# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28340.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF56413.1  [L=240]
Description: spne4 ACF56413.1 GIB00761CH01 "ribosomal small subunit pseudouridine synthase A"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-20   76.8   0.0    1.6e-20   76.2   0.0    1.3  1  PF00849  RNA pseudouridylate synthase
    1.4e-07   33.4   0.1    3.2e-07   32.3   0.1    1.6  1  PF01479  S4 domain
  ------ inclusion threshold ------
        3.5   10.5   0.0        9.5    9.0   0.0    1.7  1  PF06676  Protein of unknown function (DUF1178)
        7.2    9.5   0.0         18    8.2   0.0    1.6  1  PF07319  Primosomal protein DnaI N-terminus
        7.6    8.7   0.2         62    5.8   0.0    2.2  2  PF03463  eRF1 domain 1
         14    8.5   0.0    2.7e+02    4.4   0.0    2.2  2  PF07037  Putative transcription regulator (DUF1323)
         19    6.8   0.0         30    6.1   0.0    1.2  1  PF10071  Zn-ribbon-containing, possibly nucleic-acid-binding
         24    7.7   0.0         57    6.6   0.0    1.7  1  PF11798  IMS family HHH motif
         32    7.0   0.0      1e+02    5.3   0.0    1.8  1  PF07338  Protein of unknown function (DUF1471)
         33    7.1   0.0         73    6.0   0.0    1.6  1  PF08194  DIM protein
         45    6.4   0.0    1.5e+02    4.7   0.0    1.8  1  PF01614  Bacterial transcriptional regulator
         54    5.6   0.0         83    5.0   0.0    1.3  1  PF03353  Ras-mediated vulval-induction antagonist
         55    6.3   0.3      1e+02    5.5   0.2    1.4  1  PF12113  SVM protein signal sequence
         58    6.5   0.0    1.1e+02    5.6   0.0    1.5  1  PF03652  Uncharacterised protein family (UPF0081)
         69    6.3   0.1    1.8e+02    5.0   0.1    1.7  1  PF02583  Uncharacterised BCR, COG1937
         78    4.3   0.0    1.1e+02    3.7   0.0    1.2  1  PF00022  Actin
         81    6.1   3.5         59    6.5   0.2    2.3  1  PF00403  Heavy-metal-associated domain
         81    5.4   0.0    1.5e+02    4.5   0.0    1.4  1  PF02107  Flagellar L-ring protein
      1e+02    5.8   0.1    2.7e+02    4.4   0.1    1.7  1  PF08394  Archaeal TRASH domain
    1.1e+02    4.4   0.0    1.7e+02    3.8   0.0    1.3  1  PF05475  Chlamydia virulence protein PGP3-D
    1.2e+02    4.4   0.0      2e+02    3.6   0.0    1.3  1  PF05454  Dystroglycan (Dystrophin-associated glycoprotein 1)
    1.2e+02    5.1   0.0    2.1e+02    4.3   0.0    1.5  1  PF11076  Putative inner membrane protein YbhQ
    1.3e+02    5.4   0.0    2.4e+02    4.5   0.0    1.5  1  PF09168  X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal
    1.3e+02    4.0   0.0      2e+02    3.4   0.0    1.2  1  PF00863  Peptidase family C4
    1.5e+02    4.4   0.1    4.3e+02    2.9   0.0    1.7  1  PF11319  Protein of unknown function (DUF3121)
    1.8e+02    5.0   0.0    3.7e+02    3.9   0.0    1.5  1  PF06353  Protein of unknown function (DUF1062)
      2e+02    5.1   0.1    4.3e+02    4.0   0.0    1.6  1  PF03871  RNA polymerase Rpb5, N-terminal domain
    2.6e+02    4.0   0.0    5.1e+02    3.1   0.0    1.5  1  PF07154  Protein of unknown function (DUF1392)
    3.1e+02    3.3   0.0    7.2e+02    2.1   0.0    1.5  1  PF01725  Ham1 family
      4e+02    3.4   0.0    7.7e+02    2.5   0.0    1.5  1  PF12399  Branched-chain amino acid ATP-binding cassette tran
      1e+03    2.0   0.2    2.2e+03    0.9   0.1    1.4  1  PF06753  Bradykinin


Domain and alignment annotation for each model:
>> PF00849  RNA pseudouridylate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.2   0.0   5.1e-24   1.6e-20       2     162 ..      62     195 ..      61     197 .. 0.92

  Alignments for each domain:
  == domain 1    score: 76.2 bits;  conditional E-value: 5.1e-24
     PF00849   2 lvvvnKPagvpvtpeakggsekeksttatssraeeekkelklvhRLDkaTsGllllAksgeaaaklakafeerkvrKkYlalvfgapleeegaikskis 100
                 + ++nKP+gv++ +e+      +++t  +  ++   +ke+++v+RLD +T Gllll+++g++a+ l    ++r+v+K+Y+a v+       g++ ++  
  ACF56413.1  62 YYMMNKPKGVISATED-----PKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLS--PKRHVDKTYQAQVK-------GIMTQE-- 144
                 789*************.....9999999999999**********************************..*************5.......333333.. PP

     PF00849 101 kdtekqegarrkkeeldgkkavtylrvlesgsktpksnasakvtlveleletGrkhQiRahl 162
                     + e++ +    +d+  + ++l++l+ +       a+++++ +++++ +G+ hQi++++
  ACF56413.1 145 ----DVETFIKGIPLKDFTCQPARLEILSTD-------AEKNQSQIRVTIAEGKFHQIKRMV 195
                 ....333699999******************.......9********************985 PP

>> PF01479  S4 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.3   0.1     1e-10   3.2e-07       1      43 [.       1      42 [.       1      45 [. 0.88

  Alignments for each domain:
  == domain 1    score: 32.3 bits;  conditional E-value: 1e-10
                CBHHHHHHHHCTTSSHHHHHHHHHTT-EEE---B---TT-BE- CS
     PF01479  1 rRLDkvLarlglassrseArqlIehGhVrVNGkvvkdpsyrVk 43
                +RLDk+L+ +  + sr+e++ l ++G+V+VNGk+ k+++ +++
  ACF56413.1  1 MRLDKFLV-ACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQID 42
                9*******.666667*********************9887776 PP

>> PF06676  Protein of unknown function (DUF1178)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0029       9.5      30      70 ..       5      45 ..       2      77 .. 0.79

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0029
     PF06676 30 rglveCpvCgstevekalmaprvatkkkkeeeaaapakaaa 70
                + lv+C+v   tev+  l a rv+ ++kke++a+ + +++ 
  ACF56413.1  5 KFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI 45
                568***********************998887666555544 PP

>> PF07319  Primosomal protein DnaI N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0056        18      13      39 ..     125     151 ..     117     156 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0056
                 ---HHHHHHHHHHHHHTT-HHHHHHHH CS
     PF07319  13 kkrklekryeklkkevlkdpdVqaFlk 39 
                  kr+++k+y++ +k +++++dV+ F+k
  ACF56413.1 125 PKRHVDKTYQAQVKGIMTQEDVETFIK 151
                 578999*******************97 PP

>> PF03463  eRF1 domain 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0       1.1   3.5e+03      72      95 ..      38      61 ..      20      66 .. 0.80
   2 ?    5.8   0.0     0.019        62      56      98 ..     169     211 ..     159     221 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.1
                CCTTSTCEEEEEEE--B------. CS
     PF03463 72 klkfdpengllrvsGkvveeneev 95
                kl+ d++ + +r+ G+v e +e+v
  ACF56413.1 38 KLQIDEKIDEIRFDGQVLEYEEFV 61
                666778888899999999887765 PP

  == domain 2    score: 5.8 bits;  conditional E-value: 0.019
                 HHHHCCCCCCCCCCCCCCTTSTCEEEEEEE--B------.--- CS
     PF03463  56 sktservklaLtieveklkfdpengllrvsGkvveeneevkig 98 
                 s++ e+ ++ +++++ + kf++ + ++ ++Gk v + +   +g
  ACF56413.1 169 STDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMG 211
                 7899****************************99887766666 PP

>> PF07037  Putative transcription regulator (DUF1323)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.53   1.7e+03      32      95 ..      30      92 ..      23      97 .. 0.82
   2 ?    4.4   0.0     0.083   2.7e+02      71     120 ..     107     156 ..      98     158 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.53
     PF07037 32 pGvkGGkarlihideqvrefirnaealrnsaalyrveeepaeyavtedaeleallietleeltp 95
                +G k   a+l  ide++ e     + l +++ +y + ++p    ++++++ ++ ++++l+ l+ 
  ACF56413.1 30 NGKKEKSAKL-QIDEKIDEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLAR 92
                5666655554.89999999999999999999999999999999899999999999999998876 PP

  == domain 2    score: 4.4 bits;  conditional E-value: 0.083
     PF07037  71 paeyavtedaeleallietleeltpseqkklaelllreGiagllkRLgir 120
                 ++    t++ +l + l++  +++ ++ q++++ ++++e ++ ++k + ++
  ACF56413.1 107 HGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLK 156
                 5556678899999999999************************9877665 PP

>> PF10071  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0    0.0094        30      15      50 ..      32      67 ..      23      81 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0094
     PF10071 15 tdleavekainqlldqlrynGqilgrefpvavkkne 50
                ++ ++++ +i + +d++r++Gq+l  e++v++  n+
  ACF56413.1 32 KKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNK 67
                5566777889999**************999877665 PP

>> PF11798  IMS family HHH motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.018        57       3      17 ..     144     158 ..     142     159 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.018
                 GGHHHHH----GGGS CS
     PF11798   3 ddvpefLwplpitdl 17 
                 +dv++f++ +p++d+
  ACF56413.1 144 EDVETFIKGIPLKDF 158
                 8*************8 PP

>> PF07338  Protein of unknown function (DUF1471)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.032     1e+02       5      36 ..      15      44 ..      14      48 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.032
     PF07338  5 keqaaqlqkiGtisvsgafgspsdaeaalakk 36
                ++++++l k G+++v+g    +  a+ ++ +k
  ACF56413.1 15 RTEVKNLLKAGRVTVNGK--KEKSAKLQIDEK 44
                68999************7..777777777666 PP

>> PF08194  DIM protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.023        73      21      31 ..      22      32 ..      16      34 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.023
     PF08194 21 lspGnViINGd 31
                l +G+V++NG+
  ACF56413.1 22 LKAGRVTVNGK 32
                459*******8 PP

>> PF01614  Bacterial transcriptional regulator
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.047   1.5e+02      25      75 ..       8      60 ..       4      65 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.047
                CCTS..HHHHHHHHHHHTT---SSTTS--SHHHHHHHHHHHHH---EEEESSS CS
     PF01614 25 LAal..deeeleavleklelkrltrrtitdleaLleeLaavreqGyavdreEe 75
                 A+   +++e++++l++  ++  +++  + + ++ e+++++r +G +++ eE 
  ACF56413.1  8 VACAvgSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEF 60
                555444999999999998888889999999999*****************995 PP

>> PF03353  Ras-mediated vulval-induction antagonist
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.026        83     280     304 ..      71      95 ..      31      97 .. 0.93

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.026
     PF03353 280 tvlalddkeyenaadlFedLaasen 304
                 ++ a +d++++++ dl +dLa s++
  ACF56413.1  71 VISATEDPKHRTVLDLLDDLARSKE 95 
                 799******************7765 PP

>> PF12113  SVM protein signal sequence
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.2     0.031     1e+02      20      30 ..     108     118 ..     108     119 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.031
     PF12113  20 GLlfItNNhqV 30 
                 GLl++tNN q+
  ACF56413.1 108 GLLLLTNNGQL 118
                 9*******886 PP

>> PF03652  Uncharacterised protein family (UPF0081)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.034   1.1e+02      27      62 ..     121     156 ..     106     195 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.034
     PF03652  27 pletierkskkkdleelkelvkeeevdeiVvGlPln 62 
                  l   +r+ +k+  +++k ++++e+v++++ G+Pl+
  ACF56413.1 121 VLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLK 156
                 5555555555777899******************75 PP

>> PF02583  Uncharacterised BCR, COG1937
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.055   1.8e+02       2      25 ..     172     195 ..     171     208 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.055
     PF02583   2 eekkkllkRLrrieGQvrgiermi 25 
                 +ek++ + R+  +eG+ + i+rm+
  ACF56413.1 172 AEKNQSQIRVTIAEGKFHQIKRMV 195
                 57888899***************9 PP

>> PF00022  Actin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.035   1.1e+02      70     130 ..     140     200 ..     116     214 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.035
     PF00022  70 vedwdaveelwehvlkeelkvdpeehpllltepplnppanrekateilfekfkvpalylak 130
                 +  +++ve +++ +  ++++ +p+   +l t++  n ++ r +++e  f ++k    y++k
  ACF56413.1 140 IMTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGK 200
                 6678999999999999******************************999998876666655 PP

>> PF00403  Heavy-metal-associated domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.2     0.018        59      29      61 ..      18      50 ..      14      51 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.018
     PF00403 29 vkvdlgknkvvVegdiee.kllrkliekvekagy 61
                vk  l+++ v+V g  e+ ++l+ + ek+ ++ +
  ACF56413.1 18 VKNLLKAGRVTVNGKKEKsAKLQ-IDEKIDEIRF 50
                5666889*******999977764.8888887665 PP

>> PF02107  Flagellar L-ring protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.046   1.5e+02     100     133 ..      17      54 ..      15      58 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.046
     PF02107 100 tVtevlpNGnLvisGeke....vrvnqgdevirlsGvV 133
                  V + l+ G   ++G+ke    ++++++ ++ir+ G V
  ACF56413.1  17 EVKNLLKAGRVTVNGKKEksakLQIDEKIDEIRFDGQV 54 
                 69999***********96555599***********988 PP

>> PF08394  Archaeal TRASH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1     0.085   2.7e+02       3      10 ..     197     204 ..     196     206 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.085
     PF08394   3 YCGkeIvg 10 
                 YCGke+v+
  ACF56413.1 197 YCGKEVVD 204
                 *****997 PP

>> PF05475  Chlamydia virulence protein PGP3-D
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.054   1.7e+02     123     157 ..     129     163 ..     119     184 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.054
     PF05475 123 vsitnkiqcnGlftkenigtllGGteigkftvtpd 157
                 v+ t + q  G++t+e+++t+  G  +  ft  p 
  ACF56413.1 129 VDKTYQAQVKGIMTQEDVETFIKGIPLKDFTCQPA 163
                 6667889***********************99986 PP

>> PF05454  Dystroglycan (Dystrophin-associated glycoprotein 1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.063     2e+02     169     193 ..     132     155 ..     118     158 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.063
                 ------------------------- CS
     PF05454 169 cyrkkrkGkltledqatfikkGvPi 193
                  y+ + kG +t ed +tfi kG+P+
  ACF56413.1 132 TYQAQVKGIMTQEDVETFI-KGIPL 155
                 588999************9.69996 PP

>> PF11076  Putative inner membrane protein YbhQ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.065   2.1e+02      58      79 ..      72      93 ..      60     124 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.065
     PF11076 58 lerasearyrevadlleelttt 79
                +   +++++r+v dll++l++ 
  ACF56413.1 72 ISATEDPKHRTVLDLLDDLARS 93
                567789***********88775 PP

>> PF09168  X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.074   2.4e+02      83     119 ..      48      81 ..       2      91 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.074
     PF09168  83 evFylvalQlLgFeaevDfdlkdplaflkkialpvsk 119
                   F     Q+L++e +v + +++p+ ++++++ p+++
  ACF56413.1  48 IRFD---GQVLEYEEFVYYMMNKPKGVISATEDPKHR 81 
                 4443...5********************999988443 PP

>> PF00863  Peptidase family C4
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.063     2e+02     144     161 ..     189     206 ..     168     218 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.063
     PF00863 144 HwisTkeGdCGlplvsvk 161
                 H+i+   G CG  +v+ +
  ACF56413.1 189 HQIKRMVGYCGKEVVDLQ 206
                 9**************987 PP

>> PF11319  Protein of unknown function (DUF3121)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.13   4.3e+02     147     173 ..      17      43 ..      13      48 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.13
     PF11319 147 elkkllsakeltlrsnsaaidgLtfdl 173
                 e+k+ll+a ++t+++++++  +L++d 
  ACF56413.1  17 EVKNLLKAGRVTVNGKKEKSAKLQIDE 43 
                 79**********************996 PP

>> PF06353  Protein of unknown function (DUF1062)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.11   3.7e+02     104     137 ..       2      37 ..       1      42 [. 0.79

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.11
     PF06353 104 rldsllkeelkLsrselerliekGairgktek..sk 137
                 rld+ l  +   sr+e+++l++ G+++++ +k  s 
  ACF56413.1   2 RLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKekSA 37 
                 788888888888*************99887773344 PP

>> PF03871  RNA polymerase Rpb5, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.13   4.3e+02      33      90 ..     142     199 ..     129     202 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.13
     PF03871  33 inlsleeFkekygdeegspkrsklsisaerkedesdkilvfFceeekvgvktirtfve 90 
                  + ++e+F +    ++ + +  +l+i ++  e+++++i v  +e +  ++k++  ++ 
  ACF56413.1 142 TQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCG 199
                 46678888888888888899999********************999999999998886 PP

>> PF07154  Protein of unknown function (DUF1392)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.16   5.1e+02      14      44 ..     168     198 ..     161     214 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.16
     PF07154  14 lsPpwgkelppleisllekvylksdktfGyC 44 
                 ls   +k+ + + + + e  + + ++ +GyC
  ACF56413.1 168 LSTDAEKNQSQIRVTIAEGKFHQIKRMVGYC 198
                 6778889999********************9 PP

>> PF01725  Ham1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.22   7.2e+02       5      41 ..     182     218 ..     179     227 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.22
     PF01725   5 tgNkgKlkEikailkklkievvsleeleeakieveEt 41 
                 t  +gK+  ik++++  + evv+l+ l   ++ ++E+
  ACF56413.1 182 TIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDEN 218
                 66789*****************999998877777776 PP

>> PF12399  Branched-chain amino acid ATP-binding cassette transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.24   7.7e+02       2      13 ..     182     193 ..     181     194 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.24
     PF12399   2 vIAeGtPeEvrn 13 
                  IAeG   ++++
  ACF56413.1 182 TIAEGKFHQIKR 193
                 5*****999975 PP

>> PF06753  Bradykinin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.1      0.68   2.2e+03      13      16 ..     186     189 ..     185     190 .. 0.91

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.68
     PF06753  13 GKFH 16 
                 GKFH
  ACF56413.1 186 GKFH 189
                 9*** PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (240 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       432  (0.036266); expected 238.2 (0.02)
Passed bias filter:                      366  (0.0307253); expected 238.2 (0.02)
Passed Vit filter:                        31  (0.00260242); expected 11.9 (0.001)
Passed Fwd filter:                        31  (0.00260242); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              31  [number of targets reported over threshold]
# CPU time: 0.20u 0.04s 00:00:00.24 Elapsed: 00:00:00
# Mc/sec: 2590.68
//