# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_28344.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACF56707.1  [L=289]
Description: spne4 ACF56707.1 GIB00761CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-17   66.6   0.0    1.6e-17   66.0   0.0    1.3  1  PF02896  PEP-utilising enzyme, TIM barrel domain
  ------ inclusion threshold ------
        2.6    9.6   0.0         12    7.5   0.0    1.9  2  PF02016  LD-carboxypeptidase
        4.7    8.8   0.0        9.3    7.8   0.0    1.4  1  PF06044  Dam-replacing family
        6.1    7.7   0.0         16    6.3   0.0    1.6  1  PF00311  Phosphoenolpyruvate carboxylase
        9.7    8.8   0.2         64    6.1   0.0    2.2  1  PF08360  QacR-like protein, C-terminal region
         16    7.0   0.0         70    4.9   0.0    1.8  1  PF07555  beta-N-acetylglucosaminidase
         17    8.0   0.0         36    6.9   0.0    1.5  1  PF10893  Protein of unknown function (DUF2724)
         20    8.1   0.5         65    6.5   0.3    1.9  1  PF11969  Scavenger mRNA decapping enzyme C-term binding
         21    7.3   0.0         65    5.7   0.0    1.8  1  PF01842  ACT domain
         27    7.2   0.2    2.1e+02    4.3   0.1    2.2  1  PF05233  PHB accumulation regulatory domain
         28    6.1   0.1         56    5.1   0.0    1.6  1  PF01120  Alpha-L-fucosidase
         30    7.3   0.0         53    6.5   0.0    1.4  1  PF07550  Protein of unknown function (DUF1533)
         37    6.3   0.0         69    5.4   0.0    1.4  1  PF01756  Acyl-CoA oxidase
         45    6.4   0.0    1.3e+02    4.9   0.0    1.8  1  PF02671  Paired amphipathic helix repeat
         61    5.8   0.0    1.1e+02    5.0   0.0    1.3  1  PF03597  Cytochrome oxidase maturation protein cbb3-type
         78    5.7   0.1      2e+02    4.4   0.0    1.7  1  PF11426  Tn7 transposition regulator TnsC
         98    5.2   0.0      2e+02    4.2   0.0    1.5  1  PF07582  AP endonuclease family 2 C terminus
      1e+02    5.2   0.1    2.5e+02    4.0   0.1    1.6  1  PF12153  LPS binding domain of CAP18 (C terminal)
    1.2e+02    4.9   0.1    2.6e+02    3.8   0.1    1.5  1  PF03522  K-Cl Co-transporter type 1 (KCC1)
    1.3e+02    4.8   0.0    2.7e+02    3.8   0.0    1.5  1  PF00535  Glycosyl transferase family 2
    1.3e+02    3.5   0.0    2.2e+02    2.8   0.0    1.2  1  PF10011  Predicted membrane protein (DUF2254)
    1.5e+02    4.3   0.1    2.3e+02    3.6   0.0    1.2  1  PF05308  Protein of unknown function (DUF729)
    1.5e+02    4.9   0.1    3.1e+02    3.9   0.1    1.4  1  PF11408  Sgs1 RecQ helicase
    2.4e+02    3.5   0.3    4.1e+02    2.7   0.2    1.3  1  PF05678  VQ motif
    2.6e+02    3.8   0.0      5e+02    2.9   0.0    1.4  1  PF11295  Protein of unknown function (DUF3096)
    3.4e+02    3.8   0.2    9.1e+02    2.5   0.1    1.7  1  PF05184  Saposin-like type B, region 1
    3.5e+02    3.9   1.3    1.2e+03    2.3   0.1    2.2  1  PF03489  Saposin-like type B, region 2
    3.7e+02    3.9   0.0      9e+02    2.7   0.0    1.6  1  PF12390  Selenocysteine synthase N terminal
      4e+02    1.9   0.1    5.9e+02    1.3   0.0    1.1  1  PF05786  Barren protein
    4.6e+02    2.8   0.0    1.1e+03    1.6   0.0    1.5  1  PF12224  Putative amidoligase enzyme
    4.7e+02    3.3   0.0    9.3e+02    2.3   0.0    1.4  1  PF02216  B domain
    4.9e+02    3.0   0.9    9.9e+02    2.0   0.6    1.5  1  PF12436  Ubiquitin-specific protease 7
    7.1e+02    3.0   1.4    1.6e+03    1.8   0.2    2.1  1  PF07708  Tash protein PEST motif


Domain and alignment annotation for each model:
>> PF02896  PEP-utilising enzyme, TIM barrel domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   66.0   0.0   5.4e-21   1.6e-17      40     258 ..      21     232 ..       9     256 .. 0.84

  Alignments for each domain:
  == domain 1    score: 66.0 bits;  conditional E-value: 5.4e-21
                 -----EEECHHHHCCCCS..HHHHHH.HHHHH.HHHHHHT---EEEEE---S-GG..GGSCSSHHHH--SSTT----THHHHHHSHHHHHHHHHHHHHH CS
     PF02896  40 aeGiGLlRtEflfmdrde..lpteee.qaeay.kavlealngrpvvvRtlDiggd..kelpelveepeevNPmlGfRgirlalsepelfetqlrAilra 132
                 +  +G++R E+l  + ++  + +  +  +++y +++ +   +  v++R+        + l  ++e+  e  P+ G+Rg r+ l   + f+++   + ++
  ACF56707.1  21 FHHVGMIRGEYLLRELNQniILASCQqFVKDYlETICSLYSDEEVWYRFTELTNTeaNCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEV 119
                 5679*********999764433333324567735677778899******999877446788889*********************************** PP

                 CCHH.EEEEE-SS--SHHHHHHHHHHHHHHHHHHHHH.S---TT-B---B--SHHHHHTHHHHTTT.SSB-B---HHHHHHHCT--TTTCCHHHHS-TT CS
     PF02896 133 saeg.kleimlPlvatveelreakkvieevkeevekeglkvdkeikvGiMiEipsaalladklake.vdFfSiGtNDLtQytlavdRddeevaklydpl 229
                  +++ +l++++P+v+ +++l++a + ++++               kvG+MiE psa + + ++ +  ++ + +G NDLt +++a+ R++    + +d  
  ACF56707.1 120 YQTNpNLSVIFPFVNDADQLKQAITALRQY-----------GFTGKVGTMIELPSAYFDLSSILETgISKIVVGMNDLTSFVFATMRNS----QWHDLE 203
                 99666*******************999998...........34568*****************9988******************9986....568889 PP

                 TCHHHHHHHHHHHHHHH---B-------- CS
     PF02896 230 epavlrlvkevikaaekkglkvgiCGela 258
                 +p++l +++ + ++a+k+ ++ ++ G l 
  ACF56707.1 204 SPIMLDMLRDMQDKARKNKINFAVAGYLN 232
                 99999999999999999999999888764 PP

>> PF02016  LD-carboxypeptidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.49   1.5e+03      12      39 ..     135     162 ..     126     169 .. 0.79
   2 ?    7.5   0.0    0.0038        12      82     138 ..     166     225 ..     152     285 .. 0.77

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.49
                 HH.HHHHHHHHHH-TTEEEEE-GGGG-- CS
     PF02016  12 deerleraikrleslglevvvgenalar 39 
                 d+++l++ai++l++ g++ +vg  +   
  ACF56707.1 135 DADQLKQAITALRQYGFTGKVGTMIELP 162
                 34799************99999877655 PP

  == domain 2    score: 7.5 bits;  conditional E-value: 0.0038
                 HH.........G-EEE--TT---HHHHHHHTT--B.EE---GGGGG....S----HHHHH CS
     PF02016  82 ldyeaikkn..pkifvGySDiTaLllallaktglvtfhGpmlaslfgee.deytlesfkk 138
                  d ++i +    ki+vG  D T++ +a  ++ ++  + +p +++ + +  d+  ++++  
  ACF56707.1 166 FDLSSILETgiSKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDMLRDMqDKARKNKINF 225
                 455566555679****************************99999887645555555444 PP

>> PF06044  Dam-replacing family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0031       9.3     192     242 ..     102     151 ..      97     157 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0031
     PF06044 192 ilkcidklekeefsledvyefenelklkypknnhikdkirqqlqilrdkgl 242
                 +l+c+d++++e   + +vy+ + +l++ +p  n   d+++q +  lr  g+
  ACF56707.1 102 LLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVND-ADQLKQAITALRQYGF 151
                 799***************************8886.5889999999998776 PP

>> PF00311  Phosphoenolpyruvate carboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0    0.0053        16      87     138 ..      99     148 ..      82     159 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.0053
     PF00311  87 rerklLaetlesipeeadfakelkgkrpifevilPmteevkevievarvlae 138
                 + r+lL   l ++  ea +  e+ +++p + vi P++++++++ +++  l++
  ACF56707.1  99 T-RRLL-ACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLKQAITALRQ 148
                 4.4466.89999999999999999999*****************99888765 PP

>> PF08360  QacR-like protein, C-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.021        64      32      73 ..     212     253 ..     208     261 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.021
                 HSSSGGGHHHHHHHHHHHSSSHHHHHHHHHHHHHHHHHHHHH CS
     PF08360  32 eeyktPlsnaieelaseqvksksilekllkLerkslkayeki 73 
                  +++    +  +++a   + + s ++k+++L  k +  y  i
  ACF56707.1 212 RDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSI 253
                 56666667778899*********************9999877 PP

>> PF07555  beta-N-acetylglucosaminidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.023        70      41      75 ..     194     228 ..     178     243 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.023
                 GGTTTTTS---HHHHHHHHHHHHHHHHTT-EEEE- CS
     PF07555  41 yhrekWrelYpeeeleklkeLvkaakenkvdFvya 75 
                   +++W++l     l+ l+++ ++a++nk++F  a
  ACF56707.1 194 MRNSQWHDLESPIMLDMLRDMQDKARKNKINFAVA 228
                 5678****************************865 PP

>> PF10893  Protein of unknown function (DUF2724)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.012        36      33      64 ..     198     231 ..     191     234 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.012
     PF10893  33 rWhPCrs..qsellkglstkkrkeklsfllkgvk 64 
                 +Wh  +s    ++l++++ k rk+k++f ++g +
  ACF56707.1 198 QWHDLESpiMLDMLRDMQDKARKNKINFAVAGYL 231
                 7888866224589*****************9976 PP

>> PF11969  Scavenger mRNA decapping enzyme C-term binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.3     0.022        65      38      71 ..     246     279 ..     210     288 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.022
                 EEEESS--SSGGG--TTCCCHHHHHHHHHHHHHH CS
     PF11969  38 lvipkrdikslrdltkehlplLkemrekakkvie 71 
                 ++i +++i+++ dl+ +h + Lk+++e++kk+ +
  ACF56707.1 246 CIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQR 279
                 456677***********************99865 PP

>> PF01842  ACT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.021        65      42      64 ..     127     149 ..     115     151 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.021
                 EEEEEEEECCCGHHHHHHHHHHH CS
     PF01842  42 ivfvtvvvdeedleaaleaLkkl 64 
                  v++ +v d+++l++a+ aL+++
  ACF56707.1 127 SVIFPFVNDADQLKQAITALRQY 149
                 688999***************97 PP

>> PF05233  PHB accumulation regulatory domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1     0.069   2.1e+02      30      41 .]     209     220 ..     208     220 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.069
     PF05233  30 qmFldmQeqmqe 41 
                 +m++dmQ++ ++
  ACF56707.1 209 DMLRDMQDKARK 220
                 7********886 PP

>> PF01120  Alpha-L-fucosidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.019        56     125     159 ..     195     231 ..     189     284 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.019
     PF01120 125 kysdynivdtgpkrDivkelakavrkeglklgl..yy 159
                 + s++  ++ ++  D+++ +++ +rk+++++ +  y 
  ACF56707.1 195 RNSQWHDLESPIMLDMLRDMQDKARKNKINFAVagYL 231
                 4567999************************996554 PP

>> PF07550  Protein of unknown function (DUF1533)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.018        53      24      65 .]     195     237 ..     174     237 .. 0.71

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.018
     PF07550  24 enskyeiseagk.lkikagvfnkdGentIkIkakGYkdatitq 65 
                 +ns++   e+   l+   +  +k+++n+I++   GY +++++q
  ACF56707.1 195 RNSQWHDLESPImLDMLRDMQDKARKNKINFAVAGYLNTSFIQ 237
                 55666555666667777777899**************999987 PP

>> PF01756  Acyl-CoA oxidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.023        69      59      90 ..      31      63 ..       7      77 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.023
     PF01756 59 yllkaflekve.eiadeelkevLeklakLYalw 90
                yll++  +++  ++ ++ +k++Le++++LY+  
  ACF56707.1 31 YLLRELNQNIIlASCQQFVKDYLETICSLYSDE 63
                788888888888889999************865 PP

>> PF02671  Paired amphipathic helix repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.043   1.3e+02       7      26 ..     102     121 ..     100     148 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.043
     PF02671   7 FLeiLhdyskeiisrtelyq 26 
                  L +L  +++e   +te+yq
  ACF56707.1 102 LLACLDEFQAEAHVVTEVYQ 121
                 699****************9 PP

>> PF03597  Cytochrome oxidase maturation protein cbb3-type
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.036   1.1e+02      21      37 ..     190     206 ..     184     213 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.036
     PF03597  21 FlWavksgQfDDlegpa 37 
                  + ++++ Q +Dle+p 
  ACF56707.1 190 VFATMRNSQWHDLESPI 206
                 5789**********994 PP

>> PF11426  Tn7 transposition regulator TnsC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.065     2e+02       1      11 [.     194     204 ..     194     205 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.065
     PF11426   1 iKqkdWhtLds 11 
                 ++ ++Wh+L+s
  ACF56707.1 194 MRNSQWHDLES 204
                 6889*****97 PP

>> PF07582  AP endonuclease family 2 C terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.067     2e+02       3      17 ..     140     154 ..     138     156 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.067
     PF07582   3 eeifsaLnqigYdgp 17 
                 ++ + aL+q+g++g 
  ACF56707.1 140 KQAITALRQYGFTGK 154
                 67899********95 PP

>> PF12153  LPS binding domain of CAP18 (C terminal)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.1     0.081   2.5e+02       8      15 ..       9      16 ..       2      16 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.081
                HHHHHHHH CS
     PF12153  8 geKIgEkl 15
                geKI Ek+
  ACF56707.1  9 GEKILEKI 16
                9******8 PP

>> PF03522  K-Cl Co-transporter type 1 (KCC1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1     0.085   2.6e+02      12      18 ..      58      64 ..      56      65 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.085
     PF03522 12 SvgSDed 18
                S++SDe+
  ACF56707.1 58 SLYSDEE 64
                9*****8 PP

>> PF00535  Glycosyl transferase family 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.089   2.7e+02       1      22 [.     127     148 ..     127     159 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.089
                 EEEEEESS-CCCHHHHHHHHHC CS
     PF00535   1 sviiptyNeekylletleslla 22 
                 svi p+ N ++ l++++++l++
  ACF56707.1 127 SVIFPFVNDADQLKQAITALRQ 148
                 8*****************8876 PP

>> PF10011  Predicted membrane protein (DUF2254)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.073   2.2e+02     305     354 ..     101     150 ..      97     158 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.073
     PF10011 305 rltrllselaerklpsdaredeeekprvvvpelsfedllddafaqirryg 354
                 rl ++l e++ +    +++++ + ++ v++p ++ +d l++a++++r+yg
  ACF56707.1 101 RLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLKQAITALRQYG 150
                 6667777777777777777777777************************9 PP

>> PF05308  Protein of unknown function (DUF729)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.075   2.3e+02     230     248 ..     197     215 ..     187     219 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.075
     PF05308 230 skskskelpnmldvLkdmn 248
                 s+ +  e p mld+L+dm+
  ACF56707.1 197 SQWHDLESPIMLDMLRDMQ 215
                 4445567899********6 PP

>> PF11408  Sgs1 RecQ helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1       0.1   3.1e+02      21      40 ..     221     240 ..     208     242 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.1
                 --SSS-----S-HHHHHHHH CS
     PF11408  21 nrmnlpvdtylpdnilkkiA 40 
                 n++n++v  yl+ + ++k+ 
  ACF56707.1 221 NKINFAVAGYLNTSFIQKMN 240
                 9*****************95 PP

>> PF05678  VQ motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.2      0.14   4.1e+02       5      13 ..     117     125 ..     114     125 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.14
     PF05678   5 ptvihtdpa 13 
                 ++v++t+p+
  ACF56707.1 117 TEVYQTNPN 125
                 9*******7 PP

>> PF11295  Protein of unknown function (DUF3096)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.17     5e+02      18      26 ..     223     231 ..     222     233 .. 0.94

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.17
     PF11295  18 LnyiVAiYL 26 
                 +n++VA YL
  ACF56707.1 223 INFAVAGYL 231
                 7*******9 PP

>> PF05184  Saposin-like type B, region 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1       0.3   9.1e+02      24      37 ..      46      59 ..      45      59 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.3
     PF05184 24 eeeIikaldkvCel 37
                ++ ++++l+ +C+l
  ACF56707.1 46 QQFVKDYLETICSL 59
                67899*******85 PP

>> PF03489  Saposin-like type B, region 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.38   1.2e+03       4      15 ..      45      56 ..      43      59 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.38
                HHHHHHHHHHHH CS
     PF03489  4 CkefVdqYgpli 15
                C++fV  Y+++i
  ACF56707.1 45 CQQFVKDYLETI 56
                ********9987 PP

>> PF12390  Selenocysteine synthase N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0       0.3     9e+02      26      40 .]     205     219 ..     200     219 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.3
     PF12390  26 alvrdavrafLdrcR 40 
                 +  +d +r+++d++R
  ACF56707.1 205 PIMLDMLRDMQDKAR 219
                 567899********9 PP

>> PF05786  Barren protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0       0.2   5.9e+02     100     121 ..     208     229 ..     206     231 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.2
     PF05786 100 IDylsdllklkegeetNFqkAs 121
                  D l d+ ++  ++++NF +A+
  ACF56707.1 208 LDMLRDMQDKARKNKINFAVAG 229
                 79*****************997 PP

>> PF12224  Putative amidoligase enzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.36   1.1e+03     157     224 ..      23      90 ..      10     100 .. 0.80

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.36
     PF12224 157 ycrpfreeyvervrleaersatldeleddyltrnptrnraldllplfaqldedsrynalnleskvkar 224
                 ++  +r ey+ r++ ++   a+ +++ +dyl++ ++ +++ ++ + f++l++  +   + +++ + ++
  ACF56707.1  23 HVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFTELTNTEANCLVGTKEFFDEG 90 
                 6667777888885555556688999************************9999888888888777665 PP

>> PF02216  B domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.31   9.3e+02      36      53 ..     262     279 ..     260     280 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.31
     PF02216  36 ddPsrsqevlaEakklnd 53 
                 d+P+  + +  E+kkl  
  ACF56707.1 262 DHPDHLKHIKEESKKLQR 279
                 89*************975 PP

>> PF12436  Ubiquitin-specific protease 7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.6      0.33   9.9e+02       2      10 ..     260     268 ..     259     269 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.33
     PF12436   2 eeDvPeHlp 10 
                 e D+P+Hl+
  ACF56707.1 260 EIDHPDHLK 268
                 78*****96 PP

>> PF07708  Tash protein PEST motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.2      0.54   1.6e+03       5      12 ..     254     261 ..     254     262 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.54
     PF07708   5 PETItvEl 12 
                 PE++ +E+
  ACF56707.1 254 PEIFDLEI 261
                 9******9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (289 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       396  (0.0332438); expected 238.2 (0.02)
Passed bias filter:                      313  (0.026276); expected 238.2 (0.02)
Passed Vit filter:                        33  (0.00277032); expected 11.9 (0.001)
Passed Fwd filter:                        33  (0.00277032); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              33  [number of targets reported over threshold]
# CPU time: 0.23u 0.05s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 2712.71
//