RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF56022.1 spne4 ACF56022.1 GIB00761CH01 "conserved
hypothetical protein"
         (424 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cwgA [x.x.x] SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTION         34   7e-04

>3cwgA [x.x.x] SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTION
          Length = 501

 Score = 34.2 bits (77), Expect = 7e-04
 Identities = 11/85 (12%), Positives = 33/85 (38%)

Query: 49  QKAMNEQQTKLAQKDQEIAQLQSQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQ 108
           ++ + + + ++   +Q++  +++   +FD   +  K +  +    AL    + + +    
Sbjct: 10  EQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKMQQLEQMLTALDQMRRSIVSELAG 69

Query: 109 LATLRLEHENQLQKTLSDLEKERNQ 133
           L +     +  L        K R Q
Sbjct: 70  LLSAMEYVQKTLTDEELADWKRRQQ 94


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.316    0.133    0.354 

Gapped
Lambda     K      H
   0.267   0.0437    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,657,411
Number of extensions: 1535199
Number of successful extensions: 19592
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8672
Number of HSP's successfully gapped: 396
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)