hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_28349.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACF56337.1
Accession:      [none]
Description:    spne4 ACF56337.1 GIB00761CH01 "transcriptional regulator, RpiR family"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048077  SIS domain                                      84.0    5.5e-24   1
0039507  SIS domain                                      83.5    1.3e-23   1
0045017  SIS domain                                      81.4    1.9e-22   1
0050197  SIS domain                                      74.9    2.8e-20   1
0048203  SIS domain                                      62.3    9.5e-20   1
0039383  SIS domain                                      69.2    2.9e-19   1
0044035  SIS domain                                      68.2      6e-19   1
0050875  SIS domain                                      69.5    7.6e-19   1
0048425  SIS domain                                      57.1      1e-16   1
0049747  SIS domain                                      55.2    1.8e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0044035    1/1      81   252 ..     1   188 []    68.2    6e-19
0048203    1/1      83   204 ..     1   132 [.    62.3  9.5e-20
0039383    1/1      84   207 ..     1   124 [.    69.2  2.9e-19
0045017    1/1      84   247 ..     1   191 []    81.4  1.9e-22
0050875    1/1      85   257 ..     1   194 []    69.5  7.6e-19
0048425    1/1      86   207 ..     1   166 [.    57.1    1e-16
0050197    1/1      86   247 ..     1   192 []    74.9  2.8e-20
0039507    1/1      87   247 ..     1   177 []    83.5  1.3e-23
0048077    1/1      87   252 ..     1   186 []    84.0  5.5e-24
0049747    1/1      89   204 ..     1   112 [.    55.2  1.8e-16

Alignments of top-scoring domains:
0044035: domain 1 of 1, from 81 to 252: score 68.2, E = 6e-19
                   *->lekddlldlilkeleelpealeetlelld.eaieaaaelllnagril
                       ++  + ++  k+l  + e+l++t+  ld+ ++e++ae++  a+r++
  ACF56337.1    81    EKLALYTEATEKVLSDYEEMLRKTYTVLDeVQLERIAEMIETAERVY 127  

                   vlGaGtsgavAlelalklkelgyihaeglpgellhgplalitaiendedy
                   ++G G+s ++ +e+++++++lg i                      ++ +
  ACF56337.1   128 LYGKGSSVLALQEMKMRFMRLGVIG---------------------EVLS 156  

                   dvvflrqldalltkgdvliaiSqSGetpevlealeeakergakviaitgn
                   d+ ++++   ll+++ ++i+ S SG t  vle l++a ++gak++ +t +
  ACF56337.1   157 DEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTR 206  

                   pgsplakladivllvpagpe......tksftaqllvldlLalllavrrdekggydhfmlkeileqpekvldtlaealealaelld.eilekavel
                                l  ++e+ ekvl+ ++e+l+++   ld+  le+++e+
  ACF56337.1    83    ----------LALYTEATEKVLSDYEEMLRKTYTVLDeVQLERIAEM 119  

                   llnagrvviiGiGgSglaalaaaallesllglpvfvvhdseallgdl.ll
                   ++ a+rv+++G G+S la + +++++++ lg+  +v++d +++l    ll
  ACF56337.1   120 IETAERVYLYGKGSSVLALQEMKMRFMR-LGVIGEVLSDEDMILWSSlLL 168  

                   dpgdlviaiSqSGeTpetlaalelakergakvTiaiTdfmlkeikeqpeaiieale.tledlllealekavelllnakrivivG
                        + +  +++++ ++e l++t+  l++ +le+++e++  a+r++++G
  ACF56337.1    84    ALYTEATEKVLSDYEEMLRkTYTVLDEVQLERIAEMIETAERVYLYG 130  

                   cGtSghaalaaayllerllglpvfvlsdseflrydlglltegdlviaiSq
                    G+S +a + ++++++r lg+  +vlsd ++++    ll+e+ lvi+ S 
  ACF56337.1   131 KGSSVLALQEMKMRFMR-LGVIGEVLSDEDMILWSSLLLNENCLVIGASI 179  

                   SGeTaetlaalelakkrgakviaiTnnpdslleilkeileeliealealaealdeeaieeaaellaealknggri
                        + e  +++l+++ e+l+++  +lde ++e++ae++  a    +r+
  ACF56337.1    84    ALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETA----ERV 126  

                   lvlGrGgSgavAlelalklketfyihrlglpalalgdshllealhgdlgy
                   +++G G+S ++ +e++++++      rlg+ + +l+d  ++         
  ACF56337.1   127 YLYGKGSSVLALQEMKMRFM------RLGVIGEVLSDEDMI--------- 161  

                   eelfarqlaalldegdvviaistsGetpevlealeeakergakviaiTgn
                        ++   ll+e+++vi+ s sG t+ vle l++a ++gak++ +T +
  ACF56337.1   162 -----LWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTR 206  

                   pgsplakladvvllvpagpe.....atksqtaqllvldlLalalavalG<
                   + ++   + d  ll+ ++++  + ++++ q++ ll+ d+L+         
  ACF56337.1   207 KFDEEDCFFDELLLLASTDHlsygnRISPQFPILLITDCLF--------  247  

                   -*
                     
  ACF56337.1     -    -    

0050875: domain 1 of 1, from 85 to 257: score 69.5, E = 7.6e-19
                   *->dlldiilkvleeeiealaetlellddaieeavellaeallnagrilv
                       + +  +kvl ++ e+l++t   ld   e ++e++ae++  a+r+++
  ACF56337.1    85    LYTEATEKVLSDYEEMLRKTYTVLD---EVQLERIAEMIETAERVYL 128  

                   lGnGgsgavAlelalklletfyiereglpaealhgdlalltaiendegyp
                   +G G+s ++ +e+ ++++      r+g+++e+l++  ++l          
  ACF56337.1   129 YGKGSSVLALQEMKMRFM------RLGVIGEVLSDEDMIL---------- 162  

                   vvfarqldallgpgDvliaiStsGetaevlealeaakergakviaitgnp
                        +   ll+++ ++i+ S sG t  vle l+ a ++gak++ +t ++
  ACF56337.1   163 -----WSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRK 207  

                   gsplaelldeadvvllvpagee......tlsqtaqlvvldlLalllalrl
                    ++        d  ll+ +++   + + ++ q   l++ d+L+  +++  
  ACF56337.1   208 FDEEDCF---FDELLLLASTDHlsygnrISPQFPILLITDCLFSNYLESP 254  

                   gkdlGklvteevnelsldldllskgdylhfmlkeileqpealektleli.
                                             y +  +k++  + e l+kt   ++
  ACF56337.1    86    -----------------------YTEATEKVLSDYEEMLRKTYTVLd 109  

                   eeaieaaaellknagriiiiGaGtSghiAleaaakleelggipvellpge
                   e  +e++ae+++ a+r++++G G+S ++ +e+++++++lg i        
  ACF56337.1   110 EVQLERIAEMIETAERVYLYGKGSSVLALQEMKMRFMRLGVIGE------ 153  

                   alhgdlalltaiendedyedasefrlraalidkgdvviaiSqSGetadvl
                                     +d  +  +  +l++++ +vi+ S SG+t  vl
  ACF56337.1   154 ----------------VLSDEDMILWSSLLLNENCLVIGASISGQTDIVL 187  

                   aaleyakergaktiaitnnpdgylhimlkelkevpealeetlelldeeaieaaaellanagrifilG
                        y +  +k+l  + e+l++t   lde ++e++ae++  a+r++++G
  ACF56337.1    86    --YTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYG 130  

                   aGtSgaiAlelalklkelgypavelshgdlal.....idegdvviaiStS
                    G+S ++ +e+++++++lg +  +ls+ d+ l     ++e+ +vi+ S S
  ACF56337.1   131 KGSSVLALQEMKMRFMRLGVIGEVLSDEDMILwssllLNENCLVIGASIS 180  

                   Getaevlealeeakergakviaitgnpgsplakladivllvpagpealva
                   G+t  vle l++a ++gak++++t  +  +     d  ll+ ++++  ++
  ACF56337.1   181 GQTDIVLEGLQKAADKGAKTVLMTTRKFDEEDCFFDELLLLASTDHLSYG 230  

                   staattsqllalilllllllgdalavallellgftkedfallhpgGslGk
                   + ++  + +l + + l+                                 
  ACF56337.1   231 NRISPQFPILLITDCLF--------------------------------- 247  

                   leilkeileeliaaleallelldeeaiekaaelllnagrifilGrGt
                       e  +++l+ ++++l+++  +lde ++e++ae++  a+r++++G G+
  ACF56337.1    87    TEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGS 133  

                   sglvAlelalklkelglpagalsdgpl.....alldegdlviaisqsGet
                   s l+ +e+++++++lg++ ++lsd +++     ll+e+ lvi+ s sG t
  ACF56337.1   134 SVLALQEMKMRFMRLGVIGEVLSDEDMilwssLLLNENCLVIGASISGQT 183  

                   eevlealeeakergakviaitnn.gsplakladlvllvpageealvlast
                   + vle l++a ++gak++ +t+++ +    + d  ll+ +++++ +  ++
  ACF56337.1   184 DIVLEGLQKAADKGAKTVLMTTRkFDEEDCFFDELLLLASTDHLSYGNRI 233  

                   ksftaqllvldlLalalalrrgldvdkprnlaksvtedimlkeleelpealeetlelldeeaiekaaelllnagrifilGrGt
                       + + k+l  + e l++t+  lde ++e++ae++  a+r++++G G+
  ACF56337.1    87    TEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGS 133  

                   sglvAleaalklkelglpagalsdgdla.....lidegdlviaisqsGet
                   s l+ +e+++++++lg+  ++lsd d+      l++e+ lvi+ s sG t
  ACF56337.1   134 SVLALQEMKMRFMRLGVIGEVLSDEDMIlwsslLLNENCLVIGASISGQT 183  

                   aevlealeeakargakviaiTnnpgsplakladivllvpageeililsll
                   + vle l++a ++gak++++T+ +  +     d  ll+ +++++ +++  
  ACF56337.1   184 DIVLEGLQKAADKGAKTVLMTTRKFDEEDCFFDELLLLASTDHLSYGN-- 231  

                   lllqvaptlsptaqlvlldlLalalalrrgldvddprnlhksvtSfmlkeileqlealaetlerldeealeaaaellkkagrvvviGiGgS
                        ++k++ ++ e l++t   lde +le++ae+++ a+rv+++G G+S
  ACF56337.1    89    -ATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSS 134  

                   glaalalaaaleslglpvifvsdsdlgyita.....gdlviaiSkSGeTp
                    la + +++++++lg+  +++sd d+ + ++   +++ lvi++S SG T 
  ACF56337.1   135 VLALQEMKMRFMRLGVIGEVLSDEDMILWSSlllneNCLVIGASISGQTD 184  

                   etlaalelakelgaktiaiT