RPS-BLAST 2.2.16 [Mar-25-2007] Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002; 95pdb09Oct16_0003 66,450 sequences; 15,983,541 total letters Searching..................................................done Query= ACF56022.1 spne4 ACF56022.1 GIB00761CH01 "conserved hypothetical protein" (424 letters) Score E Sequences producing significant alignments: (bits) Value 3cwgA [x.x.x] SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTION 34 7e-04 >3cwgA [x.x.x] SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTION Length = 501 Score = 34.2 bits (77), Expect = 7e-04 Identities = 11/85 (12%), Positives = 33/85 (38%) Query: 49 QKAMNEQQTKLAQKDQEIAQLQSQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQ 108 ++ + + + ++ +Q++ +++ +FD + K + + AL + + + Sbjct: 10 EQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKMQQLEQMLTALDQMRRSIVSELAG 69 Query: 109 LATLRLEHENQLQKTLSDLEKERNQ 133 L + + L K R Q Sbjct: 70 LLSAMEYVQKTLTDEELADWKRRQQ 94 Database: 95pdb09Oct16_0000 Posted date: Oct 27, 2009 4:27 PM Number of letters in database: 15,983,541 Number of sequences in database: 66,450 Lambda K H 0.316 0.133 0.354 Gapped Lambda K H 0.267 0.0437 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 66450 Number of Hits to DB: 24,657,411 Number of extensions: 1535199 Number of successful extensions: 19592 Number of sequences better than 1.0e-03: 10 Number of HSP's gapped: 8672 Number of HSP's successfully gapped: 396 Length of database: 100,000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)