# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28349.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF56119.1  [L=109]
Description: spne4 ACF56119.1 GIB00761CH01 "CrcB protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    7.3e-26   93.0   6.2    8.2e-26   92.8   4.3    1.0  1  PF02537  CrcB-like protein
  ------ inclusion threshold ------
        0.5   12.7   1.6        0.7   12.3   1.1    1.3  1  PF06197  Protein of unknown function (DUF998)
       0.88   11.7   4.1        5.6    9.1   2.8    1.9  1  PF01988  VIT family
        1.5   10.9   1.1        3.6    9.6   0.1    1.9  1  PF01758  Sodium Bile acid symporter family
        1.8   11.0   0.1        4.4    9.8   0.1    1.8  1  PF11381  Protein of unknown function (DUF3185)
          3    9.9   0.0         16    7.6   0.0    1.9  2  PF11553  Protein of unknown function (DUF3231)
        5.8    8.3   0.1        7.3    8.0   0.1    1.2  1  PF02714  Domain of unknown function DUF221
        7.3    6.8   0.0          9    6.5   0.0    1.1  1  PF11145  Protein of unknown function (DUF2921)
        8.4    8.8   0.4         14    8.2   0.1    1.7  1  PF11143  Protein of unknown function (DUF2919)
         19    7.2   8.6         51    5.8   1.3    2.3  2  PF02687  Predicted permease
         22    7.2   0.0         50    6.1   0.0    1.6  1  PF08290  Hepatitis core protein, putative zinc finger
         34    6.1   1.9         50    5.5   0.5    1.8  2  PF01062  Bestrophin
         35    7.2   1.1         50    6.7   0.1    1.9  1  PF11808  Domain of unknown function (DUF3329)
         45    6.5   0.1    1.2e+02    5.2   0.0    1.8  1  PF03748  Flagellar basal body-associated protein FliL
         49    5.2   0.9         57    5.0   0.6    1.3  1  PF05982  Domain of unknown function (DUF897)
         59    5.8   0.0         88    5.3   0.0    1.1  1  PF02668  Taurine catabolism dioxygenase TauD, TfdA family
         60    5.1   0.1         79    4.7   0.1    1.1  1  PF12037  Domain of unknown function (DUF3523)
         66    4.7   0.1         81    4.4   0.0    1.1  1  PF09731  Mitochondrial inner membrane protein
    1.1e+02    5.7   9.0    1.3e+03    2.2   6.2    2.6  1  PF09335  SNARE associated Golgi protein
    1.1e+02    5.0   2.0         94    5.2   0.1    1.9  1  PF11293  Protein of unknown function (DUF3094)
    1.2e+02    5.1   1.5      3e+02    3.9   0.3    2.2  1  PF08183  Stage V sporulation protein family
    1.5e+02    4.9   0.3    2.6e+02    4.1   0.2    1.3  1  PF12107  Plasminogen (Pg) ligand in fibrinolytic pathway
    1.6e+02    4.4   0.8    1.9e+02    4.1   0.1    1.6  1  PF09878  Predicted membrane protein (DUF2105)
    1.6e+02    4.6   0.1    5.8e+02    2.8   0.0    1.8  1  PF00440  Bacterial regulatory proteins, tetR family
    1.8e+02    4.7   0.0    2.8e+02    4.1   0.0    1.2  1  PF06975  Protein of unknown function (DUF1299)
    1.9e+02    4.3   0.2      3e+02    3.7   0.1    1.2  1  PF12104  T cell CD4 receptor C terminal region
      2e+02    3.4   0.0    2.3e+02    3.2   0.0    1.2  1  PF01048  Phosphorylase superfamily
    3.2e+02    2.9   0.0    4.9e+02    2.2   0.0    1.2  1  PF02353  Cyclopropane-fatty-acyl-phospholipid synthase
    3.2e+02    3.5   7.2         94    5.2   0.1    2.9  2  PF10215  Oligosaccaryltransferase
    4.2e+02    2.6   0.0    1.1e+03    1.2   0.0    1.5  1  PF01088  Ubiquitin carboxyl-terminal hydrolase, family 1
    4.3e+02    3.6   0.0      7e+02    2.9   0.0    1.2  1  PF08855  Domain of unknown function (DUF1825)
    4.4e+02    2.4   0.0    7.1e+02    1.7   0.0    1.4  1  PF10355  Protein of unknown function (Ytp1)
    5.3e+02    2.8   0.3    1.6e+03    1.3   0.2    1.7  1  PF00325  Bacterial regulatory proteins, crp family
    7.1e+02    2.8   3.1    2.4e+03    1.1   2.1    2.0  1  PF00746  Gram positive anchor


Domain and alignment annotation for each model:
>> PF02537  CrcB-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.8   4.3   2.8e-29   8.2e-26       2     116 ..       4     107 ..       3     108 .. 0.91

  Alignments for each domain:
  == domain 1    score: 92.8 bits;  conditional E-value: 2.8e-29
     PF02537   2 llvalggalGallRyllsellkkkvkkaplgtllvNvlGsfllgllvallaaeraskvskelrlllgtGflGglTTfStfalelvkllesgkilkally 100
                 +++a++++lGal+Ry++s+++++  +k plgtl++N+lG+fl+g++++       +  ske++++l+tGf+GglTTfSt+  el +ll+++k+  ++ y
  ACF56119.1   4 VYLAIACGLGALVRYFFSRYNQA--SKLPLGTLIANLLGCFLIGVFYN-------HVESKEVYAILATGFCGGLTTFSTLNDELQRLLSDKKV--FYSY 91 
                 7899****************766..66799****************76.......3445779****************************965..799* PP

     PF02537 101 lllslllgllavllgl 116
                 l+l++++gl+a++lg+
  ACF56119.1  92 LTLTYIGGLVAIFLGI 107
                 **************97 PP

>> PF06197  Protein of unknown function (DUF998)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.3   1.1   0.00024       0.7      28      85 ..       5      65 ..       3     108 .. 0.63

  Alignments for each domain:
  == domain 1    score: 12.3 bits;  conditional E-value: 0.00024
     PF06197 28 glivtgvLvllfallllr..klervgaallivagvflalvGvfpegtg..epHlivallfFl 85
                 l + + L++l+ ++++r  + +++    li++ ++ +l+Gvf +++   e+  i a+  F 
  ACF56119.1  5 YLAIACGLGALVRYFFSRynQASKLPLGTLIANLLGCFLIGVFYNHVEskEVYAILATG-FC 65
                578889999999999999877777888889*************9988422344444433.33 PP

>> PF01988  VIT family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   2.8    0.0019       5.6     140     207 ..       5      73 ..       1     108 [. 0.85

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0019
     PF01988 140 lsfllggliPllpyllvp.s.aseallvsvivtllaLfilGvvkarlsgksylrsairtlivgllaagat 207
                    +++gl  l+ y+++  + as+  l ++i+ ll  f++Gv+  ++  k  +++++ t ++g+l++++t
  ACF56119.1   5 YLAIACGLGALVRYFFSRyNqASKLPLGTLIANLLGCFLIGVFYNHVESK-EVYAILATGFCGGLTTFST 73 
                 5668899999****99988557779999*******************985.6888888888888888776 PP

>> PF01758  Sodium Bile acid symporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.1    0.0012       3.6     130     176 ..       2      44 ..       1      54 [. 0.75

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0012
     PF01758 130 vliyviiPliaGiltryilprekfekkllkvlspisligllltivvi 176
                 v++y+ i + +G l+ry++    +++    +l++ +li+ ll  ++i
  ACF56119.1   2 VIVYLAIACGLGALVRYFFS--RYNQ--ASKLPLGTLIANLLGCFLI 44 
                 89******************..5554..3566777777766666655 PP

>> PF11381  Protein of unknown function (DUF3185)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.1    0.0015       4.4      18      58 ..      67     109 .]      58     109 .] 0.83

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0015
     PF11381  18 GyqasdslesqvtravTGspt..dktilyligGvvavivGlvl 58 
                 G+  +++l+++++r+++ ++      +l +igG va+  G++l
  ACF56119.1  67 GLTTFSTLNDELQRLLSDKKVfySYLTLTYIGGLVAIFLGILL 109
                 778899999999999988865225678899**********985 PP

>> PF11553  Protein of unknown function (DUF3231)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0055        16      25      54 ..      33      62 ..      31      86 .. 0.87
   2 ?    0.7   0.0      0.73   2.1e+03      84     109 ..      72      97 ..      65     103 .. 0.73

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0055
     PF11553 25 nyqanslgkclleyflqvaedeeikkllek 54
                +++an lg  l+ +f++++e++e+ ++l  
  ACF56119.1 33 TLIANLLGCFLIGVFYNHVESKEVYAILAT 62
                578888999999*************99975 PP

  == domain 2    score: 0.7 bits;  conditional E-value: 0.73
     PF11553  84 edvtdsaprlFsDklmlfylslmaaa 109
                 ++ +d+ +rl+sDk   +   +++ +
  ACF56119.1  72 STLNDELQRLLSDKKVFYSYLTLTYI 97 
                 67789999999999877766665554 PP

>> PF02714  Domain of unknown function DUF221
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.1    0.0025       7.3     217     267 ..       3      53 ..       1      74 [. 0.82

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0025
     PF02714 217 ilylirrkflsktprdlaerktkppefqygtvypqflliftialiYsviaP 267
                 i+yl   + l+   r +++r++++++++ gt ++++l  f+i++ Y  +  
  ACF56119.1   3 IVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVES 53 
                 66777777778888999*****************************87766 PP

>> PF11145  Protein of unknown function (DUF2921)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0031         9     797     825 ..      77     105 ..      70     108 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0031
     PF11145 797 evsrvpsdkkvllvslplyllGllialiv 825
                 e +r  sdkkv+++ l+l  +G+l+a+++
  ACF56119.1  77 ELQRLLSDKKVFYSYLTLTYIGGLVAIFL 105
                 678999*******************9986 PP

>> PF11143  Protein of unknown function (DUF2919)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.1    0.0047        14      57      96 ..       5      44 ..       3      87 .. 0.82

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0047
     PF11143 57 ylgLaigvpalllllligrrkksrkwlrklwrylrwllll 96
                yl++a+g++al+ +++++  ++s+  l  l++ l +  l+
  ACF56119.1  5 YLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLI 44
                89**************999999988776655544444444 PP

>> PF02687  Predicted permease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   1.3     0.017        51     111     161 ..       4      47 ..       1      49 [. 0.73
   2 ?    5.3   0.5     0.024        70      93     119 ..      83     109 .]      82     109 .] 0.85

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.017
     PF02687 111 iglllGlllglllaqllsqallkfsssslpisldpisillllllilliall 161
                 + l+++++lg l+ +++s++       +    l++ ++++ ll+++li+++
  ACF56119.1   4 VYLAIACGLGALVRYFFSRY-------NQASKLPLGTLIANLLGCFLIGVF 47 
                 55789999999999999995.......666666666777777766666654 PP

  == domain 2    score: 5.3 bits;  conditional E-value: 0.024
     PF02687  93 skkqifkqlllealligliglllGlll 119
                 s+k++f ++l+ + + gl++++lG+ll
  ACF56119.1  83 SDKKVFYSYLTLTYIGGLVAIFLGILL 109
                 789999999999999999999999876 PP

>> PF08290  Hepatitis core protein, putative zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.017        50      18      26 ..      25      33 ..      24      34 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.017
     PF08290 18 QASKLCLGW 26
                QASKL LG 
  ACF56119.1 25 QASKLPLGT 33
                9******95 PP

>> PF01062  Bestrophin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.0   0.1       0.8   2.4e+03      19      51 ..       2      39 ..       1      53 [. 0.55
   2 ?    5.5   0.5     0.017        50      31      60 ..      74     106 ..      31     108 .. 0.79

  Alignments for each domain:
  == domain 1    score: 0.0 bits;  conditional E-value: 0.8
     PF01062 19 lllflllsalvvvlyrylls...qkvslp..alpftll 51
                ++++l++++ + +l ry++s   q+ +lp  +l+  ll
  ACF56119.1  2 VIVYLAIACGLGALVRYFFSrynQASKLPlgTLIANLL 39
                56777777777777777777443334444213333333 PP

  == domain 2    score: 5.5 bits;  conditional E-value: 0.017
     PF01062  31 v...lyryllsqkvslpalpftllgiaLsllLg 60 
                 +   l+r+l ++kv+ ++l++t +g  ++++Lg
  ACF56119.1  74 LndeLQRLLSDKKVFYSYLTLTYIGGLVAIFLG 106
                 144488888889********************9 PP

>> PF11808  Domain of unknown function (DUF3329)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.1     0.017        50       8      30 ..      30      52 ..      23      86 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.017
     PF11808  8 llrrLlllllaalllGlligela 30
                 l +L++ ll ++l+G++ +++ 
  ACF56119.1 30 PLGTLIANLLGCFLIGVFYNHVE 52
                577999*************9985 PP

>> PF03748  Flagellar basal body-associated protein FliL
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.039   1.2e+02       8      34 ..       2      28 ..       1      59 [. 0.82

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.039
     PF03748  8 lllllllvvgggggvffllsgkqeaeq 34
                +++ l+++ g+g+ v ++ s++++a++
  ACF56119.1  2 VIVYLAIACGLGALVRYFFSRYNQASK 28
                78899999999***********99865 PP

>> PF05982  Domain of unknown function (DUF897)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.6     0.019        57     180     216 ..      35      71 ..      27     109 .] 0.78

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.019
     PF05982 180 lvlllgglviGlltgeegvkvlkpffvalfqgvLslf 216
                 +  llg ++iG+++++   k++  ++   f g L+ f
  ACF56119.1  35 IANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTF 71 
                 6679*****************9********9999877 PP

>> PF02668  Taurine catabolism dioxygenase TauD, TfdA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.03        88     125     153 ..      62      91 ..      61      93 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.03
     PF02668 125 tlfvdgfaayeaLspelkella.egltyvy 153
                 t f+ g + ++ L++el++ll+ +++ y y
  ACF56119.1  62 TGFCGGLTTFSTLNDELQRLLSdKKVFYSY 91 
                 899*******************77999987 PP

>> PF12037  Domain of unknown function (DUF3523)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.1     0.027        79     218     251 ..      69     107 ..      68     108 .. 0.71

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.027
     PF12037 218 ttfsligeglralltDknkll.....aavggltalaaGi 251
                 ttfs +++ l+ ll+Dk+  +     + +ggl a+ +Gi
  ACF56119.1  69 TTFSTLNDELQRLLSDKKVFYsyltlTYIGGLVAIFLGI 107
                 89**************97543111114567777777776 PP

>> PF09731  Mitochondrial inner membrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.027        81      12      40 ..      58      87 ..      53      97 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.027
     PF09731 12 vllatvfyGGgvlyakkddkfrdffeey.v 40
                ++lat+f GG  + ++ +d+++ ++ ++ v
  ACF56119.1 58 AILATGFCGGLTTFSTLNDELQRLLSDKkV 87
                789*******************99998755 PP

>> PF09335  SNARE associated Golgi protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   6.2      0.45   1.3e+03      18      82 ..       1      67 [.       1     109 [] 0.76

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.45
     PF09335 18 lgtlvtslgallgallayllgrylgk.....kalrrkllsekrveklkkverlverygfsallllrllPi 82
                +++++ ++++ lgal+ y+++ry +        l   ll    ++    ++++ve + ++a+l   ++ +
  ACF56119.1  1 MVIVYLAIACGLGALVRYFFSRYNQAsklplGTLIANLLGCFLIGV---FYNHVESKEVYAILATGFCGG 67
                5899******************987666555555555555555555...666666666666665555555 PP

>> PF11293  Protein of unknown function (DUF3094)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.032        94      34      50 ..       2      18 ..       1      23 [. 0.82

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.032
     PF11293 34 llvvlAvvigLGLlsRl 50
                ++v lA+  gLG l R 
  ACF56119.1  2 VIVYLAIACGLGALVRY 18
                5788********99985 PP

>> PF08183  Stage V sporulation protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.3       0.1     3e+02      12      23 ..      97     108 ..      95     109 .] 0.91

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.1
     PF08183  12 vGGvVkklLgsf 23 
                 +GG V   Lg++
  ACF56119.1  97 IGGLVAIFLGIL 108
                 8*********98 PP

>> PF12107  Plasminogen (Pg) ligand in fibrinolytic pathway
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.2     0.087   2.6e+02       2       8 ..      76      81 ..      75      81 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.087
     PF12107  2 DaELeRL 8 
                D EL+RL
  ACF56119.1 76 D-ELQRL 81
                8.****9 PP

>> PF09878  Predicted membrane protein (DUF2105)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.1     0.066   1.9e+02     122     136 ..      56      70 ..      53     107 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.066
     PF09878 122 vyGiiLtGftGGava 136
                 vy i+ tGf GG   
  ACF56119.1  56 VYAILATGFCGGLTT 70 
                 89**********865 PP

>> PF00440  Bacterial regulatory proteins, tetR family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0       0.2   5.8e+02      31      41 ..      45      55 ..      44      56 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.2
                HHHHHHTSSHH CS
     PF00440 31 galYrhFpsKe 41
                g +Y h  sKe
  ACF56119.1 45 GVFYNHVESKE 55
                679*******8 PP

>> PF06975  Protein of unknown function (DUF1299)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.097   2.8e+02       4      17 ..      48      61 ..      47      62 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.097
     PF06975  4 yddveDQEaYviLS 17
                y+ ve  E Y+iL 
  ACF56119.1 48 YNHVESKEVYAILA 61
                9***********95 PP

>> PF12104  T cell CD4 receptor C terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.1       0.1     3e+02      11      18 ..      79      86 ..      77      87 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.1
     PF12104 11 krlLsEKK 18
                +rlLs KK
  ACF56119.1 79 QRLLSDKK 86
                6******9 PP

>> PF01048  Phosphorylase superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.08   2.3e+02      69      82 ..      55      68 ..      23      75 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.08
                .-SEEEEE--B--- CS
     PF01048 69 gvkaiirtGtaGgl 82
                +v ai++tG +Ggl
  ACF56119.1 55 EVYAILATGFCGGL 68
                5779*********9 PP

>> PF02353  Cyclopropane-fatty-acyl-phospholipid synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.17   4.9e+02      67      85 ..       6      24 ..       3      30 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.17
                EE-------HHHHHHHHH- CS
     PF02353 67 LdiGcGWGslvrraveryd 85
                L i cG G+lvr+  +ry+
  ACF56119.1  6 LAIACGLGALVRYFFSRYN 24
                789**************98 PP

>> PF10215  Oligosaccaryltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.032        94       9      19 ..      34      44 ..      31      57 .. 0.83
   2 ?    1.6   0.4      0.44   1.3e+03      10      17 ..     101     108 ..      99     109 .] 0.80

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.032
                HHHHH---HHH CS
     PF10215  9 sLAntLGiaaf 19
                 +An LG++++
  ACF56119.1 34 LIANLLGCFLI 44
                68******986 PP

  == domain 2    score: 1.6 bits;  conditional E-value: 0.44
                 HHHH---H CS
     PF10215  10 LAntLGia 17 
                  A++LGi 
  ACF56119.1 101 VAIFLGIL 108
                 69****95 PP

>> PF01088  Ubiquitin carboxyl-terminal hydrolase, family 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0      0.37   1.1e+03      91     120 ..       9      38 ..       5      41 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.37
                 -------HHHHHT..TTTT------HHHHH CS
     PF01088  91 ACgtialLhvllNlenedkeieegseLkkf 120
                 ACg+ al+   +   n+++++ +g+ ++++
  ACF56119.1   9 ACGLGALVRYFFSRYNQASKLPLGTLIANL 38 
                 9***********988888899999888776 PP

>> PF08855  Domain of unknown function (DUF1825)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.24     7e+02      44      62 ..      76      94 ..      72      96 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.24
     PF08855 44 ekleeLldkqrifykRleL 62
                ++l+ Ll  +++fy  l+L
  ACF56119.1 76 DELQRLLSDKKVFYSYLTL 94
                67999*********99998 PP

>> PF10355  Protein of unknown function (Ytp1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.24   7.1e+02     119     167 ..      60     108 ..      40     109 .] 0.72

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.24
     PF10355 119 iggGllGlllesklvrkllnsaeeeeevksysvsrnpiPalvilltGil 167
                 +++G++G l++ ++ ++ l++  + ++v  + + ++ i  lv +++Gil
  ACF56119.1  60 LATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGIL 108
                 4567777776666666666666666777777777777888888888776 PP

>> PF00325  Bacterial regulatory proteins, crp family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.2      0.53   1.6e+03       8      14 ..      35      41 ..      34      41 .. 0.96

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.53
     PF00325  8 IAdylGl 14
                IA++lG+
  ACF56119.1 35 IANLLGC 41
                9*****9 PP

>> PF00746  Gram positive anchor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   2.1       0.8   2.4e+03      18      35 ..      92     109 .]      90     109 .] 0.77

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.8
     PF00746  18 ifltlaGlllaaggglll 35 
                 + lt +G+l+a+  g ll
  ACF56119.1  92 LTLTYIGGLVAIFLGILL 109
                 579999**8888777765 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (109 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       468  (0.0392881); expected 238.2 (0.02)
Passed bias filter:                      359  (0.0301377); expected 238.2 (0.02)
Passed Vit filter:                        37  (0.00310611); expected 11.9 (0.001)
Passed Fwd filter:                        37  (0.00310611); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              34  [number of targets reported over threshold]
# CPU time: 0.17u 0.04s 00:00:00.21 Elapsed: 00:00:01
# Mc/sec: 1384.24
//