RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF55228.1 spne4 ACF55228.1 GIB00761CH01
"5'-methylthioadenosine/S-adenosylhomocysteine nu.."
         (230 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3df9A [c.56.2 (1nc1A)] MTA/SAH NUCLEOSIDASE                           182   1e-48
3df9B [c.56.2 (1nc1B)] MTA/SAH NUCLEOSIDASE                           176   8e-47
3bl6A [x.x.x] 5'-METHYLTHIOADENOSINE NUCLEOSIDASE/S-                  165   1e-43
3dp9A [x.x.x] MTA/SAH NUCLEOSIDASE                                    163   7e-43
3dp9C [x.x.x] MTA/SAH NUCLEOSIDASE                                    159   7e-42
3eeiA [x.x.x] 5-METHYLTHIOADENOSINE NUCLEOSIDASE/S-                   159   1e-41
3ddoB [x.x.x] URIDINE PHOSPHORYLASE                                   139   7e-36
3dpsF [x.x.x] URIDINE PHOSPHORYLASE                                   138   1e-35
3ddoA [x.x.x] URIDINE PHOSPHORYLASE                                   138   2e-35
2ac7B [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         131   2e-33
2a8yA [x.x.x] 5'-METHYLTHIOADENOSINE PHOSPHORYLASE (MTAP)             131   3e-33
3bsfA [x.x.x] AT4G34840                                               126   5e-32
2ai2A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         125   1e-31
3c74F [x.x.x] URIDINE PHOSPHORYLASE                                   122   7e-31
1cb0A [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE               122   7e-31
2ai3A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         121   2e-30
3ddoE [x.x.x] URIDINE PHOSPHORYLASE                                   120   5e-30
1a69C [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE                        119   8e-30
3e9rB [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE                         118   1e-29
2bsxA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         118   1e-29
2ac7A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         117   3e-29
3c74A [x.x.x] URIDINE PHOSPHORYLASE                                   117   3e-29
3c74E [x.x.x] URIDINE PHOSPHORYLASE                                   114   3e-28
3bgsA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         111   2e-27
1a9oA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         110   4e-27
3e0qA [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE                         109   6e-27
1a9qA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         109   8e-27
2a0wA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         108   1e-26
2a0xA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         107   3e-26
3ddoF [x.x.x] URIDINE PHOSPHORYLASE                                   107   4e-26
3ddoC [x.x.x] URIDINE PHOSPHORYLASE                                   106   9e-26
1b8oA [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE                        103   4e-25
3djfB [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE                         103   5e-25
2a0yA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                         103   7e-25
1b8nA [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE                         97   5e-23
2b94A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE                          66   9e-14
3e9zC [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE                          50   5e-09
1c3xA [c.56.2] PENTOSYLTRANSFERASE                                     41   5e-06
3bjeA [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE                       37   5e-05
3bldA [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE                          36   1e-04

>3df9A [c.56.2 (1nc1A)] MTA/SAH NUCLEOSIDASE
          Length = 234

 Score =  182 bits (462), Expect = 1e-48
 Identities = 91/229 (39%), Positives = 147/229 (64%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           MKIGII AM EE+  L   ++N Q   + G   +TG +   EV L++SGIGKV +A+   
Sbjct: 3   MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT 62

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
           +L +H + D +INTGSAG +A  + VGD+V++D+  YHD DVTAFGY YGQ+   P  F+
Sbjct: 63  LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK 122

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
           +D   +A  +  +++L+ N   GLI +GD+F+ G+  +  I+ +FP+ +AVEME      
Sbjct: 123 ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH 182

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
                N+P +V+RA+SD A+ ++++ FDEF+  A ++S+ ++ + ++ L
Sbjct: 183 VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL 231


>3df9B [c.56.2 (1nc1B)] MTA/SAH NUCLEOSIDASE
          Length = 232

 Score =  176 bits (446), Expect = 8e-47
 Identities = 91/229 (39%), Positives = 147/229 (64%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           MKIGII AM EE+  L   ++N Q   + G   +TG +   EV L++SGIGKV +A+   
Sbjct: 1   MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT 60

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
           +L +H + D +INTGSAG +A  + VGD+V++D+  YHD DVTAFGY YGQ+   P  F+
Sbjct: 61  LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK 120

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
           +D   +A  +  +++L+ N   GLI +GD+F+ G+  +  I+ +FP+ +AVEME      
Sbjct: 121 ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH 180

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
                N+P +V+RA+SD A+ ++++ FDEF+  A ++S+ ++ + ++ L
Sbjct: 181 VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKL 229


>3bl6A [x.x.x] 5'-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
          Length = 230

 Score =  165 bits (419), Expect = 1e-43
 Identities = 95/229 (41%), Positives = 137/229 (59%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           M IGII AM EE+  L   L    E  V    ++TG +   EVV+ +SGIGKV +A+S  
Sbjct: 2   MMIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTT 61

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
           +L + F+ D +INTGSAGA+ E + VGDV+I+D + YHD D TAFGY YGQ+ Q P+ F+
Sbjct: 62  LLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQ 121

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
           S K  + ++ + + Q       GLI +GDSF+   ++ + IK  FP  +AVEME      
Sbjct: 122 SSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQ 181

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
                N+P +V+RA+SD AN EA + F+ F+ +A   S+Q +   +  L
Sbjct: 182 TCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL 230


>3dp9A [x.x.x] MTA/SAH NUCLEOSIDASE
          Length = 229

 Score =  163 bits (412), Expect = 7e-43
 Identities = 95/229 (41%), Positives = 145/229 (63%), Gaps = 1/229 (0%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           KIGII AM +E+A L   +++ QE    G T+++G I   +VVL++SGIGKV +A+  A+
Sbjct: 1   KIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTAL 60

Query: 62  LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFES 121
           L   +  D +INTGSAG     + VGDVVI+ ++ +HD DVTAFGY  GQMA QP  F++
Sbjct: 61  LISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKA 120

Query: 122 DKTFVAQIQESLSQLDQN-WHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
           D+  +   +++L+QL       GLI TGD+FV   ++ + I+ HFP V+AVEME      
Sbjct: 121 DEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQ 180

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
                 +P +V+RA+SD A+ E+ + F+EF+  A + S+ ++L  ++ L
Sbjct: 181 TCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELL 229


>3dp9C [x.x.x] MTA/SAH NUCLEOSIDASE
          Length = 230

 Score =  159 bits (403), Expect = 7e-42
 Identities = 96/230 (41%), Positives = 147/230 (63%), Gaps = 1/230 (0%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           MKIGII AM +E+A L   +++ QE    G T+++G I   +VVL++SGIGKV +A+  A
Sbjct: 1   MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTA 60

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
           +L   +  D +INTGSAG     + VGDVVI+ ++ +HD DVTAFGY  GQMA QP  F+
Sbjct: 61  LLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFK 120

Query: 121 SDKTFVAQIQESLSQLD-QNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXX 179
           +D+  +   +++L+QL   +   GLI TGD+FV   ++ + I+ HFP V+AVEME     
Sbjct: 121 ADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIA 180

Query: 180 XXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
                  +P +V+RA+SD A+ E+ + F+EF+  A + S+ ++L  ++ L
Sbjct: 181 QTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELL 230


>3eeiA [x.x.x] 5-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
          Length = 231

 Score =  159 bits (402), Expect = 1e-41
 Identities = 90/229 (39%), Positives = 136/229 (59%), Gaps = 1/229 (0%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
            + +I AM +E+  L + ++N +       + + G +A   +VL  SGIGKV +A++ A 
Sbjct: 3   TVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAW 62

Query: 62  LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFES 121
           +   F  D +INTGSAG + +G+ VGDVVI  + A+HDVDVTAFGYA+GQ+ Q P  F S
Sbjct: 63  IIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPARFAS 122

Query: 122 DKTFVAQIQESLSQLD-QNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
           D   +   + +    +      GLI +GD FV  ++ +  I+ HFPEV AVEME      
Sbjct: 123 DGILIEAAKRAARTFEGAAVEQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQ 182

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
               L  P ++IRA+SD+A+ +A+I FDEF+  A   SA+++   +K+L
Sbjct: 183 TCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAKMVAEIVKSL 231


>3ddoB [x.x.x] URIDINE PHOSPHORYLASE
          Length = 244

 Score =  139 bits (352), Expect = 7e-36
 Identities = 37/235 (15%), Positives = 79/235 (33%), Gaps = 22/235 (9%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 18  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 77

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++         D  +  +A  +         
Sbjct: 78  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA---- 130

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
            D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 131 -DFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 189

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL 222
           V+  EME            L   ++  +  N   +        +      + ++L
Sbjct: 190 VMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPTESHAVKIVVEAARRLL 244


>3dpsF [x.x.x] URIDINE PHOSPHORYLASE
          Length = 226

 Score =  138 bits (350), Expect = 1e-35
 Identities = 41/223 (18%), Positives = 79/223 (35%), Gaps = 14/223 (6%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++         D  +  +A  +         
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA---- 129

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXX 180
            D      + E+   +    H G+ A+ D+F  G    E        V+  EME      
Sbjct: 130 -DFACTTALVEAAKSIGATTHVGVTASSDTFYPGQSMEEWQAM---GVMNYEMESATLLT 185

Query: 181 XXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLL 223
                 L   ++  +  N   E         ++    +A+ LL
Sbjct: 186 MCASQGLRAGMVAGVIVNRTQEKQTESHA--VKIVVEAARRLL 226


>3ddoA [x.x.x] URIDINE PHOSPHORYLASE
          Length = 240

 Score =  138 bits (348), Expect = 2e-35
 Identities = 40/230 (17%), Positives = 81/230 (35%), Gaps = 22/230 (9%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++         D  +  +A  +         
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA---- 129

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
            D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 130 -DFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 188

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRR 217
           V+  EME            L   ++  +  N   +      + ++EA RR
Sbjct: 189 VMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQTSHAVKIVVEAARR 238


>2ac7B [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 221

 Score =  131 bits (330), Expect = 2e-33
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 9/215 (4%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV--VLGNTYHTGTIASHEVVLVESGIGKVMSAMSV 59
           +  ++   P    Y+ +           V G    TGT     V +  +G+G    ++ V
Sbjct: 13  ESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYV 72

Query: 60  AILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYF 119
             L   + V  LI  G+ GA+ + + V DV+IA                           
Sbjct: 73  NELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDS------NMNRLTFPGFDFAP 126

Query: 120 ESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXX 179
            ++   + +  ++ ++   +   G + T D F   +  +      +  VLAVEME     
Sbjct: 127 AANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYG-VLAVEMETTALY 185

Query: 180 XXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEA 214
                  +  L +  +SD+          E  ++A
Sbjct: 186 TLAAKYGVNALSVLTVSDHIFQTTFNEMIEIALDA 220


>2a8yA [x.x.x] 5'-METHYLTHIOADENOSINE PHOSPHORYLASE (MTAP)
          Length = 263

 Score =  131 bits (329), Expect = 3e-33
 Identities = 31/238 (13%), Positives = 62/238 (26%), Gaps = 10/238 (4%)

Query: 2   KIGIIAAMPEE-LAYLVQHLDNAQEQV--VLGNTYHTGTIASHEVV-LVESGIGKVMSAM 57
            IGII            +  +           +    G I +  V  L   G G  +   
Sbjct: 9   SIGIIGGSGLYDPGIFSESKEIKVYTPYGQPSDFITIGKIGNKSVAFLPRHGRGHRIPPH 68

Query: 58  SVAILA-----DHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQM 112
            +   A         V  +I+  + G++     +GD VI D+      +     +    +
Sbjct: 69  KINYRANIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDGPVV 128

Query: 113 AQQPLYFESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIE-AIKSHFPEVLAV 171
           A   +      +      E+  +L+   H             + + E        +   +
Sbjct: 129 AHVSMADPFCNSLRKLAIETAKELNIKTHESGTYICIEGPRFSTRAESRTWREVYKADII 188

Query: 172 EMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKAL 229
            M             +    I  ++D           E +      + +     L AL
Sbjct: 189 GMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIPVTAEEVTRVMAENTEKAKKLLYAL 246


>3bsfA [x.x.x] AT4G34840
          Length = 244

 Score =  126 bits (318), Expect = 5e-32
 Identities = 44/245 (17%), Positives = 84/245 (34%), Gaps = 29/245 (11%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVV--------------LGNTYHTGTIASHEVVLV 46
             I  I AM +E   L+  L   +E                   +          +  L 
Sbjct: 4   STIVFIVAMQKEAQPLINRLRLVEEVNTPFPKEVTWIMFKGMYKDLNINIVCPGKDSTLG 63

Query: 47  ESGIGKVMSAMSVAILADHFQVDALINTGSAGAV-AEGIAVGDVVIADKLAYHDVDVTAF 105
              +G V +++         Q D +IN G+AG   A+G  + DV +   +A+HD  +   
Sbjct: 64  VESVGTVPASLVTYASILAIQPDLIINAGTAGGFKAKGACISDVYVVSTVAFHDRRIPVP 123

Query: 106 GYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHF 165
                 +  +                     + N   G ++TGDS        E+I ++ 
Sbjct: 124 VLDIYGVGMRNT-----------FPTPNLIKELNLKVGRLSTGDSMDMSPHDEESITAND 172

Query: 166 PEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTF 225
                 +MEG           +P ++I+ ++D  +       +EF+      +A++  + 
Sbjct: 173 --ATVKDMEGAAVAYVADIFKVPTILIKGVTDIVDGNRPT-SEEFLENLAAVTAKLDESL 229

Query: 226 LKALD 230
            K +D
Sbjct: 230 TKVID 234


>2ai2A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 274

 Score =  125 bits (314), Expect = 1e-31
 Identities = 24/253 (9%), Positives = 63/253 (24%), Gaps = 25/253 (9%)

Query: 1   MKIGII-----AAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMS 55
            ++ +I       +  +L        +             G +     V+++        
Sbjct: 23  PQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEG 82

Query: 56  AMSVAILA-----DHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYG 110
                +           V+ L+ T +AG +     VGD+++                   
Sbjct: 83  YPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGP 142

Query: 111 QMAQQPLYFES-----DKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKS 163
              +  + F +     D+    +   +  Q+ +      G                 +  
Sbjct: 143 NEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLR 202

Query: 164 HFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIF-------FDEFIIEAGR 216
           +     AV M             L V     +++    +             E   +A +
Sbjct: 203 NL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQ 261

Query: 217 RSAQVLLTFLKAL 229
           +  Q +   + ++
Sbjct: 262 KLEQFVSLLMASI 274


>3c74F [x.x.x] URIDINE PHOSPHORYLASE
          Length = 248

 Score =  122 bits (308), Expect = 7e-31
 Identities = 38/240 (15%), Positives = 77/240 (32%), Gaps = 23/240 (9%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQE-QVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++       D     F               
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFP-------AV 128

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
           +D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 129 ADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 188

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEF-IIEAGRRSAQVLLTFL 226
           V+  EME            L   ++  +  N   +     +      A +   +     L
Sbjct: 189 VMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKESHAVKIVVEAARRLL 248


>1cb0A [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
          Length = 268

 Score =  122 bits (308), Expect = 7e-31
 Identities = 34/244 (13%), Positives = 68/244 (27%), Gaps = 15/244 (6%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQVVLG---NTYHTGTIASHEVV-LVESGIGKVMSA 56
           +KIGII     +   +++           G   +    G I + + V L   G    +  
Sbjct: 2   VKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMP 61

Query: 57  MSVAI-----LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQ 111
             V                +I T + G++ E I  GD+VI D+            Y    
Sbjct: 62  SKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSH 121

Query: 112 MAQQPLYFES-----DKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFP 166
              + +                + E+  +L    H             + + E+      
Sbjct: 122 SCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTW 181

Query: 167 EVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEAN-IFFDEFIIEAGRRSAQVLLTF 225
               + M             +    I   +D      +     + + E   ++  +LLT 
Sbjct: 182 GADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTT 241

Query: 226 LKAL 229
           +  +
Sbjct: 242 IPQI 245


>2ai3A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 272

 Score =  121 bits (304), Expect = 2e-30
 Identities = 22/247 (8%), Positives = 61/247 (24%), Gaps = 18/247 (7%)

Query: 1   MKIGII-----AAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVES----GIG 51
            ++ +I       +  +L        +             G +     V+++       G
Sbjct: 23  PQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEG 82

Query: 52  KVMSAMSVAIL-ADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYG 110
                ++  +       V+ L+ T +AG +     VGD+++                   
Sbjct: 83  YPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGP 142

Query: 111 QM-----AQQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKS 163
                      +    D+    +   +  Q+ +      G                 +  
Sbjct: 143 NEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLR 202

Query: 164 HFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLL 223
           +     AV M             L V     +++    +     +E +    + + ++  
Sbjct: 203 NL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYKANHEEVLEAGKQAAQKLEQ 261

Query: 224 TFLKALD 230
                + 
Sbjct: 262 FVSLLMA 268


>3ddoE [x.x.x] URIDINE PHOSPHORYLASE
          Length = 242

 Score =  120 bits (301), Expect = 5e-30
 Identities = 36/236 (15%), Positives = 75/236 (31%), Gaps = 23/236 (9%)

Query: 1   MKIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSV 59
            ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V
Sbjct: 16  AQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAV 75

Query: 60  AILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYF 119
             LA    +   +  G+ GA+   I VGDV++       D     F              
Sbjct: 76  EELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADF--- 131

Query: 120 ESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------ 167
                    + E+   +    H G+ A+ D+F  G ++ +                    
Sbjct: 132 ----ACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAM 187

Query: 168 -VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL 222
            V+  EME            L   ++  +  N   +        +      + ++L
Sbjct: 188 GVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQKQT-ESHAVKIVVEAARRLL 242


>1a69C [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 233

 Score =  119 bits (299), Expect = 8e-30
 Identities = 42/226 (18%), Positives = 76/226 (33%), Gaps = 12/226 (5%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV--VLGNTYHTGTIASHEVVLVESGIGKVMSAMSV 59
            + ++   P    Y+ +       +V  V G    TGT    ++ ++  G+G    ++  
Sbjct: 14  DVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYT 73

Query: 60  AILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYF 119
             L   F V  +I  GS GAV   + + DVVI                   +        
Sbjct: 74  KELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDS------KVNRIRFKDHDFAA 127

Query: 120 ESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXX 179
            +D   V    ++   L  +   G + + D F + + ++  +   +  +L VEME     
Sbjct: 128 IADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYG-ILGVEMEAAGIY 186

Query: 180 XXXXXLNLPVLVIRAMSDNANHEAN---IFFDEFIIEAGRRSAQVL 222
                     L I  +SD+    A      F++ I  A        
Sbjct: 187 GVAAEFGAKALTICTVSDHIRTTAAERQTTFNDMIKIALESVLLGD 232


>3e9rB [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
          Length = 273

 Score =  118 bits (297), Expect = 1e-29
 Identities = 27/248 (10%), Positives = 64/248 (25%), Gaps = 22/248 (8%)

Query: 2   KIGIIAAMP-----EELAYLVQHLDNAQEQVVL--GNTYHTGTIASHEVVLVE------S 48
           +IGII         + +   +                    GT++  +VV+++       
Sbjct: 25  EIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSSGNLIFGTLSGRKVVVMQGRFHMYE 84

Query: 49  GIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYA 108
           G      A+ + ++     V  L+ + +AG +   + +GD VI     Y           
Sbjct: 85  GYSNDTVALPIRVMK-LLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILV 143

Query: 109 YGQMAQQPLYFES-----DKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAI 161
                     F +     D+       +   +       H G+                +
Sbjct: 144 GPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTM 203

Query: 162 KSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQV 221
             +      V M             + V  +  +++ +  +          +        
Sbjct: 204 LLNM-GCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVEEEVLATGAQRAELMQSW 262

Query: 222 LLTFLKAL 229
               ++ L
Sbjct: 263 FEKIIEKL 270


>2bsxA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 241

 Score =  118 bits (297), Expect = 1e-29
 Identities = 28/231 (12%), Positives = 63/231 (27%), Gaps = 14/231 (6%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQVVLGN-TYHTGTIASHEVVLVESGIGKVMSAMSVA 60
            + ++   P  +  +    D+  +                 + + V  G+G    A+   
Sbjct: 17  PVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFE 76

Query: 61  ILADHFQVDALINTGSAGAV-AEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYF 119
            L        +I  GS G++  + I  GD+ I +     D       +            
Sbjct: 77  ELC-QNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIH-------GDFPA 128

Query: 120 ESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSH-FPEVLAVEMEGXXX 178
             D      + +   +L+     G+  + D +         ++ +       VEME    
Sbjct: 129 VGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATL 188

Query: 179 XXXXXXLNLPVLVIRAMSDNANHEANI---FFDEFIIEAGRRSAQVLLTFL 226
                   +    I  +         +     +  I  A    A++   + 
Sbjct: 189 MVIGTLRKVKTGGILIVDGCPFKWDELVPHQLENMIKIALGACAKLATKYA 239


>2ac7A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 220

 Score =  117 bits (294), Expect = 3e-29
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 9/215 (4%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV--VLGNTYHTGTIASHEVVLVESGIGKVMSAMSV 59
           +  ++   P    Y+ +           V G    TGT     V +  +G+G    ++ V
Sbjct: 13  ESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYV 72

Query: 60  AILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYF 119
             L   + V  LI  G+ GA+ + + V DV+IA                           
Sbjct: 73  NELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDS------NMNRLTFPGFDFAP 126

Query: 120 ESDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXX 179
            ++   + +  ++ ++   +   G + T D F   +  +      +  VLAVEME     
Sbjct: 127 AANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYG-VLAVEMETTALY 185

Query: 180 XXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEA 214
                  +  L +  +SD+     N   +  +  A
Sbjct: 186 TLAAKYGVNALSVLTVSDHIQTTFNEMIEIALDAA 220


>3c74A [x.x.x] URIDINE PHOSPHORYLASE
          Length = 242

 Score =  117 bits (294), Expect = 3e-29
 Identities = 38/235 (16%), Positives = 78/235 (33%), Gaps = 23/235 (9%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQE-QVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++       D     F               
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFP-------AV 128

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
           +D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 129 ADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 188

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVL 222
           V+  EME            L   ++  +  N   +  I     +      + ++L
Sbjct: 189 VMNYEMESATLLTMCASQGLRAGMVAGVIVNRT-QQEIPESHAVKIVVEAARRLL 242


>3c74E [x.x.x] URIDINE PHOSPHORYLASE
          Length = 241

 Score =  114 bits (285), Expect = 3e-28
 Identities = 40/231 (17%), Positives = 77/231 (33%), Gaps = 23/231 (9%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++       D     F               
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTT 135

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHF-------------PE 167
           +         E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 136 AL-------VEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 188

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNA-NHEANIFFDEFIIEAGRR 217
           V+  EME            L   ++  +  N    E      + ++EA RR
Sbjct: 189 VMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPSHAVKIVVEAARR 239


>3bgsA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 286

 Score =  111 bits (279), Expect = 2e-27
 Identities = 27/247 (10%), Positives = 64/247 (25%), Gaps = 22/247 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           G+   + +   +    + N     V G       G +     V+++             +
Sbjct: 37  GLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKV 96

Query: 62  -----LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQ----- 111
                +     VD L+ T +AG +     VGD+++                         
Sbjct: 97  TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG 156

Query: 112 MAQQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
                +    D+T   +   +  Q+ +      G                 +        
Sbjct: 157 DRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKL-GAD 215

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEAN----IFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++    +         +E +    +A ++  Q +
Sbjct: 216 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFV 275

Query: 223 LTFLKAL 229
              + ++
Sbjct: 276 SILMASI 282


>1a9oA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 289

 Score =  110 bits (276), Expect = 4e-27
 Identities = 26/247 (10%), Positives = 65/247 (26%), Gaps = 22/247 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVM-----SA 56
           G++  + +   +    + N  E  V G       G +     V+++              
Sbjct: 37  GLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKV 96

Query: 57  MSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYG-----Q 111
                +     V+ L+ T +AG +     VGD+++                         
Sbjct: 97  TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFG 156

Query: 112 MAQQPLYFESDKTFVAQIQESLSQ--LDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
           +    +    D+    +   +  Q    +    G                 +  +     
Sbjct: 157 VRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLG-AD 215

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNANH----EANIFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++        +     +E +    +A ++  Q +
Sbjct: 216 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFV 275

Query: 223 LTFLKAL 229
              + ++
Sbjct: 276 SLLMASI 282


>3e0qA [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
          Length = 280

 Score =  109 bits (274), Expect = 6e-27
 Identities = 22/245 (8%), Positives = 59/245 (24%), Gaps = 21/245 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGI-----GKVMSAMS 58
            +   + +++      + N  +          GT++  +VV+++            +   
Sbjct: 35  KLADGVKDKITIPYTKIPNFPQTSH-SGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVAL 93

Query: 59  VAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMA----- 113
              +     V  L+ + +AG +   + +GD VI     Y                     
Sbjct: 94  PIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTR 153

Query: 114 QQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVLAV 171
              L    D+       +   +       H G+                +  +      V
Sbjct: 154 FPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNM-GCDVV 212

Query: 172 EMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIF-------FDEFIIEAGRRSAQVLLT 224
            M             + V  +  +++ +  +                 +           
Sbjct: 213 GMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEK 272

Query: 225 FLKAL 229
            ++ L
Sbjct: 273 IIEKL 277


>1a9qA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 282

 Score =  109 bits (273), Expect = 8e-27
 Identities = 26/247 (10%), Positives = 66/247 (26%), Gaps = 22/247 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           G++  + +   +    + N  E  V G       G +     V+++             +
Sbjct: 37  GLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKV 96

Query: 62  -----LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQM---- 112
                +     V+ L+ T +AG +     VGD+++                         
Sbjct: 97  TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFG 156

Query: 113 -AQQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
                +    D+    +   +  Q+ +      G                 +  +     
Sbjct: 157 VRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNL-GAD 215

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNA----NHEANIFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++        +     +E +    +A ++  Q +
Sbjct: 216 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFV 275

Query: 223 LTFLKAL 229
              + ++
Sbjct: 276 SLLMASI 282


>2a0wA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 282

 Score =  108 bits (271), Expect = 1e-26
 Identities = 27/248 (10%), Positives = 63/248 (25%), Gaps = 22/248 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           G+   + +   +    + N     V G       G +     V+++             +
Sbjct: 35  GLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKV 94

Query: 62  -----LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGY-----AYGQ 111
                +     VD L+ T +AG +     VGD+++                         
Sbjct: 95  TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG 154

Query: 112 MAQQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
                +    D+T   +   +  Q+ +      G                 +        
Sbjct: 155 DRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLG-AD 213

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNA----NHEANIFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++              +E +    +A ++  Q +
Sbjct: 214 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANGEEVLAAGKQAAQKLEQFV 273

Query: 223 LTFLKALD 230
              + ++ 
Sbjct: 274 SILMASIP 281


>2a0xA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 282

 Score =  107 bits (268), Expect = 3e-26
 Identities = 28/248 (11%), Positives = 63/248 (25%), Gaps = 22/248 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           G+   + +   +    + N     V G       G +     V+++             +
Sbjct: 35  GLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKV 94

Query: 62  -----LADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQ----- 111
                +     VD L+ T +AG +     VGD+++                         
Sbjct: 95  TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG 154

Query: 112 MAQQPLYFESDKTFVAQIQESLSQLDQN--WHFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
                +    D+T   +   +  Q+ +      G                 +        
Sbjct: 155 DRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLG-AD 213

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNANH----EANIFFDEF---IIEAGRRSAQVL 222
           AV M             L V     +++             F+E      +A ++  Q +
Sbjct: 214 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANFEEVLAAGKQAAQKLEQFV 273

Query: 223 LTFLKALD 230
              + ++ 
Sbjct: 274 SILMASIP 281


>3ddoF [x.x.x] URIDINE PHOSPHORYLASE
          Length = 243

 Score =  107 bits (268), Expect = 4e-26
 Identities = 37/211 (17%), Positives = 75/211 (35%), Gaps = 22/211 (10%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 17  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 76

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++    A   +D  +  +A  +         
Sbjct: 77  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTT--ASVRLDGASLHFAPMEFPAVA---- 129

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
            D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 130 -DFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 188

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVIRAMSDN 198
           V+  EME            L   ++  +  N
Sbjct: 189 VMNYEMESATLLTMCASQGLRAGMVAGVIVN 219


>3ddoC [x.x.x] URIDINE PHOSPHORYLASE
          Length = 249

 Score =  106 bits (265), Expect = 9e-26
 Identities = 36/205 (17%), Positives = 73/205 (35%), Gaps = 22/205 (10%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQV-VLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA 60
           ++ I+   PE +  +   +D   +       T     +    V++  +GIG   ++++V 
Sbjct: 19  QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVE 78

Query: 61  ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
            LA    +   +  G+ GA+   I VGDV++    A   +D  +  +A  +         
Sbjct: 79  ELA-QLGIRTFLRIGTTGAIQPHINVGDVLVTT--ASVRLDGASLHFAPMEFPAVA---- 131

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE------------- 167
            D      + E+   +    H G+ A+ D+F  G ++ +                     
Sbjct: 132 -DFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMG 190

Query: 168 VLAVEMEGXXXXXXXXXLNLPVLVI 192
           V+  EME            L   ++
Sbjct: 191 VMNYEMESATLLTMCASQGLRAGMV 215


>1b8oA [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 280

 Score =  103 bits (258), Expect = 4e-25
 Identities = 26/247 (10%), Positives = 65/247 (26%), Gaps = 22/247 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
           G++  + +   +    + N  E  V G       G +     V+++             +
Sbjct: 35  GLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKV 94

Query: 62  LA-----DHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQM---- 112
                      V+ L+ T +AG +     VGD+++                         
Sbjct: 95  TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFG 154

Query: 113 -AQQPLYFESDKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
                +    D+    +   +  Q+ +      G                 +  +     
Sbjct: 155 VRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNL-GAD 213

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNA----NHEANIFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++        +     +E +    +A ++  Q +
Sbjct: 214 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFV 273

Query: 223 LTFLKAL 229
              + ++
Sbjct: 274 SLLMASI 280


>3djfB [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
          Length = 268

 Score =  103 bits (258), Expect = 5e-25
 Identities = 30/246 (12%), Positives = 70/246 (28%), Gaps = 26/246 (10%)

Query: 1   MKIGII------AAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLV------ 46
            +IGII        + +++      + N  +  V+G       GT++  +VV++      
Sbjct: 24  PEIGIICGSGLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHM 83

Query: 47  ESGIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFG 106
             G      A+ + ++     V  L+ + +AG +   + +GD VI     Y         
Sbjct: 84  YEGYSNDTVALPIRVM-KLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNI 142

Query: 107 YAYGQ-----MAQQPLYFESDKTFVAQIQESLSQLDQNWHFG---LIATGDSFVAGNDKI 158
                          L    D+       +   +            +  G        + 
Sbjct: 143 LVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAEC 202

Query: 159 EAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNAN-HEANIFFDEFIIEAGRR 217
             + +       V M             + V  +  +++ +     +    E +     +
Sbjct: 203 TMLLNMG--CDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESAQRAELMQSWFEK 260

Query: 218 SAQVLL 223
             + L 
Sbjct: 261 IIEKLP 266


>2a0yA [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 282

 Score =  103 bits (256), Expect = 7e-25
 Identities = 28/248 (11%), Positives = 65/248 (26%), Gaps = 22/248 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVM-----SA 56
           G+   + +   +    + N     V G       G +     V+++              
Sbjct: 35  GLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKV 94

Query: 57  MSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQP 116
                +     VD L+ T +AG +     VGD+++                      +  
Sbjct: 95  TFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG 154

Query: 117 LYFES-----DKTFVAQIQESLSQLDQN--WHFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
             F +     D+T   +   +  Q+ +      G                 +        
Sbjct: 155 DRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLG-AD 213

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEAN----IFFDEFI---IEAGRRSAQVL 222
           AV M             L V     +++    +         +E +    +A ++  Q +
Sbjct: 214 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANDEEVLAAGKQAAQKLEQFV 273

Query: 223 LTFLKALD 230
              + ++ 
Sbjct: 274 SILMASIP 281


>1b8nA [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 278

 Score = 96.8 bits (240), Expect = 5e-23
 Identities = 33/244 (13%), Positives = 71/244 (29%), Gaps = 20/244 (8%)

Query: 4   GIIAAMPEELAYLVQHLDNAQEQVVLG--NTYHTGTIASHEVVLVESGIGKVM-----SA 56
           G++  + +   +    + N  E  V G       G +     V+++              
Sbjct: 36  GLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKV 95

Query: 57  MSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQP 116
                +     V+ L+ T +AG +     VGD+++                      +  
Sbjct: 96  TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFG 155

Query: 117 LYFES-----DKTFVAQIQESLSQLDQNW--HFGLIATGDSFVAGNDKIEAIKSHFPEVL 169
           + F +     D+    +   +  Q+ +      G                 +  +     
Sbjct: 156 VRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNL-GAD 214

Query: 170 AVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEAN----IFFDEFIIEAGRRSAQVLLTF 225
           AV M             L V     +++    +         +E  +EAG+++AQ L  F
Sbjct: 215 AVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEV-LEAGKQAAQKLEQF 273

Query: 226 LKAL 229
           +  L
Sbjct: 274 VSLL 277


>2b94A [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
          Length = 242

 Score = 66.2 bits (160), Expect = 9e-14
 Identities = 28/228 (12%), Positives = 66/228 (28%), Gaps = 14/228 (6%)

Query: 2   KIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAI 61
            + ++   P  +  +    D+  +           T    + + V  G+G    A+    
Sbjct: 25  PVVLVVGDPGRVDKVKMLCDSYVDLA--EYKSVECTYKGQKFLCVSHGVGSAGCAICFEE 82

Query: 62  LADHFQVDALINTGSAGAVAE-GIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE 120
           L  +     +I  GS G++    +  GD+ I +     D       Y+          + 
Sbjct: 83  LM-NNGAKVIIRAGSCGSLQPTQMKRGDICICNAAVREDRVSHLMIYSDFPAVADFEVY- 140

Query: 121 SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPE-VLAVEMEGXXXX 179
                   + +   +L+     G+  + D +         ++ +    V  VEME     
Sbjct: 141 ------DTLNKVAQELEVPVFNGISLSSDLYYPHKIIPTRLEDYSKANVAVVEMEVATLM 194

Query: 180 XXXXXLNLPVLVIRAMSDNANHEANIF--FDEFIIEAGRRSAQVLLTF 225
                  +    I  +         +    +  I  +    A++   +
Sbjct: 195 VMGTLRKVKTGGIFIVDGCPLKWNLVPEKLENMIKISLETCARLAKKY 242


>3e9zC [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
          Length = 283

 Score = 50.3 bits (120), Expect = 5e-09
 Identities = 34/263 (12%), Positives = 90/263 (34%), Gaps = 45/263 (17%)

Query: 2   KIGII---------AAMPEELAYLVQHLDNAQEQVVLGNT--YHTGTIASHEVVLVES-- 48
           +IGII           + +++      + N  +  V+G++     GT++  +VV+++   
Sbjct: 25  EIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRF 84

Query: 49  ----GIGKVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLA-------- 96
               G      A+ + ++     V  L+ + +AG +   + +GD VI             
Sbjct: 85  HMYEGYSNDTVALPIRVMK-LLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLN 143

Query: 97  --YHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQN--WHFGLIA--TGDS 150
                 +  AFG  +  ++        D+       +   +       H G+     G  
Sbjct: 144 NILVGPNQEAFGTRFPALSN-----AYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPC 198

Query: 151 FVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSD----NANHEANIF 206
           +    +    + +       V M             + V  +  +++    +   +    
Sbjct: 199 YETPAE-CTMLLNM--GCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPN 255

Query: 207 FDEFIIEAGRRSAQVLLTFLKAL 229
            +E ++  G + A+++ ++ + +
Sbjct: 256 HEE-VLATGAQRAELMQSWFEKI 277


>1c3xA [c.56.2] PENTOSYLTRANSFERASE
          Length = 266

 Score = 40.5 bits (93), Expect = 5e-06
 Identities = 23/206 (11%), Positives = 47/206 (22%), Gaps = 18/206 (8%)

Query: 32  TYHTGTIASHEVVLVESGIGK-------VMSAMSVAILADHFQVDALINTGSAGAVAEGI 84
           +             +  G          V + +     A     + LI T   G + +  
Sbjct: 68  SIRVERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEW 127

Query: 85  AVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNWHFGL 144
             G  V+              G  +  +              +     L+          
Sbjct: 128 GAGTPVLLSDHINLTARSPLEGPTFVDLTDVY----------SPRLRELAHRVDPTLPEG 177

Query: 145 IATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEAN 204
           +             E   +       V M             L VL +  +++ A   + 
Sbjct: 178 VYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISP 237

Query: 205 IFFD-EFIIEAGRRSAQVLLTFLKAL 229
                  +IEAG+ +   +   L  +
Sbjct: 238 TPLSHAEVIEAGQAAGPRISALLADI 263


>3bjeA [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
          Length = 327

 Score = 37.3 bits (84), Expect = 5e-05
 Identities = 11/71 (15%), Positives = 22/71 (30%)

Query: 156 DKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEFIIEAG 215
                + +    V  +EME          L         +      E  +F  + +  A 
Sbjct: 254 SLKFNLSNGVEVVTNIEMETSAICYLSDMLGYQAGAACVVVSKRVGEKKMFLGDQLDAAM 313

Query: 216 RRSAQVLLTFL 226
           +R  +++L  L
Sbjct: 314 KRCIKIILEAL 324


>3bldA [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
          Length = 348

 Score = 35.9 bits (83), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 3/60 (5%)

Query: 18  QHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILAD--HFQVDALINTG 75
           + +      ++LGNTYH       E +    G+   M      IL D   FQV +    G
Sbjct: 47  ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDR-PILTDSGGFQVMSQSEEG 105


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.135    0.375 

Gapped
Lambda     K      H
   0.267   0.0379    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 17,899,796
Number of extensions: 1074101
Number of successful extensions: 12348
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5036
Number of HSP's successfully gapped: 359
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)