# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28340.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF55636.1  [L=232]
Description: spne4 ACF55636.1 GIB00761CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-63  217.2   9.2    1.3e-63  217.0   6.4    1.0  1  PF09922  Predicted membrane protein (DUF2154)
  ------ inclusion threshold ------
        1.5   10.1   3.7        1.9    9.7   2.6    1.2  1  PF09913  Predicted membrane protein (DUF2142)
        2.1   10.7   0.1        2.1   10.7   0.0    3.4  1  PF11137  Protein of unknown function (DUF2909)
        3.3    9.8   0.6          9    8.4   0.0    2.0  1  PF07545  Vestigial/Tondu family
        4.3    9.9   8.7        5.2    9.6   5.4    1.7  1  PF10998  Protein of unknown function (DUF2838)
         18    6.8   0.0         34    5.9   0.0    1.3  1  PF04541  Herpesvirus virion protein U34
         23    6.1   3.5         33    5.6   2.4    1.2  1  PF09972  Predicted membrane protein (DUF2207)
         24    7.2   0.0         52    6.2   0.0    1.5  1  PF08865  Domain of unknown function (DUF1830)
         25    6.8   1.5         52    5.8   1.0    1.7  1  PF08475  Viral capsid protein 91 N-terminal
         27    7.3   0.2         51    6.4   0.1    1.5  1  PF08796  Protein of unknown function (DUF1797)
         27    7.1   0.0         74    5.7   0.0    1.8  1  PF00203  Ribosomal protein S19
         31    6.5   0.0         47    5.9   0.0    1.3  1  PF11794  4-hydroxyphenylacetate 3-hydroxylase N terminal
         36    7.2   0.1         84    6.0   0.0    1.6  1  PF03765  CRAL/TRIO, N-terminus
         38    7.6   0.1         63    6.9   0.0    1.3  1  PF10783  Protein of unknown function (DUF2599)
         40    6.2   1.5         61    5.6   1.0    1.4  1  PF12263  Protein of unknown function (DUF3611)
         48    6.4   0.1      2e+02    4.4   0.0    2.1  1  PF04588  Hypoxia induced protein conserved region
         56    5.6   0.2         96    4.9   0.1    1.3  1  PF11359  Glycoprotein UL132
         59    6.0   0.3    1.4e+02    4.8   0.2    1.6  1  PF09574  Protein  of unknown function (Duf2374)
         66    5.1   0.1      1e+02    4.5   0.0    1.3  1  PF01028  Eukaryotic DNA topoisomerase I, catalytic core
         71    6.2   2.3    2.3e+02    4.6   1.6    1.8  1  PF09928  Predicted small integral membrane protein (DUF2160)
         76    5.7   0.4      4e+02    3.4   0.1    2.0  1  PF08239  Bacterial SH3 domain
         84    6.1   0.0    1.9e+02    5.0   0.0    1.5  1  PF04122  Putative cell wall binding repeat 2
         96    5.1   0.0    1.5e+02    4.4   0.0    1.2  1  PF11350  Protein of unknown function (DUF3152)
      1e+02    6.2   0.5    5.2e+02    4.0   0.0    2.4  1  PF07723  Leucine Rich Repeat
    1.1e+02    5.5   0.0    2.1e+02    4.7   0.0    1.4  1  PF09702  CRISPR-associated protein (Cas_Csa5)
    1.2e+02    3.9   8.4    2.5e+02    2.8   5.8    1.5  1  PF09852  Predicted membrane protein (DUF2079)
    1.3e+02    4.8   1.7    3.8e+02    3.3   1.1    1.8  1  PF04805  E10-like protein conserved region
    1.5e+02    4.6   0.0    2.4e+02    4.0   0.0    1.4  1  PF11923  Domain of unknown function (DUF3441)
    2.7e+02    4.1   0.1    3.8e+02    3.6   0.0    1.2  1  PF02084  Bindin
      3e+02    3.4   2.9      5e+02    2.7   2.0    1.4  1  PF11833  Protein of unknown function (DUF3353)
    3.1e+02    3.0   0.1    1.6e+03    0.7   0.0    1.7  1  PF07910  Peptidase family C78
    3.5e+02    2.9   0.0    5.7e+02    2.2   0.0    1.3  1  PF01866  Putative diphthamide synthesis protein
      4e+02    3.6   0.0      7e+02    2.9   0.0    1.3  1  PF07123  Photosystem II reaction centre W protein (PsbW)
    4.8e+02    3.7   0.2    1.2e+03    2.4   0.1    1.6  1  PF00014  Kunitz/Bovine pancreatic trypsin inhibitor domain
    4.9e+02    1.6   4.3    6.7e+02    1.1   2.9    1.3  1  PF07916  TraG-like protein, N-terminal region
      6e+02    2.9   6.2    4.9e+02    3.2   1.0    2.9  1  PF12409  P-type ATPase transporter
    7.1e+02    2.4   6.9    8.7e+02    2.1   3.4    1.9  1  PF04246  Positive regulator of sigma(E), RseC/MucC
    8.1e+02    2.7   6.8    1.7e+02    4.8   2.0    2.0  1  PF06667  Phage shock protein B
    1.3e+03    1.7   3.7    8.5e+02    2.3   0.7    1.9  1  PF10161  Putative mitochondrial precursor protein
    1.5e+03    0.4   0.0    1.9e+03   -0.0   0.0    1.1  1  PF06286  Coleoptericin
    1.5e+03    1.9   9.7    1.2e+02    5.4   0.4    2.4  2  PF07178  TraL protein
    1.7e+03    1.2   1.3    3.5e+03    0.2   0.9    1.4  1  PF02044  Bombesin-like peptide


Domain and alignment annotation for each model:
>> PF09922  Predicted membrane protein (DUF2154)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.0   6.4   5.3e-67   1.3e-63       1     233 []       5     229 ..       5     229 .. 0.98

  Alignments for each domain:
  == domain 1    score: 217.0 bits;  conditional E-value: 5.3e-67
     PF09922   1 siflligallllkalglilseegslfllllplllillgyyllkkrkfklgnvlliiglillllsllsfnlvilllplaliylgikliskkkkeerakak 99 
                 +ifl+i+a+ll+ al+l++se++s+fll+l l+l+l++yy+ k+     +n+ll++++il++++++ +++vil++++a+iy ++ l+  +++e++++  
  ACF55636.1   5 KIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEG----NNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNL 99 
                 58****************************************999....9******************************************9999999 PP

     PF09922 100 irkeeeekekpsaetlkrnnwfGdqrtved..syefkdiniqngiGdtvIDLskavlpegetvIvirkliGdvkilVPsdvevsldvsaifGgvdlfde 196
                 +++e  + +k+      +n+wfG+ +++++  +++f+din+ +++G+++I+L++++l+++++vI++rk++G +ki+VP+dvevsl+v++++G++++f++
  ACF55636.1 100 VFEEVVTVKKE------KNRWFGNLHHFSSyqTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQ 192
                 99998888888......5**********9888******************************************************************* PP

     PF09922 197 eeeglrneslrvksedydeaerklkIvvslliGdveV 233
                  ++ lrne+ + +++dy ++++++kI+++++iGdveV
  ACF55636.1 193 PKRALRNEHYHQETKDYLKSNKSVKIFLTTMIGDVEV 229
                 ************************************9 PP

>> PF09913  Predicted membrane protein (DUF2142)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   2.6    0.0008       1.9     173     224 ..      30      80 ..       2     123 .. 0.53

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.0008
     PF09913 173 ialafllfalllrlslekkltrrllillllaavllalskppyvllallvlli 224
                 ++l+++lf ll+r+++ k++ + ll+++ ++++++++   p+v la+ v++i
  ACF55636.1  30 FLLILFLFLLLIRYYTGKEGNNLLLVAATILFFFIVMLN-PFVILAIFVAVI 80 
                 344455555555555555555554444444444444444.223333322222 PP

>> PF11137  Protein of unknown function (DUF2909)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.7   0.0   0.00089       2.1       3      33 ..      70      99 ..      69     104 .. 0.81

  Alignments for each domain:
  == domain 1    score: 10.7 bits;  conditional E-value: 0.00089
     PF11137  3 ilivllLlaivaSLgsALfflvkdkgkskrm 33
                ++i+++++a+++SL+  L+ ++ ++++++++
  ACF55636.1 70 FVILAIFVAVIYSLFL-LYPMMNQEKEQTNL 99
                79*************8.77777776666555 PP

>> PF07545  Vestigial/Tondu family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.0    0.0038         9      20      29 ..      22      31 ..      17      33 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0038
     PF07545 20 vVDEHFSRAL 29
                +V EHFSR L
  ACF55636.1 22 MVSEHFSRFL 31
                89******66 PP

>> PF10998  Protein of unknown function (DUF2838)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   5.4    0.0022       5.2       7      70 ..       8      73 ..       2     108 .. 0.76

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0022
     PF10998  7 fgvlnlllsgfligkvPellllvytvallvlmpirlytykkkklhyFllD..lCyflnallllflw 70
                + +  +ll+g li +v e++  +  +++l+l+ ir+yt k+ ++  +++   l +f+ +l+ +++ 
  ACF55636.1  8 LFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLVAAtiLFFFIVMLNPFVIL 73
                445567799*****************************9999998888888777777777666663 PP

>> PF04541  Herpesvirus virion protein U34
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.014        34      89     120 ..     189     220 ..     185     225 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.014
     PF04541  89 FlsePrdaqsgaltaeesnviLkknesvglsl 120
                 F+++P++a   ++ ++e+  +Lk+n+sv + l
  ACF55636.1 189 FFNQPKRALRNEHYHQETKDYLKSNKSVKIFL 220
                 9*******5556666666667******99866 PP

>> PF09972  Predicted membrane protein (DUF2207)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   2.4     0.014        33     405     448 ..      31      86 ..      16     125 .. 0.58

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.014
     PF09972 405 illlilsfiliifllalfag.lllaalvllvivlvigliialll...........l 448
                 +l+l+l+++li++++ ++ + lll a+ +l++++v+++ +++l            l
  ACF55636.1  31 LLILFLFLLLIRYYTGKEGNnLLLVAATILFFFIVMLNPFVILAifvaviyslflL 86 
                 34555555555455554444044444444444444443333333335555554443 PP

>> PF08865  Domain of unknown function (DUF1830)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.022        52      10      29 ..     132     151 ..     126     157 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.022
     PF08865  10 mvvlriigeenfYlErVvfP 29 
                 +  +r +g+++ +lErV++ 
  ACF55636.1 132 INLFRFMGKDTIHLERVILT 151
                 66799*************86 PP

>> PF08475  Viral capsid protein 91 N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   1.0     0.022        52       4      63 ..      70     129 ..      53     155 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.022
     PF08475   4 vvilllivflilylvivkdfdeeefekrlkvlkeylkrtnaeeplpdvlsyvseVdenlY 63 
                 +vil ++v +i++l++   + ++e e+   v++e +  +++++  + +l++ s+ ++ ++
  ACF55636.1  70 FVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHHFSSYQTCQF 129
                 588889999999999999999999999999********9999999999999998766555 PP

>> PF08796  Protein of unknown function (DUF1797)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.1     0.021        51      28      58 ..     104     134 ..      86     137 .. 0.73

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.021
     PF08796  28 laeVsydektetfeleevkdkekfqFDniDl 58 
                 + +V+ ++++   +l++++  ++ qFD+i l
  ACF55636.1 104 VVTVKKEKNRWFGNLHHFSSYQTCQFDDINL 134
                 4555544444445899*************98 PP

>> PF00203  Ribosomal protein S19
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.031        74       5      46 ..     126     166 ..     122     170 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.031
                 SS----HHHHHHHHHHHHH---S----S-TT----GGG---E CS
     PF00203   5 kkpfvalkllkkakkenekkekeviktwsRrstilPemvGst 46 
                 + +f +++l++ + k + + e+ vi t   + +il +mvG t
  ACF55636.1 126 TCQFDDINLFRFMGKDTIHLER-VILTNHDNVIILRKMVGTT 166
                 5678899999999999999996.9****************87 PP

>> PF11794  4-hydroxyphenylacetate 3-hydroxylase N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0      0.02        47     120     150 ..     192     231 ..     161     232 .] 0.83

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.02
                 -.........HHHHHHHHHHHHHHHT--EEEEES--SS-T CS
     PF11794 120 t.........yaenikkylkyvqendlvlthaitdpkgdR 150
                 +         y+++ k+ylk  ++ +++lt++i d+++ R
  ACF55636.1 192 QpkralrnehYHQETKDYLKSNKSVKIFLTTMIGDVEVVR 231
                 3333344478**************************9998 PP

>> PF03765  CRAL/TRIO, N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.035        84       5      37 ..      98     137 ..      93     138 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.035
                 HHHHHHHH................HTT--SS-SHHHHHHH CS
     PF03765   5 kellkalpdlikkk.......eevddkekekltDellLRF 37 
                 + +++ + + +k+k       + ++ +  + ++D  l+RF
  ACF55636.1  98 NLVFEEVVTVKKEKnrwfgnlHHFSSYQTCQFDDINLFRF 137
                 55788889999999999999999****************9 PP

>> PF10783  Protein of unknown function (DUF2599)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.026        63      26      74 ..      92     146 ..      89     153 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.026
     PF10783  26 aakeqtdaayaellalspddkew.adtasmraqlvChle...var..dktswnLE 74 
                  +keqt+ +++e+++ ++++++w  + + + +   C ++   ++r  +k + +LE
  ACF55636.1  92 QEKEQTNLVFEEVVTVKKEKNRWfGNLHHFSSYQTCQFDdinLFRfmGKDTIHLE 146
                 567889*************9***88888888888888764333336677777776 PP

>> PF12263  Protein of unknown function (DUF3611)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   1.0     0.026        61     154     178 ..      62      86 ..      34      91 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.026
     PF12263 154 vllvlantntilahfiGlvvsLwLL 178
                  ++v+ n  +ila f+ ++ sL+LL
  ACF55636.1  62 FFIVMLNPFVILAIFVAVIYSLFLL 86 
                 69**********************9 PP

>> PF04588  Hypoxia induced protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.085     2e+02       3      35 ..      67      99 ..      65     102 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.085
     PF04588  3 enplvpiGclatagallaglysmkrGnsktsqk 35
                 np+v +++   ++  l+ ly m++ ++ +++ 
  ACF55636.1 67 LNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNL 99
                59********9999999******9777777776 PP

>> PF11359  Glycoprotein UL132
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1      0.04        96      41      77 ..      47      83 ..      42     112 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.04
     PF11359 41 kepndvvekvlaivvyivsgvsilsllvvlvavlyss 77
                ke n+ +    +i+++ ++    + +l++ vav+ys 
  ACF55636.1 47 KEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSL 83
                555666777789999999999**************96 PP

>> PF09574  Protein  of unknown function (Duf2374)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.2     0.058   1.4e+02      18      36 ..      69      86 ..      67      92 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.058
     PF09574 18 PvIiLsGFvaVavvsillL 36
                P++iL+ FvaV   s+ lL
  ACF55636.1 69 PFVILAIFVAVI-YSLFLL 86
                9*********95.455554 PP

>> PF01028  Eukaryotic DNA topoisomerase I, catalytic core
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.043     1e+02      91     120 ..     134     163 ..      97     172 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.043
                 EEEE-------EEEEEE.-HHHHHHHHHH. CS
     PF01028  91 tldFlGKdsiryentvkvdkrvyknlkkfl 120
                  ++F+GKd i+ e+ + ++++ +++l+k++
  ACF55636.1 134 LFRFMGKDTIHLERVILTNHDNVIILRKMV 163
                 499***********9999999999998875 PP

>> PF09928  Predicted small integral membrane protein (DUF2160)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   1.6     0.095   2.3e+02      52      85 ..      53      86 ..      47      89 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.095
     PF09928 52 LlgaayinLawlglveaslwvalvlsllylvlvl 85
                Ll aa i  +++ ++++ + +a+ ++++y +++l
  ACF55636.1 53 LLVAATILFFFIVMLNPFVILAIFVAVIYSLFLL 86
                899**************************99876 PP

>> PF08239  Bacterial SH3 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.17     4e+02      23      35 ..     103     115 ..      97     116 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.17
     PF08239  23 ekvtvlgeengWy 35 
                 e+vtv++e+n W+
  ACF55636.1 103 EVVTVKKEKNRWF 115
                 89**********7 PP

>> PF04122  Putative cell wall binding repeat 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.078   1.9e+02      58      84 ..     200     229 ..     196     231 .. 0.69

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.078
     PF04122  58 kklssetkdylkskkskkvyii...Ggens 84 
                 +++ +etkdylks+ks k+ +    G +++
  ACF55636.1 200 EHYHQETKDYLKSNKSVKIFLTtmiGDVEV 229
                 56679*********7777755433366665 PP

>> PF11350  Protein of unknown function (DUF3152)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.065   1.5e+02      71     139 ..     141     209 ..     135     213 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.065
     PF11350  71 gklafervdegapdlriklaspeTvrelCagleiele..vsCakaagervvineaRWvrgavefegdlgsY 139
                 +++ +erv  +++d +i l     ++++ ++ ++e+   v+C +  g+  + n+ +      +++++ + Y
  ACF55636.1 141 DTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSlsVNCLY--GDLTFFNQPKRALRNEHYHQETKDY 209
                 56778899999999999999888777777566655542277888..9999999988888888888888887 PP

>> PF07723  Leucine Rich Repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.22   5.2e+02       4      16 ..     142     154 ..     142     159 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.22
     PF07723   4 tLhLdsvdfddde 16 
                 t hL++v  ++++
  ACF55636.1 142 TIHLERVILTNHD 154
                 67*********97 PP

>> PF09702  CRISPR-associated protein (Cas_Csa5)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.089   2.1e+02      66      93 ..     204     231 ..     190     232 .] 0.83

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.089
     PF09702  66 yivvgklpsdedvesFleeverDiyvAr 93 
                 +++  +l s++ v+ Fl ++  D+ v r
  ACF55636.1 204 QETKDYLKSNKSVKIFLTTMIGDVEVVR 231
                 556789*************999998866 PP

>> PF09852  Predicted membrane protein (DUF2079)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   5.8      0.11   2.5e+02     137     197 ..      13      71 ..      10     126 .. 0.63

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.11
     PF09852 137 fillllllllvkedlalvvvalglwlllrrrkrkkrrkglillllglawfllvtkviiPlf 197
                 ++l  +l+l+v+e ++ ++++l l lll r ++ k+  +l+l+++ +++f++v+  ++P++
  ACF55636.1  13 CLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLVAATILFFFIVM--LNPFV 71 
                 567778999999999999999999999999777544444444444444444444..33333 PP

>> PF04805  E10-like protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   1.1      0.16   3.8e+02      42      55 ..      58      71 ..      50      77 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.16
     PF04805 42 yiyfFfislfNnla 55
                 i+fFfi + N ++
  ACF55636.1 58 TILFFFIVMLNPFV 71
                69*******99875 PP

>> PF11923  Domain of unknown function (DUF3441)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0       0.1   2.4e+02      72     111 ..     191     230 ..     157     232 .] 0.87

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.1
     PF11923  72 kkvdesakekdlaprelelikslkdeeivntlpvgkvkiv 111
                 ++++   +++   ++ ++++ks k+ +i  t ++g+v +v
  ACF55636.1 191 NQPKRALRNEHYHQETKDYLKSNKSVKIFLTTMIGDVEVV 230
                 6677777888889999*******************99876 PP

>> PF02084  Bindin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0      0.16   3.8e+02     109     124 ..     159     174 ..     128     178 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.16
     PF02084 109 ikavLGAtKiDLPvDi 124
                 ++ ++G tKi +PvD+
  ACF55636.1 159 LRKMVGTTKIIVPVDV 174
                 67889**********8 PP

>> PF11833  Protein of unknown function (DUF3353)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   2.0      0.21     5e+02      97     130 ..      32      64 ..      20      88 .. 0.75

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.21
     PF11833  97 lvlfgllalllllvpaeespeLllalslgaliyf 130
                 l+lf +l+l+ +++  +e+ +Lll+++++  ++ 
  ACF55636.1  32 LILFLFLLLIRYYT-GKEGNNLLLVAATILFFFI 64 
                 56777888888887.8899999999988876654 PP

>> PF07910  Peptidase family C78
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.0      0.66   1.6e+03     173     219 .]      81     127 ..      73     127 .. 0.78

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 0.66
     PF07910 173 lnlLvlDPhyktaaiekllkekggvswekalrrgaktlkkkkqynll 219
                 ++l +l P++++++ + +l  ++ v+ +k   r    l++ + y+ +
  ACF55636.1  81 YSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHHFSSYQTC 127
                 5688899***9996666666666677778888888888888888876 PP

>> PF01866  Putative diphthamide synthesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.24   5.7e+02     118     176 ..     101     159 ..      85     174 .. 0.77

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.24
     PF01866 118 ieveigkpqsrplspgqvlGctfsalkeeddadavlyvGdgrfhllgvalatkkpvlay 176
                 +e ++++++++ ++ g++   ++ +  + dd + + ++G++  hl+ v l+++ +v+++
  ACF55636.1 101 FEEVVTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIIL 159
                 556677777777888888887777764448889999**************998888876 PP

>> PF07123  Photosystem II reaction centre W protein (PsbW)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.29     7e+02     105     130 ..      71      96 ..      67     100 .. 0.74

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.29
     PF07123 105 wiLlgvfgliwslYfiytkqleeded 130
                  iL+   ++i+sl+++y+   +e+e 
  ACF55636.1  71 VILAIFVAVIYSLFLLYPMMNQEKEQ 96 
                 4555566789*******988777765 PP

>> PF00014  Kunitz/Bovine pancreatic trypsin inhibitor domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.49   1.2e+03      37      49 ..     116     128 ..     111     129 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.49
                 TTSSSBSSHHHHH CS
     PF00014  37 gNaNnFetkeeCe 49 
                 gN  +F++++ C+
  ACF55636.1 116 GNLHHFSSYQTCQ 128
                 8999********7 PP

>> PF07916  TraG-like protein, N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   2.9      0.28   6.7e+02     330     361 ..      51      79 ..      20     103 .. 0.80

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.28
     PF07916 330 qalpmvqaflemalyalfPlvlvlsllklgtg 361
                 + l ++ ++l++++++l P+v++++ +    +
  ACF55636.1  51 NLLLVAATILFFFIVMLNPFVILAIFVA---V 79 
                 5566777888888888888888777643...3 PP

>> PF12409  P-type ATPase transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   1.0       0.2   4.9e+02      14      42 ..       3      31 ..       1      37 [. 0.86

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.2
     PF12409 14 klrlilyyllcvltlGllyLllrWfprwr 42
                k++++l++ +c+lt+ l++++   f r+ 
  ACF55636.1  3 KFKIFLFIEACLLTGALILMVSEHFSRFL 31
                7899****************998888875 PP

>> PF04246  Positive regulator of sigma(E), RseC/MucC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   3.4      0.37   8.7e+02      80     125 ..      52      97 ..      31     107 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.37
     PF04246  80 lalllgallgqalllsellaallgllglllgflilrllakklkkks 125
                 l+l+++++l+ ++   + +++l+++++++ ++++l  + ++ k+++
  ACF55636.1  52 LLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQT 97 
                 5677777778888888999999999999999999988776666554 PP

>> PF06667  Phage shock protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   2.0     0.073   1.7e+02       4      34 ..      64      95 ..      50     112 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.073
     PF06667  4 eflavplivfvlfvapiW.liLHYrskkkksq 34
                 +++ p++++ +fva+i+ l+L Y   +++++
  ACF55636.1 64 IVMLNPFVILAIFVAVIYsLFLLYPMMNQEKE 95
                46778999999999998768888854444333 PP

>> PF10161  Putative mitochondrial precursor protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.7      0.36   8.5e+02      36      52 ..      68      84 ..      66      87 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.36
     PF10161 36 vpfGllkiilvvipgLy 52
                +pf +l+i+++vi +L+
  ACF55636.1 68 NPFVILAIFVAVIYSLF 84
                7999***********99 PP

>> PF06286  Coleoptericin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.0   0.0      0.81   1.9e+03       6      75 ..      78     147 ..      73     168 .. 0.78

  Alignments for each domain:
  == domain 1    score: -0.0 bits;  conditional E-value: 0.81
     PF06286   6 slilflvllvsaleeeerykrslqpeaanvnnndqewqvsPailrddsgntktdinvqrhgenndfeagw 75 
                  +i+ l ll   +++e+   +  + e  +v+++++ w+   + + +++     din+ r+  ++ +    
  ACF55636.1  78 AVIYSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLER 147
                 677788888888888888888899999999*******999999999999999999999987666655555 PP

>> PF07178  TraL protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.4     0.049   1.2e+02      26      67 ..      14      55 ..       3      58 .. 0.85
   2 ?    0.5   2.7       1.7   4.1e+03      24      50 ..      55      81 ..      53     100 .. 0.69

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.049
     PF07178 26 alllfvlgilsnkiliglilallvllalrklKkgkgssfllh 67
                +l+  +++++s+++  +l++ +l+ll +r+   ++g+++ll 
  ACF55636.1 14 LLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLV 55
                4566778899999***********************999986 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 1.7
     PF07178 24 ipalllfvlgilsnkiliglilallvl 50
                + a +lf++ +++n ++i  i+ ++++
  ACF55636.1 55 VAATILFFFIVMLNPFVILAIFVAVIY 81
                456677777777888777766666554 PP

>> PF02044  Bombesin-like peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.9       1.5   3.5e+03       9      12 ..     137     140 ..     137     140 .. 0.96

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.5
                 ---- CS
     PF02044   9 lMGK 12 
                 +MGK
  ACF55636.1 137 FMGK 140
                 9**9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (232 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       855  (0.0717764); expected 238.2 (0.02)
Passed bias filter:                      355  (0.0298019); expected 238.2 (0.02)
Passed Vit filter:                        55  (0.00461719); expected 11.9 (0.001)
Passed Fwd filter:                        55  (0.00461719); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              42  [number of targets reported over threshold]
# CPU time: 0.26u 0.08s 00:00:00.34 Elapsed: 00:00:01
# Mc/sec: 1926.40
//