# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28344.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF55303.1  [L=816]
Description: spne4 ACF55303.1 GIB00761CH01 "Dna polymerase III, epsylon subunit/ATP-dependen.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.8e-27   99.3   0.1    1.3e-26   96.5   0.1    2.3  1  PF00929  Exonuclease
    9.3e-09   37.6   1.9    1.4e-05   27.3   1.3    3.4  1  PF00270  DEAD/DEAH box helicase
     0.0013   21.2   0.0     0.0041   19.6   0.0    1.9  1  PF04851  Type III restriction enzyme, res subunit
  ------ inclusion threshold ------
       0.06   15.8   0.0        1.3   11.5   0.0    3.0  1  PF00271  Helicase conserved C-terminal domain
        1.6   11.0   0.0        3.4    9.9   0.0    1.5  1  PF05455  GvpH
        4.5    8.4   0.0        8.4    7.5   0.0    1.4  1  PF02534  TraG/TraD family
         11    8.3   0.2    2.2e+02    4.1   0.0    2.8  2  PF07366  SnoaL-like polyketide cyclase
         15    8.1   0.2         69    6.0   0.1    2.1  1  PF12179  I-kappa-kinase-beta NEMO binding domain
         21    7.5   0.1         72    5.8   0.0    1.9  1  PF09876  Predicted metal-binding protein (DUF2103)
         27    6.9   0.1         58    5.8   0.1    1.5  1  PF03352  Methyladenine glycosylase
         52    4.4   0.0         77    3.9   0.0    1.2  1  PF03094  Mlo family
         73    3.6   0.0    1.1e+02    3.0   0.0    1.2  1  PF07999  Retrotransposon hot spot protein
    1.1e+02    3.8   0.0    2.8e+02    2.5   0.0    1.5  1  PF03246  Pneumovirus nucleocapsid protein
    1.3e+02    5.1   0.0    3.7e+02    3.6   0.0    1.7  1  PF10857  Protein of unknown function (DUF2701)
    1.3e+02    4.6   0.0    3.8e+02    3.1   0.0    1.7  1  PF04432  Coenzyme F420 hydrogenase/dehydrogenase, beta subun
    2.2e+02    4.4   1.0    8.9e+02    2.5   0.5    2.3  1  PF05184  Saposin-like type B, region 1
    4.2e+02    3.6   0.0    9.8e+02    2.4   0.0    1.6  1  PF03610  PTS system fructose IIA component
    5.1e+02    3.5   0.0    1.1e+03    2.5   0.0    1.4  1  PF07983  X8 domain
    5.3e+02    3.5   0.0      1e+03    2.6   0.0    1.3  1  PF11667  Protein of unknown function (DUF3267)
    5.9e+02    2.9   4.9    1.4e+02    4.9   0.5    2.2  1  PF08181  DegQ (SacQ) family
    6.1e+02    2.9   0.1    1.4e+03    1.7   0.0    1.5  1  PF04678  Protein of unknown function, DUF607
    9.3e+02    2.5   0.1    2.6e+03    1.1   0.0    1.7  1  PF08043  Xin repeat


Domain and alignment annotation for each model:
>> PF00929  Exonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.5   0.1   2.8e-30   1.3e-26       1     165 []       8     162 ..       8     162 .. 0.96

  Alignments for each domain:
  == domain 1    score: 96.5 bits;  conditional E-value: 2.8e-30
                 EEEEEEEE--BTTTTS-EEEEEEEEEETTCCEEEEEEEEEEEHSSHCSS-HHHHHHHHH-HHHHHCSEEHHHHHHHHHHHHHHHTEEEETTHHHCEHHH CS
     PF00929   1 lvviDcEttgldaekdeiieiaavsivggeeeigetfdtyvkpeedakitdeateftgitqedldkapsfeevleelkellrklkllvahnaafdvgfl 99 
                 +vv+D+E t++   k++ii+++ v i +ge  i  ++ t v+p+e+  +++ + e+tg t++ l +ap f +v++++++l++ + ++vahn+ fd++ l
  ACF55303.1   8 YVVVDLEATSTGS-KAKIIQVGIVVIEDGE--IVDHYTTDVNPHEP--LDAHIKELTGLTDQRLAQAPDFSQVARKIFDLVE-DGIFVAHNVQFDANLL 100
                 69**********7.9***************..9999**********..**********************************.88************** PP

                 HHHHHHHHHHHCHHHHHCSECHHHHHHHHHHHHHHCHHHHHHHTTHHHTTHTSHHHHHHHHHHHHH CS
     PF00929 100 lqddlrflklempkrndvldtlildkktlkelkrtslkklaekllleeiqraHrAldDarataelf 165
                  ++++  +++    rn+ +dt++l++  ++el+++sl+ l+++l+++ +  aH+Al+Da+atael+
  ACF55303.1 101 AENLFFEGYE---LRNPRVDTVELAQVFFPELEKYSLPILCRELGIPLKH-AHTALSDAQATAELL 162
                 ****987666...79*********************************98.6************96 PP

>> PF00270  DEAD/DEAH box helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.3   1.3     3e-09   1.4e-05      17      73 ..     266     318 ..     253     587 .. 0.89

  Alignments for each domain:
  == domain 1    score: 27.3 bits;  conditional E-value: 3e-09
                 EEEEE------HHHHHHHHHHHHHCTTT-S-SEEEE-SSHHHHHHHHHHHHHHTTT.S CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.x RF
     PF00270  17 vlvaaeTGsGKTlaflipvlqilyetlpnapkalivaPtreLaeqtlenlkkfkky.l 73 
                  l++a+TG GKT  +l+p+l++ +     + ++++ +Pt+ L +q++e+  k++k+  
  ACF55303.1 266 SLIQAPTGIGKTYGYLLPALSQSK-----ERQIVLSVPTKILQNQIMEEEGKRLKEvF 318
                 589*****************4444.....667***************99888877542 PP

>> PF04851  Type III restriction enzyme, res subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.6   0.0     9e-07    0.0041       3      70 ..     244     310 ..     227     387 .. 0.79

  Alignments for each domain:
  == domain 1    score: 19.6 bits;  conditional E-value: 9e-07
                 EE-HHHHHHHHHHT.......TTT---EEE------HHHHHHHHHHH-S..-EEEEESSHHHHHHHHHH- CS
     PF04851   3 klrpyQeeaienllesiekedekkrglivmaTGtGKTlvaasliarlar..kflflvprkelleqaleef 70 
                 ++r+ Qe   +++   +++e   +  li+++TG GKT+ ++  ++   +  ++++ vp+k+l +q +ee 
  ACF55303.1 244 EVREEQESFAKEVGLLLKDE---PVSLIQAPTGIGKTYGYLLPALSQSKerQIVLSVPTKILQNQIMEEE 310
                 66777777777777666666...999**************9655555557899999**********9876 PP

>> PF00271  Helicase conserved C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.5   0.0   0.00029       1.3      27      76 ..     682     763 ..     667     765 .. 0.90

  Alignments for each domain:
  == domain 1    score: 11.5 bits;  conditional E-value: 0.00029
                 HHHHTTSSSEEEESSCCT----STTEEEEEESST................................TSSHHHHHHH----CT CS
     PF00271  27 eqFnagkskvlvatnvaerGidlpdvnlVinfdl................................prsvtsyiQriGRagR 76 
                 ++F +g+ ++l+    + +G+d+ +  +Vi++ +                                p+    + Q++GR +R
  ACF55303.1 682 KRFEKGEQQILLGAASFWEGVDFSSHPFVIQVVPrlpfqnpqepltkkinqelnqegknafydyqlPMAIIRLKQALGRSMR 763
                 79******************************99999999999999999999999999999999999999999999999998 PP

>> PF05455  GvpH
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.0   0.00076       3.4      90     132 ..     598     638 ..     584     646 .. 0.84

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.00076
     PF05455  90 ksihvetresddgelvvvaDLPgvtDeealDvaletdesaltl 132
                 k +++e r++++ e+v+v D+P vt e++l+v    ++ al +
  ACF55303.1 598 KFVKIESRGKQEQEVVMVKDFPLVT-ETSLEVYAR-EVAALLV 638
                 5689********************6.666999765.6666655 PP

>> PF02534  TraG/TraD family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0018       8.4      45     112 ..     264     330 ..     222     350 .. 0.78

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0018
     PF02534  45 ehvlvvAptrsgKgvgvviPnllkwkq.siVvlDpkgElaeltskiRkkqgrkVfvlePanlktsdrfN 112
                 + +l+ Apt+ gK+ g+ +P l + k+  iV   p + l + + +   k++++Vf  +  +lk+   +N
  ACF55303.1 264 PVSLIQAPTGIGKTYGYLLPALSQSKErQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGP--QN 330
                 568999****************9999867777777777888888888888888888888888877..44 PP

>> PF07366  SnoaL-like polyketide cyclase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.048   2.2e+02      90     113 ..      17      40 ..      10      44 .. 0.89
   2 ?    0.5   0.0      0.62   2.8e+03       4      34 ..     379     409 ..     376     442 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.048
                 ----EEEEEEEEEEEEETTEEEEE CS
     PF07366  90 ptGkkvkfeeitllrvedGkIvee 113
                  tG k k+ ++ ++ +edG+Iv++
  ACF55303.1  17 STGSKAKIIQVGIVVIEDGEIVDH 40 
                 599*******************98 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 0.62
                 HHHHHHHHHTT-GCCGGGCEEEEEEEE.TTT CS
     PF07366   4 lrfyeevwnsgdldaldelvaedvvdhnpee 34 
                 + f++++ + g+l+    +v+ed+  +++e 
  ACF55303.1 379 QHFLADLRHDGNLSSHSLFVTEDFWKRSQER 409
                 67999999****************9998765 PP

>> PF12179  I-kappa-kinase-beta NEMO binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.1     0.015        69       5      23 ..     441     459 ..     439     463 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.015
     PF12179   5 leEnlnllsqLesvlqetm 23 
                 + E ++ l  Le++lqet 
  ACF55303.1 441 IDEVQKILLALENLLQETY 459
                 7899*************96 PP

>> PF09876  Predicted metal-binding protein (DUF2103)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.016        72      16      43 ..     778     805 ..     775     811 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.016
     PF09876  16 liggreGkklikkiakhpevKkviPgvi 43 
                 ++g+r Gk+++ ++a+   vK++  + +
  ACF55303.1 778 IVGKRYGKQIVASLAEEATVKTISRSEV 805
                 79********************976665 PP

>> PF03352  Methyladenine glycosylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.1     0.013        58      27      62 ..     489     525 ..     480     556 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.013
     PF03352  27 felLvL.egaqaglsWltiLkkreafreaFagfdvek 62 
                 fe+L L e++q+g s + iL   +++++ F++ +ve 
  ACF55303.1 489 FECLYLiEQFQSGKSRKNILDSLDNLHQYFSELEVEG 525
                 89997659***********************999875 PP

>> PF03094  Mlo family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.017        77     257     308 ..     614     665 ..     610     758 .. 0.77

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.017
     PF03094 257 leddfkkvvgispvlWvvvvlflllnvnglktylwisfiPlilllavGtkLe 308
                 + +df  v + s+++++  v  ll+++++++  +++ f    +llav   L 
  ACF55303.1 614 MVKDFPLVTETSLEVYAREVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLT 665
                 679************************************9999999987664 PP

>> PF07999  Retrotransposon hot spot protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0     0.025   1.1e+02     572     630 ..     744     802 ..     727     809 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.025
     PF07999 572 ayieqkileklrelldqanlreyalfkallskaliaAdifekvgiaafvdvnllleiak 630
                  y+  + + +l++ l ++  rey+   +l+ ++ i+ + ++k ++a++ +++++ +i +
  ACF55303.1 744 DYQLPMAIIRLKQALGRSMRREYQRSLTLILDRRIVGKRYGKQIVASLAEEATVKTISR 802
                 4666678899********999***********************************987 PP

>> PF03246  Pneumovirus nucleocapsid protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0     0.062   2.8e+02      94     217 ..      10     133 ..       4     151 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.062
     PF03246  94 ltdlktftlkleGkeskievldisgiekaileeiekearktvakllkekaeipknqrhdapdagvillciaalvvtklaatvrvGleavirranrvlkd 192
                  +dl+  +   + k+ ++ ++ i++ e       + +  + +   +ke + +++++  +apd + +   i  lv   +  + +v ++a +   n  ++ 
  ACF55303.1  10 VVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDVNPHEPLDAHIKELTGLTDQRLAQAPDFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEG 108
                 55666666666666666666666666666666678888999999********************************************99988888899 PP

     PF03246 193 elkryprldikkiaksfyelfekkv 217
                    r pr+d  ++a+ f+  +ek+ 
  ACF55303.1 109 YELRNPRVDTVELAQVFFPELEKYS 133
                 999***************9999985 PP

>> PF10857  Protein of unknown function (DUF2701)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.082   3.7e+02      27      50 ..     349     372 ..     347     376 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.082
     PF10857  27 alnkikikilklttrrsFtqLdnv 50 
                 +++++k+++l ++t ++   Ld++
  ACF55303.1 349 LFRRFKMQVLVWLTETETGDLDEI 372
                 799**************9999986 PP

>> PF04432  Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.083   3.8e+02      44      97 ..     512     572 ..     509     573 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.083
     PF04432  44 evlrkyleeklgvdped.vkkiefrkgkfsvelkdggeleiplkel.......eeylrpsCk 97 
                 + l++y++e l+v+  d ++++   +g++++e+ + ++++i+++++         +l++sC+
  ACF55303.1 512 DNLHQYFSE-LEVEGFDeLVRYFTAEGDYWLEVTETSQKKIQISSTksgrtllSSLLPESCQ 572
                 678899999.67777666777777779******99999999999997777777777777776 PP

>> PF05184  Saposin-like type B, region 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.5       0.2   8.9e+02      14      34 ..     451     471 ..     445     471 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.2
     PF05184  14 vekllkdnkteeeIikaldkv 34 
                 +e+ll++ +  + Ii+++dk+
  ACF55303.1 451 LENLLQETYDIQSIIDLIDKA 471
                 89*****************95 PP

>> PF03610  PTS system fructose IIA component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.22   9.8e+02      63     115 ..     588     640 ..     582     641 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.22
                 EE----HHHHHHHHHCT-SS....EEEE--S-S----HHHHHHHH----HHHH CS
     PF03610  63 lvDlgggtpfneaallllekedievitglnlPlveeavaarasasleelveei 115
                 l+Dl+g    + +  +   k++ ev+ + + Plv e+  ++ + ++ +l+ ei
  ACF55303.1 588 LADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYAREVAALLVEI 640
                 778887777777777888888899**************999888888877666 PP

>> PF07983  X8 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.23   1.1e+03      44      67 ..     391     414 ..     386     428 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.23
                 TTHHHHHHHHHHHHH----GGG-- CS
     PF07983  44 vkahasyafnsYyqkqkkaksaCd 67 
                 + +h  ++ +++++++++++++C+
  ACF55303.1 391 LSSHSLFVTEDFWKRSQERAETCK 414
                 678999*****************8 PP

>> PF11667  Protein of unknown function (DUF3267)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.22     1e+03      69     107 ..     637     675 ..     632     678 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.22
     PF11667  69 illllplashllifllalntagcvgDflllllllkqpks 107
                 ++ + ++++++l++++a  + ++v D+l +  l++++++
  ACF55303.1 637 LVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNG 675
                 444456999************************999765 PP

>> PF08181  DegQ (SacQ) family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.5     0.031   1.4e+02       6      25 ..     441     460 ..     439     471 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.031
     PF08181   6 iEElKqLLwrLENeiRETtd 25 
                 i+E++++L  LEN + ET d
  ACF55303.1 441 IDEVQKILLALENLLQETYD 460
                 89****************87 PP

>> PF04678  Protein of unknown function, DUF607
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.31   1.4e+03      30      73 ..     648     691 ..     609     694 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.31
     PF04678  30 gvllrPkkvkklverllellkveeeklsreeelrkrleelkeel 73 
                 +vl   k++  +v  ll++ +++++k+   ++l+kr e+ ++++
  ACF55303.1 648 LVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQI 691
                 335567889999*************************9999886 PP

>> PF08043  Xin repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.57   2.6e+03       1      11 [.     675     685 ..     675     685 .. 0.97

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.57
     PF08043   1 GDVkttrwlFE 11 
                 GDV++ ++ FE
  ACF55303.1 675 GDVHQLKKRFE 685
                 9*********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (816 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       500  (0.0419745); expected 238.2 (0.02)
Passed bias filter:                      265  (0.0222465); expected 238.2 (0.02)
Passed Vit filter:                        23  (0.00193083); expected 11.9 (0.001)
Passed Fwd filter:                        22  (0.00184688); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              22  [number of targets reported over threshold]
# CPU time: 0.47u 0.04s 00:00:00.51 Elapsed: 00:00:00
# Mc/sec: 3748.22
//