# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28357.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF55806.1  [L=234]
Description: spne4 ACF55806.1 GIB00761CH01 "zinc ABC transporter, ATP-binding protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.2e-20   75.3   0.0    4.7e-20   74.7   0.0    1.3  1  PF00005  ABC transporter
  ------ inclusion threshold ------
        1.9    9.2   0.0        2.2    9.0   0.0    1.0  1  PF12228  Protein of unknown function (DUF3604)
        3.1   10.1   0.1    1.1e+02    5.1   0.0    2.1  2  PF03266  Protein of unknown function, DUF265
         14    8.0   0.0         24    7.2   0.0    1.3  1  PF02367  Uncharacterised P-loop hydrolase UPF0079
         29    7.1   0.0         66    6.0   0.0    1.6  1  PF05930  Prophage CP4-57 regulatory protein (AlpA)
         34    6.8   0.0         63    5.9   0.0    1.4  1  PF02625  XdhC and CoxI family
         63    5.9   0.2      1e+02    5.2   0.1    1.3  1  PF05163  DinB family
         77    5.9   0.1    3.5e+02    3.8   0.0    2.1  1  PF07372  Protein of unknown function (DUF1491)
         82    6.5   0.2    1.6e+02    5.5   0.1    1.4  1  PF09626  Dihaem cytochrome c
         92    5.5   0.0    1.5e+02    4.8   0.0    1.4  1  PF11749  Protein of unknown function (DUF3305)
    1.1e+02    5.3   0.1    2.1e+02    4.3   0.0    1.4  1  PF07208  Protein of unknown function (DUF1414)
    1.1e+02    5.3   1.4      2e+02    4.5   1.0    1.3  1  PF10986  Protein of unknown function (DUF2796)
    1.3e+02    3.2   0.0    2.6e+02    2.2   0.0    1.4  1  PF09817  Uncharacterized conserved protein (DUF2352)
    1.5e+02    5.5   0.0    2.5e+02    4.8   0.0    1.5  1  PF00188  Cysteine-rich secretory protein family
    3.7e+02    2.7   0.0    6.2e+02    2.0   0.0    1.3  1  PF09839  Uncharacterized protein conserved in bacteria (DUF2
    4.7e+02    2.8   0.0      1e+03    1.7   0.0    1.5  1  PF10948  Protein of unknown function (DUF2635)
    7.3e+02    0.9   0.0    1.3e+03    0.0   0.0    1.2  1  PF04637  Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV UL25
    7.6e+02    1.2   0.0      1e+03    0.8   0.0    1.1  1  PF03214  Reversibly glycosylated polypeptide
    7.7e+02    2.2   0.0    1.6e+03    1.2   0.0    1.4  1  PF05372  Delta lysin family


Domain and alignment annotation for each model:
>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.7   0.0   8.9e-24   4.7e-20       1     118 []      43     166 ..      43     166 .. 0.92

  Alignments for each domain:
  == domain 1    score: 74.7 bits;  conditional E-value: 8.9e-24
                 HHHHHHHTTSS------EEE-..--BGGGB-HHHHHEEEE-------....--BHHHHHH----S--.........-HHHHHHHHHH---HHHH----- CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005   1 STLlklltgelkptegeievdndrkdlesdkleklrigyipqdpllf...peltvrenldmakeekk.........tdkrieevlekvgldelldksrv 87 
                 +TL+k+ +g l+p  g++ +++ +     ++ +klri+y+pq+  +f      tv e ++ ++   k         +++ i++ l+ vg+ e++dk r 
  ACF55806.1  43 TTLIKASLGILQPRIGKVAISKTN-----TQGKKLRIAYLPQQIASFnagFPSTVYEFVKSGRYPRKgwfrrlnahDEEHIKASLDSVGMWEHRDK-RL 135
                 8********************533.....3446788***********87767899999998888877*****************************.** PP

                 -------HHHHHHHHHHTT--SEEEEESTTT CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005  88 stLSgGqkqrvalArallkkpklllLDEPtn 118
                 ++LSgGqkqr ++Ar+++++p++++LDEPt+
  ACF55806.1 136 GSLSGGQKQRAVIARMFASDPDVFILDEPTT 166
                 ******************************6 PP

>> PF12228  Protein of unknown function (DUF3604)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0   0.00042       2.2     113     222 ..      84     199 ..      34     205 .. 0.74

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.00042
     PF12228 113 aaeelpealakeakegskvaksaWketveaaeeynepgkfttligyEwtsatk....ganlHRnvifrddaklasev...vPfsalesenpeeLwdwle 204
                 +++ +p+++ + + ++ ++ ++ W + ++a +e   ++++ ++  +E+  +      g++  R vi r  a+ ++ +    P++ +++ +++e +++++
  ACF55806.1  84 FNAGFPSTVYEFV-KSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLgslsGGQKQRAVIARMFASDPDVFildEPTTGMDAGSKNEFYELMH 181
                 3444444444333.334688999************************986542123388999****9987777655422269999************** PP

     PF12228 205 aleektggsvlaipHNsN 222
                 +  +++g+ vl i H + 
  ACF55806.1 182 HSAHHHGKAVLMITHDPE 199
                 ***************875 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0      0.02   1.1e+02       2      24 ..      32      54 ..      31      90 .. 0.83
   2 ?    3.1   0.0     0.082   4.3e+02      88     136 ..     147     199 ..     113     230 .. 0.73

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.02
                EEEE-------HHHHHHHHHH-. CS
     PF03266  2 vfiTGppgvGKtTlvkkvlellk 24
                v +TG+ g   tTl+k  l  l+
  ACF55806.1 32 VTLTGENGAAXTTLIKASLGILQ 54
                789*************9888885 PP

  == domain 2    score: 3.1 bits;  conditional E-value: 0.082
                 HHHHHH.HHH-EEEE--.----GGG-H.HHHHHHHHHHT.TTSEEEEE--SS- CS
     PF03266  88 alrnal.eeadviviDE.iGkmElksk.kfieaveevls.sekpvlatihrrk 136
                 ++ +++ +++dv+++DE    m   sk +f e +++  + ++k vl+  h ++
  ACF55806.1 147 VIARMFaSDPDVFILDEpTTGMDAGSKnEFYELMHHSAHhHGKAVLMITHDPE 199
                 4445445899*******534577766526999998888878888888888885 PP

>> PF02367  Uncharacterised P-loop hydrolase UPF0079
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0046        24       9      34 ..      23      48 ..      18      62 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0046
                HHHHSS-EEEEEE-------HHHH-- CS
     PF02367  9 aellkagdvvlLsGdlGaGKTtlvkg 34
                 + ++ g+ v+L+G+ Ga  Ttl+k+
  ACF55806.1 23 NYCVDSGEFVTLTGENGAAXTTLIKA 48
                566789*****************996 PP

>> PF05930  Prophage CP4-57 regulatory protein (AlpA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.012        66      18      32 ..      90     104 ..      79     106 .. 0.92

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.012
     PF05930  18 stiYrlikdgeFPkk 32 
                 st+Y+++k g++P+k
  ACF55806.1  90 STVYEFVKSGRYPRK 104
                 8************97 PP

>> PF02625  XdhC and CoxI family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.012        63      34      54 ..     131     150 ..     126     154 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.012
     PF02625  34 adgrivGtiGGGclEadviee 54 
                 +d   +G+++GG+  ++vi++
  ACF55806.1 131 RDK-RLGSLSGGQKQRAVIAR 150
                 566.99************987 PP

>> PF05163  DinB family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.019     1e+02     129     145 ..     179     195 ..     146     201 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.019
                 HHHHHHHH---HHHHHH CS
     PF05163 129 vinHethHrGqitvllr 145
                 ++ H  hH G ++++++
  ACF55806.1 179 LMHHSAHHHGKAVLMIT 195
                 699************96 PP

>> PF07372  Protein of unknown function (DUF1491)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.067   3.5e+02      71      91 ..     142     162 ..     102     173 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.067
     PF07372  71 aevdaylererrfDpDlWvvE 91 
                 ++ +a ++r  + DpD+++++
  ACF55806.1 142 QKQRAVIARMFASDPDVFILD 162
                 45678999**********986 PP

>> PF09626  Dihaem cytochrome c
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.1     0.031   1.6e+02      21      54 ..     175     208 ..     172     229 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.031
                 HHHHHHCGGGG---------TTT---HHHHHHHT CS
     PF09626  21 sWrklladlekHfgedasldeetraeieeyLean 54 
                 +  +l++++++H+g+ + + +++ +e+++y  +n
  ACF55806.1 175 EFYELMHHSAHHHGKAVLMITHDPEEVKDYADRN 208
                 56789************************98776 PP

>> PF11749  Protein of unknown function (DUF3305)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.029   1.5e+02      80     113 ..     181     214 ..     153     221 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.029
     PF11749  80 reeeeeeelevvsvtaspyeaqdyldsgeelVek 113
                 ++++ ++   v ++t +p+e +dy+d + +lV +
  ACF55806.1 181 HHSAHHHGKAVLMITHDPEEVKDYADRNIHLVRN 214
                 445555677899**************98888876 PP

>> PF07208  Protein of unknown function (DUF1414)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.039   2.1e+02      26      37 ..     142     153 ..     139     154 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.039
                 CCCHHHHHHHHH CS
     PF07208  26 aaqReaiAekFa 37 
                 ++qR++iA  Fa
  ACF55806.1 142 QKQRAVIARMFA 153
                 79*********9 PP

>> PF10986  Protein of unknown function (DUF2796)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   1.0     0.038     2e+02       1      20 [.     182     201 ..     182     204 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.038
     PF10986   1 heaHvHGvaelnialdgkdl 20 
                 h+aH HG+a l i +d +++
  ACF55806.1 182 HSAHHHGKAVLMITHDPEEV 201
                 79************998765 PP

>> PF09817  Uncharacterized conserved protein (DUF2352)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.05   2.6e+02     545     574 ..      10      38 ..       6      49 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.05
     PF09817 545 vfylssepildHinflvpdlapeltaegee 574
                 +fy  +ep+l+Hin+ v d+   +t++ge+
  ACF55806.1  10 SFYYDKEPVLEHINYCV-DSGEFVTLTGEN 38 
                 79*************99.887788888877 PP

>> PF00188  Cysteine-rich secretory protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.047   2.5e+02      29      55 ..      20      46 ..      18     111 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.047
     PF00188 29 dhakdcaksgyfshnsgenlaisersg 55
                +h ++c++sg+f   +gen+a+ ++  
  ACF55806.1 20 EHINYCVDSGEFVTLTGENGAAXTTLI 46
                799*****************9988765 PP

>> PF09839  Uncharacterized protein conserved in bacteria (DUF2066)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.12   6.2e+02      34      86 ..      31      83 ..      28      86 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.12
     PF09839 34 lvkvsGnedvlenpevkkalkdassylsqygyeekdegeltLkvsFdaekvnr 86
                +v ++G+  ++  + +k+ l   +  + ++++ +++++ ++L++ + ++++ +
  ACF55806.1 31 FVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGKKLRIAYLPQQIAS 83
                6789*****************************98999********9999975 PP

>> PF10948  Protein of unknown function (DUF2635)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0       0.2     1e+03      31      39 ..     106     114 ..     103     121 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.2
     PF10948  31 WlRRladGD 39 
                 W RRl++ D
  ACF55806.1 106 WFRRLNAHD 114
                 ******988 PP

>> PF04637  Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV UL25)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.0   0.0      0.24   1.3e+03      30      46 ..      79      95 ..      74      97 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.0 bits;  conditional E-value: 0.24
     PF04637 30 gaVallNsglPmpayaL 46
                +++a +N+g P+++y++
  ACF55806.1 79 QQIASFNAGFPSTVYEF 95
                789************86 PP

>> PF03214  Reversibly glycosylated polypeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.0      0.19     1e+03     232     282 ..       2      52 ..       1      69 [. 0.90

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 0.19
     PF03214 232 rydtledvwaGlcvkvvcdhlglGvktGlpyvwrseagnaleslkkeyeGv 282
                 ry t+ed+   +    v +h+++ v +G    +  e+g a ++l k   G+
  ACF55806.1   2 RYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGI 52 
                 9999****99999999************99999999999999998887776 PP

>> PF05372  Delta lysin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0       0.3   1.6e+03       7      14 ..      90      97 ..      90      98 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.3
     PF05372  7 STIgdfVK 14
                ST+ +fVK
  ACF55806.1 90 STVYEFVK 97
                899****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (234 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       286  (0.0240094); expected 238.2 (0.02)
Passed bias filter:                      265  (0.0222465); expected 238.2 (0.02)
Passed Vit filter:                        20  (0.00167898); expected 11.9 (0.001)
Passed Fwd filter:                        20  (0.00167898); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              19  [number of targets reported over threshold]
# CPU time: 0.19u 0.05s 00:00:00.24 Elapsed: 00:00:00
# Mc/sec: 2658.86
//