RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF56432.1 spne4 ACF56432.1 GIB00761CH01 "oligopeptide ABC
transporter, oligopeptide-bindi.."
         (652 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1b0hA [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN               188   4e-50
1dpeA [x.x.x] DIPEPTIDE-BINDING PROTEIN                               188   5e-50
3dp8C [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN                      187   7e-50
3dp8B [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN                      187   9e-50
1dppA [c.94.1] DIPEPTIDE BINDING PROTEIN                              185   3e-49
3dp8A [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN                      182   2e-48
1b52A [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)                179   2e-47
3e3kB [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN                      176   2e-46
3drgA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA                       171   6e-45
3drhA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA                       164   7e-43
3drjA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA                       164   7e-43
2d5wA [x.x.x] PEPTIDE ABC TRANSPORTER, PEPTIDE-BINDING PROTEIN        163   1e-42
3drfA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA                       162   4e-42
3c18A [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN                      75   4e-16
3c18B [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN                      74   1e-15
2d05A [x.x.x] CHITOSANASE                                              50   2e-08

>1b0hA [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
          Length = 517

 Score =  188 bits (478), Expect = 4e-50
 Identities = 110/560 (19%), Positives = 195/560 (34%), Gaps = 84/560 (15%)

Query: 23  SACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAE 82
              G      +T      S+  SL+         S++  +L +GLL +D  G+  P +AE
Sbjct: 3   VPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAE 62

Query: 83  DWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSE---ALYLVQD 139
            W  ++D   +T+ LR++AKW         PVTA DFV   Q  AD  +    A YL   
Sbjct: 63  KWE-NKDFKVWTFHLRENAKWSDGT-----PVTAHDFVYSWQRLADPNTASPYASYLQYG 116

Query: 140 SVAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSK 199
            +A +DD I GK    + +GVKALDD T + TL +P  Y+    +   + PV    ++  
Sbjct: 117 HIANIDDIIAGKK-PATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKF 175

Query: 200 GDDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQES 259
           GD +    P++I+ NG + +K  V    I  ++NP YWD     ++  ++TY   S + +
Sbjct: 176 GDKW--TQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVIN--QVTYLPISSEVT 231

Query: 260 LERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKT 319
               + +G             ++ +K++  N +       T Y++  N  +  +N     
Sbjct: 232 DVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFN----- 285

Query: 320 SDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKD 379
                        +   R A+  A DR              K+     +P    +     
Sbjct: 286 -------------DVRVRTALKLALDR---------DIIVNKVKNQGDLPAYSYTPPY-- 321

Query: 380 FGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTV 439
                                                              F      T 
Sbjct: 322 --------TDGAKLVEPE---WFKWSQQKRNEEAKKLLAEA---------GFTADKPLTF 361

Query: 440 EVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGG 499
           ++                     +  V ++++            F  T  Q  +D+   G
Sbjct: 362 DLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKT------FLDTRHQGTFDVARAG 415

Query: 500 WGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAK 559
           W  DY +P+++L+   ++S     +                   + +++ +  K  D  +
Sbjct: 416 WCADYNEPTSFLNTMLSDSSNNTAHYKSPA--------------FDKLIADTLKVADDTQ 461

Query: 560 RYEKYADIQAWLIDSSLVLP 579
           R E YA  +  L   S ++P
Sbjct: 462 RSELYAKAEQQLDKDSAIVP 481


>1dpeA [x.x.x] DIPEPTIDE-BINDING PROTEIN
          Length = 507

 Score =  188 bits (477), Expect = 5e-50
 Identities = 94/552 (17%), Positives = 165/552 (29%), Gaps = 83/552 (15%)

Query: 33  KTYNYVYSSDPSSLN-YLAENRAATSDIVANLVDGLLE-NDQYGNIIPSLAEDWTVSQDG 90
           KT  Y     P   N  L  +          L + L+E       +IP LAE W VS+DG
Sbjct: 1   KTLVYCSEGSPEGFNPQLFISGTTYDASSVPLYNRLVEFKIGTTEVIPGLAEKWEVSEDG 60

Query: 91  LTYTYKLRKDAKWF-TSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYIT 149
            TYT+ LRK  KW    E +    + A D V       + ++           G  +Y  
Sbjct: 61  KTYTFHLRKGVKWHDNKEFKPTRELNADDVVFSFDRQKNAQNPYHK----VSGGSYEYFE 116

Query: 150 GKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKAD-P 208
           G         VK +DD TVQ+ L +PE  + +         ++ ++  +           
Sbjct: 117 GMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMDFASILSKEYADAMMKAGTPEKLD 176

Query: 209 SSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGA 268
            + +  GPF ++     S I YK    YW  K        L +    D            
Sbjct: 177 LNPIGTGPFQLQQYQKDSRIRYKAFDGYWGTKPQI---DTLVFSITPDASVRYAKLQKNE 233

Query: 269 YTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQ 328
                 +PN +    + ++ K+  +  M      + ++N+ +K  +              
Sbjct: 234 CQVMP-YPNPADIARM-KQDKSINLMEMPGLNVGYLSYNVQKKPLD-------------- 277

Query: 329 EAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKM 388
               +   RQA+ +A ++ +             + +   V    +               
Sbjct: 278 ----DVKVRQALTYAVNKDAI---------IKAVYQGAGVSAKNLIPPTMWGYN------ 318

Query: 389 VNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQ 448
                        D QD  Y+P                 G++    +D       +    
Sbjct: 319 ------------DDVQDYTYDP-------EKAKALLKEAGLEKGFSIDLWAMPVQRPYNP 359

Query: 449 GVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPS 508
               + + I++      V   I      E+       + A   ++     GW  D  DP 
Sbjct: 360 NARRMAEMIQADWAKVGVQAKIVTYEWGEYL------KRAKDGEHQTVMMGWTGDNGDPD 413

Query: 509 TYLDIF-NTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADI 567
            +     +  +     N                   +  +++ A    D  KR E Y   
Sbjct: 414 NFFATEFSCAASEQGSNYS---KWCYKP--------FEDLIQPARATDDHNKRVELYKQA 462

Query: 568 QAWLIDSSLVLP 579
           Q  + D +  L 
Sbjct: 463 QVVMHDQAPALI 474


>3dp8C [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
          Length = 496

 Score =  187 bits (476), Expect = 7e-50
 Identities = 82/548 (14%), Positives = 148/548 (27%), Gaps = 88/548 (16%)

Query: 34  TYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQDGLTY 93
                +  +   LN             + + + L++    G++IP LA+ WT S+DG T+
Sbjct: 2   EITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKYQADGSVIPWLAKSWTHSEDGKTW 60

Query: 94  TYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYITGKTS 153
           T+ LR D K+  S GE   P  A+      +   D +    +        L + I     
Sbjct: 61  TFTLRDDVKF--SNGE---PFDAEAAAENFRAVLDNRQRHAW------LELANQIV---- 105

Query: 154 DFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSSILY 213
                 VKAL    +Q TL      +  +      F   A       +        + + 
Sbjct: 106 -----DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETM--NGIKAPIG 158

Query: 214 NGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTAR 273
            GP++++         + +N NYW  K       K+T+    D  +    F  G      
Sbjct: 159 TGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLLY 215

Query: 274 LFPNSSSYEGIKEKYKNN--IIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAV 331
                   +      +N        Q   +     N  +   N                 
Sbjct: 216 GNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTN----------------- 258

Query: 332 LNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNY 391
                R+A+N+A ++ S    +    G  ++   L  P    +  G    +    K    
Sbjct: 259 -ELAVREALNYAVNKKSLIDNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKAL 315

Query: 392 GKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQGVS 451
            ++      A       N                  G    I L           +    
Sbjct: 316 LEKAGWTLPAGKDIREKN------------------GQPLRIELSFIGTDALSKSMA--- 354

Query: 452 SIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPSTYL 511
              + I++ +      + +                      + +          DP  +L
Sbjct: 355 ---EIIQADMRQIGADVSLIGEEESS------IYARQRDGRFGMIFHRTWGAPYDPHAFL 405

Query: 512 DIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQAWL 571
                 S         +                 + + E     D  +R   Y DI   L
Sbjct: 406 SSMRVPSHA--DFQAQQGLADKPL--------IDKEIGEVLATHDETQRQALYRDILTRL 455

Query: 572 IDSSLVLP 579
            D ++ LP
Sbjct: 456 HDEAVYLP 463


>3dp8B [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
          Length = 497

 Score =  187 bits (475), Expect = 9e-50
 Identities = 76/549 (13%), Positives = 148/549 (26%), Gaps = 89/549 (16%)

Query: 33  KTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQDGLT 92
                 +  +   LN             + + + L++    G++IP LA+ WT S+DG T
Sbjct: 2   DEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKYQADGSVIPWLAKSWTHSEDGKT 60

Query: 93  YTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYITGKT 152
           +T+ LR D K+  S GE   P  A+      +   D +    +        L + I    
Sbjct: 61  WTFTLRDDVKF--SNGE---PFDAEAAAENFRAVLDNRQRHAW------LELANQIV--- 106

Query: 153 SDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSSIL 212
                  VKAL    +Q TL      +  +      F   A       +          +
Sbjct: 107 ------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA--PI 158

Query: 213 YNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTA 272
             GP++++         + +N NYW  K       K+T+    D  +    F  G     
Sbjct: 159 GTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLL 215

Query: 273 RLFPNSSSYEGIK--EKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEA 330
                    +      +         Q   +     N  +   N                
Sbjct: 216 YGNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTN---------------- 259

Query: 331 VLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVN 390
                 R+A+N+A ++ S    +         + + +  P+          +    K   
Sbjct: 260 --ELAVREALNYAVNKKSLIDNALYGTQ---QVADTLFAPSVPYANLGLKPQYDPQKAKA 314

Query: 391 YGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQGV 450
             ++      A                           ++        +E++        
Sbjct: 315 LLEKAGWTLPAGK------------------------DIREKNGQPLRIELSFIGTDALS 350

Query: 451 SSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPSTY 510
            S+ + I++ +      + +                      + +          DP  +
Sbjct: 351 KSMAEIIQADMRQIGADVSLIGEEESSIY------ARQRDGRFGMIFHRTWGAPYDPHAF 404

Query: 511 LDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQAW 570
           L      S            +           +  + + E     D  +R   Y DI   
Sbjct: 405 LSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQRQALYRDILTR 454

Query: 571 LIDSSLVLP 579
           L D ++ LP
Sbjct: 455 LHDEAVYLP 463


>1dppA [c.94.1] DIPEPTIDE BINDING PROTEIN
          Length = 507

 Score =  185 bits (471), Expect = 3e-49
 Identities = 91/551 (16%), Positives = 161/551 (29%), Gaps = 81/551 (14%)

Query: 33  KTYNYVYSSDPSSLN-YLAENRAATSDIVANLVDGLLE-NDQYGNIIPSLAEDWTVSQDG 90
           KT  Y     P   N  L  +          L + L+E       +IP LAE W VS+DG
Sbjct: 1   KTLVYCSEGSPEGFNPQLFTSGTTYDASSVPLYNRLVEFKIGTTEVIPGLAEKWEVSEDG 60

Query: 91  LTYTYKLRKDAKWF-TSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYIT 149
            TYT+ LRK  KW    E +    + A D V       + ++           G  +Y  
Sbjct: 61  KTYTFHLRKGVKWHDNKEFKPTRELNADDVVFSFDRQKNAQNPYHK----VSGGSYEYFE 116

Query: 150 GKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKAD-P 208
           G         VK +DD TVQ+ L +PE  + +         ++ ++  +           
Sbjct: 117 GMGLPELISEVKKVDDNTVQFVLTRPEAPFLADLAMDFASILSKEYADAMMKAGTPEKLD 176

Query: 209 SSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGA 268
            + +  GPF ++     S I YK    YW  K        L +    D            
Sbjct: 177 LNPIGTGPFQLQQYQKDSRIRYKAFDGYWGTKPQI---DTLVFSITPDASVRYAKLQKNE 233

Query: 269 YTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQ 328
                    +       ++ K+  +  M      + ++N+ +K  +              
Sbjct: 234 CQVMPYPNPADIAR--MKQDKSINLMEMPGLNVGYLSYNVQKKPLD-------------- 277

Query: 329 EAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKM 388
               +   RQA+ +A ++ +             + +   V    +               
Sbjct: 278 ----DVKVRQALTYAVNKDAI---------IKAVYQGAGVSAKNLIPPTMWGYN------ 318

Query: 389 VNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQ 448
                        D QD  Y+P                 G++    +D       +    
Sbjct: 319 ------------DDVQDYTYDP-------EKAKALLKEAGLEKGFSIDLWAMPVQRPYNP 359

Query: 449 GVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPS 508
               + + I++      V   I      E+       + A   ++     GW  D  DP 
Sbjct: 360 NARRMAEMIQADWAKVGVQAKIVTYEWGEYL------KRAKDGEHQTVMMGWTGDNGDPD 413

Query: 509 TYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQ 568
            +     + +     +                   +  +++ A    D  KR E Y   Q
Sbjct: 414 NFFATLFSCAASEQGS--NYSKWCYKP--------FEDLIQPARATDDHNKRVELYKQAQ 463

Query: 569 AWLIDSSLVLP 579
             + D +  L 
Sbjct: 464 VVMHDQAPALI 474


>3dp8A [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
          Length = 498

 Score =  182 bits (463), Expect = 2e-48
 Identities = 81/551 (14%), Positives = 147/551 (26%), Gaps = 88/551 (15%)

Query: 31  ASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQDG 90
           A       +  +   LN             + + + L++    G++IP LA+ WT S+DG
Sbjct: 1   APDEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKYQADGSVIPWLAKSWTHSEDG 59

Query: 91  LTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYITG 150
            T+T+ LR D K+   E     P  A+      +   D +    +        L + I  
Sbjct: 60  KTWTFTLRDDVKFSNGE-----PFDAEAAAENFRAVLDNRQRHAW------LELANQIV- 107

Query: 151 KTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS 210
                    VKAL    +Q TL      +  +      F   A       +         
Sbjct: 108 --------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA-- 157

Query: 211 ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYT 270
            +  GP++++         + +N NYW  K       K+T+    D  +    F  G   
Sbjct: 158 PIGTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDID 214

Query: 271 TARLFPNSSSYEGIKEKYKNN--IIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQ 328
                      +      +N        Q   +     N  +   N              
Sbjct: 215 LLYGNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTN-------------- 260

Query: 329 EAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKM 388
                   R+A+N+A ++ S    +    G  ++   L  P    +  G    +    K 
Sbjct: 261 ----ELAVREALNYAVNKKSLIDNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKA 314

Query: 389 VNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQ 448
               ++      A       N                  G    I L           + 
Sbjct: 315 KALLEKAGWTLPAGKDIREKN------------------GQPLRIELSFIGTDALSKSMA 356

Query: 449 GVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPS 508
                 + I++ +      + +                      + +          DP 
Sbjct: 357 ------EIIQADMRQIGADVSLIGEEESSIY------ARQRDGRFGMIFHRTWGAPYDPH 404

Query: 509 TYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQ 568
            +L      S            +           +  + + E     D  +R   Y DI 
Sbjct: 405 AFLSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQRQALYRDIL 454

Query: 569 AWLIDSSLVLP 579
             L D ++ LP
Sbjct: 455 TRLHDEAVYLP 465


>1b52A [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
          Length = 515

 Score =  179 bits (455), Expect = 2e-47
 Identities = 108/554 (19%), Positives = 197/554 (35%), Gaps = 84/554 (15%)

Query: 28  SSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVS 87
                +T      S+  SL+         S++  +L +GLL +D  G+  P +AE W  +
Sbjct: 8   QLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWE-N 66

Query: 88  QDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLD-- 145
           +D   +T+ LR++AKW         PVTA DFV   Q  AD  + + Y        +   
Sbjct: 67  KDFKVWTFHLRENAKWSDGT-----PVTAHDFVYSWQRLADPNTASPYASYLQYGHIANI 121

Query: 146 DYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGK 205
           D I       + +GVKALDD T + TL +P  Y+    +   + PV    ++  GD +  
Sbjct: 122 DDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW-- 179

Query: 206 ADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFT 265
             P++I+ NG + +K  V    I  ++NP YWD     ++  ++TY   S + +    + 
Sbjct: 180 TQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVIN--QVTYLPISSEVTDVNRYR 237

Query: 266 AGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKK 325
           +G             ++ +K++  N +       T Y++  N  +  +N           
Sbjct: 238 SGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFN----------- 285

Query: 326 STQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVA 385
                  +   R A+  A DR              K+     +P                
Sbjct: 286 -------DVRVRTALKLALDR---------DIIVNKVKNQGDLP---------------- 313

Query: 386 SKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKV 445
                Y       + A   +P +                   G   P+  D     +D  
Sbjct: 314 ----AYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTAPLTFDLLYNTSDLH 369

Query: 446 GIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQ 505
               ++           +  V ++++            F  T  Q  +D+   GW  DY 
Sbjct: 370 KKLAIAVASIW----KKNLGVNVNLENQEWKT------FLDTRHQGTFDVARAGWCADYN 419

Query: 506 DPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYA 565
           +P+++L+   ++S     +                   + +++ +  K  D  +R E YA
Sbjct: 420 EPTSFLNTMLSDSSNNTAHYKSPA--------------FDKLIADTLKVADDTQRSELYA 465

Query: 566 DIQAWLIDSSLVLP 579
             +  L   S ++P
Sbjct: 466 KAEQQLDKDSAIVP 479


>3e3kB [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
          Length = 500

 Score =  176 bits (446), Expect = 2e-46
 Identities = 80/549 (14%), Positives = 146/549 (26%), Gaps = 88/549 (16%)

Query: 33  KTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQDGLT 92
                 +  +   LN             + + + L++    G++IP LA+ WT S+DG T
Sbjct: 2   DEITTAWPVNVGPLNP-HLYTPNQMFAQSMVYEPLVKYQADGSVIPWLAKSWTHSEDGKT 60

Query: 93  YTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDSVAGLDDYITGKT 152
           +T+ LR D K+   E     P  A+      +   D +    +        L + I    
Sbjct: 61  WTFTLRDDVKFSNGE-----PFDAEAAAENFRAVLDNRQRHAW------LELANQIV--- 106

Query: 153 SDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSSIL 212
                  VKAL    +Q TL      +  +      F   A       +          +
Sbjct: 107 ------DVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA--PI 158

Query: 213 YNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTA 272
             GP++++         + +N NYW  K       K+T+    D  +    F  G     
Sbjct: 159 GTGPWILQESKLNQYDVFVRNENYWGEKPAI---KKITFNVIPDPTTRAVAFETGDIDLL 215

Query: 273 RLFPNSSSYEGIKEKYKNN--IIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEA 330
                    +      +N        Q   +     N  +   N                
Sbjct: 216 YGNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTN---------------- 259

Query: 331 VLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVN 390
                 R+A+N+A ++ S    +    G  ++   L  P    +  G    +    K   
Sbjct: 260 --ELAVREALNYAVNKKSLIDNALY--GTQQVADTLFAPSVPYANLGLKPSQYDPQKAKA 315

Query: 391 YGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQGV 450
             ++      A       N                  G    I L           +   
Sbjct: 316 LLEKAGWTLPAGKDIREKN------------------GQPLRIELSFIGTDALSKSMA-- 355

Query: 451 SSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPSTY 510
               + I++ +      + +                      + +          DP  +
Sbjct: 356 ----EIIQADMRQIGADVSLIGEEESS------IYARQRDGRFGMIFHRTWGAPYDPHAF 405

Query: 511 LDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQAW 570
           L      S            +           +  + + E     D  +R   Y DI   
Sbjct: 406 LSSMRVPSHA--------DFQAQQ--GLADKPLIDKEIGEVLATHDETQRQALYRDILTR 455

Query: 571 LIDSSLVLP 579
           L D ++ LP
Sbjct: 456 LHDEAVYLP 464


>3drgA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
          Length = 562

 Score =  171 bits (433), Expect = 6e-45
 Identities = 96/588 (16%), Positives = 165/588 (28%), Gaps = 73/588 (12%)

Query: 23  SACGNSSTASK--TYNYVYSSDPSSLNYL-----AENRAATSDIVANLVDGLLENDQYGN 75
            A  N   A K       Y SD             +   AT        DGL   D    
Sbjct: 9   VAYQNPDKAIKGGNLKVAYQSDSPMKAQWLSGLSNDATFATMSGPGGGQDGLFFTDSGFK 68

Query: 76  IIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKK--SEA 133
            I   A D  + ++  T T  LRKD KW  S+G     VTA+D+    +  A+    S+ 
Sbjct: 69  FIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPAYGSDR 123

Query: 134 LYLVQDSVAGLDDYITGKTSDFSTV-GVKALDDQTVQYTLVKPELYWNSKTLATILFPVN 192
                 ++ GL DY TGK    S +      + + ++    + +           L  V 
Sbjct: 124 WTDSLANIVGLSDYHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVA 183

Query: 193 ADFL----KSKGDDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVK 248
                     K         +  L  GPF  + +V+  +I+Y  NP YW  +   ++ + 
Sbjct: 184 PYQYLKDVAPKDLASSPKTTTKPLVTGPFKPENVVAGESIKYVPNPYYWG-EKPKLNSIT 242

Query: 249 LTYYDGSDQESLERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNL 308
                           ++  Y         SS     +  K   +   Q        +NL
Sbjct: 243 YEVV---STAKSVAALSSSKYDIINGMV--SSQYKQVKNLKGYKVLGQQAMYISLMYYNL 297

Query: 309 DRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVV 368
                  +     I  +  +  + ++N RQAI +A +           E   K    L  
Sbjct: 298 GHYDAKNS-----INVQDRKTPLQDQNVRQAIGYARNV---------AEVDNKFSNGLST 343

Query: 369 P-PNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXX 427
           P  + +    K F             +       +                         
Sbjct: 344 PANSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNK----------------ST 387

Query: 428 GVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQT 487
           G +     + ++    +VG     +I Q+         V + +      E      F   
Sbjct: 388 GYREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSW 441

Query: 488 AAQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQM 547
                       W       S   +    +            G  ND          T+ 
Sbjct: 442 VDHMTTPPGANDWDITDGSWSLASEPSQQDLFS--AAAPYNFGHFNDSE-------ITKD 492

Query: 548 LEE--ANKEQDPAKRYEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTV 593
           L +  + K ++P  R   +   Q  +   + V+P+        + + V
Sbjct: 493 LNDIDSAKSENPTYRKAAFVKYQEDMNKKAYVIPTNFMLNYTPVNKRV 540


>3drhA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
          Length = 559

 Score =  164 bits (415), Expect = 7e-43
 Identities = 91/573 (15%), Positives = 159/573 (27%), Gaps = 71/573 (12%)

Query: 23  SACGNSSTASK--TYNYVYSSDPSSLNYL-----AENRAATSDIVANLVDGLLENDQYGN 75
            A  N   A K       Y SD             +   AT        DGL   D    
Sbjct: 8   VAYQNPDKAIKGGNLKVAYQSDSPMKAQWLSGLSNDATFATMSGPGGGQDGLFFTDSGFK 67

Query: 76  IIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKK--SEA 133
            I   A D  + ++  T T  LRKD KW  S+G     VTA+D+    +  A+    S+ 
Sbjct: 68  FIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPAYGSDR 122

Query: 134 LYLVQDSVAGLDDYITGKTSDFSTV-GVKALDDQTVQYTLVKPELYWNSKTLATILFPVN 192
                 ++ GL DY TGK    S +      + + ++    + +           L  V 
Sbjct: 123 WTDSLANIVGLSDYHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVA 182

Query: 193 ADFLKSKG----DDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVK 248
                               +  L  GPF  + +V+  +I+Y  NP YW  K   ++ + 
Sbjct: 183 PYQYLKDVAPKDLASSPKTTTKPLVTGPFKPENVVAGESIKYVPNPYYWGEK-PKLNSIT 241

Query: 249 LTYYDGSDQESLERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNL 308
                           ++  Y         SS     +  K   +   Q        +N 
Sbjct: 242 YEVV---STAKSVAALSSSKYDII--NGMVSSQYKQVKNLKGYKVLGQQAMYISLMYYN- 295

Query: 309 DRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVV 368
                 +    + I  +  +  + ++N RQAI +A +           E   K    L  
Sbjct: 296 ----LGHYDAKNSINVQDRKTPLQDQNVRQAIGYARNV---------AEVDNKFSNGLST 342

Query: 369 PPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXG 428
           P               A+ ++    +    +   G +                      G
Sbjct: 343 P---------------ANSLIPPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNKSTG 387

Query: 429 VQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTA 488
            +     + ++    +VG     +I Q+         V + +      E      F    
Sbjct: 388 YREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWV 441

Query: 489 AQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQML 548
                      W       S   +    +                           T+ L
Sbjct: 442 DHMTTPPGANDWDITDGSWSLASEPSQQDL---------FSAAAPYNFGHFNDSEITKDL 492

Query: 549 EE--ANKEQDPAKRYEKYADIQAWLIDSSLVLP 579
            +  + K ++P  R   +   Q  +   + V+P
Sbjct: 493 NDIDSAKSENPTYRKAAFVKYQEDMNKKAYVIP 525


>3drjA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
          Length = 560

 Score =  164 bits (415), Expect = 7e-43
 Identities = 94/573 (16%), Positives = 160/573 (27%), Gaps = 71/573 (12%)

Query: 23  SACGNSSTASK--TYNYVYSSDPSSLNYLAENRAATSD-----IVANLVDGLLENDQYGN 75
            A  N   A K       Y SD           +  +            DGL   D    
Sbjct: 8   VAYQNPDKAIKGGNLKVAYQSDSPMKAQWLSGLSNDATFATMSGPGGGQDGLFFTDSGFK 67

Query: 76  IIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKK--SEA 133
            I   A D  + ++  T T  LRKD KW  S+G     VTA+D+    +  A+    S+ 
Sbjct: 68  FIKGGAADVALDKESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPAYGSDR 122

Query: 134 LYLVQDSVAGLDDYITGKTSDFSTV-GVKALDDQTVQYTLVKPELYWNSKTLATILFPVN 192
                 ++ GL DY TGK    S +      + + ++    + +           L  V 
Sbjct: 123 WTDSLANIVGLSDYHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVA 182

Query: 193 ADFLKSKG----DDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVK 248
                               +  L  GPF  + +V+  +I+Y  NP YW  K        
Sbjct: 183 PYQYLKDVAPKDLASSPKTTTKPLVTGPFKPENVVAGESIKYVPNPYYWGEKPKLNSITY 242

Query: 249 LTYYDGSDQESLERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNL 308
                     +L  +              SS Y+ +K   K   +   Q        +NL
Sbjct: 243 EVVSTAKSVAALSSSKYDIIN-----GMVSSQYKQVK-NLKGYKVLGQQAMYISLMYYNL 296

Query: 309 DRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVV 368
                  +     I  +  +  + ++N RQAI +A +      +            N ++
Sbjct: 297 GHYDAKNS-----INVQDRKTPLQDQNVRQAIGYARNVAEVDNKFSNGLS---TPANSLI 348

Query: 369 PPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXG 428
           PP F               +    K      +   +                       G
Sbjct: 349 PPIFKQFTSSSVKGYEKQDLDKANKLLDEDGWKLNKS---------------------TG 387

Query: 429 VQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTA 488
            +     + ++    +VG     +I Q+         V + +      E      F    
Sbjct: 388 YREKDGKELSLVYAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWV 441

Query: 489 AQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQML 548
                      W       S   +    +            G  ND          T+ L
Sbjct: 442 DHMTTPPGANDWDITDGSWSLASEPSQQDLFS--AAAPYNFGHFNDSE-------ITKDL 492

Query: 549 EE--ANKEQDPAKRYEKYADIQAWLIDSSLVLP 579
            +  + K ++P  R   +   Q  +   + V+P
Sbjct: 493 NDIDSAKSENPTYRKAAFVKYQEDMNKKAYVIP 525


>2d5wA [x.x.x] PEPTIDE ABC TRANSPORTER, PEPTIDE-BINDING PROTEIN
          Length = 602

 Score =  163 bits (413), Expect = 1e-42
 Identities = 78/585 (13%), Positives = 159/585 (27%), Gaps = 78/585 (13%)

Query: 31  ASKTYNYVYSSDPSSLN----YLAENRAATSDIVANLVDGLLENDQYGNIIPSLAEDW-- 84
              +     S +P  L      +  N+A  S+I   L    +  +      P LA +   
Sbjct: 4   QDNSLVIGASQEPRVLAGDFLRVISNQAIKSEIEQYLFAPFIGFNADSQNFPVLATEVPT 63

Query: 85  -----------TVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKS-- 131
                         +  L     +R DAKW  S+G    P+T +D     +    K    
Sbjct: 64  LENGRLRVTDIGGGKKRLEMDITIRPDAKW--SDGR---PITTEDVAFYFEVGKAKGMPV 118

Query: 132 -EALYLVQDSVAGLDDY----------ITGKTSDFSTVGVKALDDQTVQYTLVKPELYWN 180
               +  + +V   D                    +T   K +     +           
Sbjct: 119 LNPDFWERVNVRIKDARNFTLIFEPAYYYDTYGPINTYAPKHIMGPEWERVKAAARGLDP 178

Query: 181 SKTLATILFPVNADFLKSKGDDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAK 240
            K    +       FLK             ++Y+GPF +K  V  ++IE ++NPN+    
Sbjct: 179 DKDAEKLNELYRNFFLKFATPQALNRGA--MVYSGPFKLKRWVPGNSIEMERNPNFPIKP 236

Query: 241 NVF--VDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSS----SYEGIKEKYKNNIIY 294
                    K+ Y    +  SL      G+         +     S + ++       I+
Sbjct: 237 EGGESKYVQKVVYRFIQNTNSLLVAVIGGSIDATSSVSLTFDQGRSPQLVRRAPGRFDIW 296

Query: 295 SMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSE 354
            +  +     + N             +           +K  RQAI  A +R        
Sbjct: 297 FVPGAIWEHIDINKFENCQVVKDLGLN-----------DKRTRQAILHALNR-------- 337

Query: 355 GKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXX 414
            +         L    +                   +    +   F   +          
Sbjct: 338 -EGLVKAFFDGLQPVAHTWIAPV----------NPLFNPNVKKYEFDLKKAEALLAEMGW 386

Query: 415 XXXXXXXXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLT 474
                        G      ++      + V  +      + ++ +     + + I    
Sbjct: 387 RKGPDGILQRTVNGRTVRFEIEYVTTAGNVVRERTQQFFAEDLKKI----GIAVKINNAP 442

Query: 475 SDEFDSSGYFAQTAAQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXND 534
           S    +  +  + +  K   ++   W  + Q+  +     N N+G ++        +  +
Sbjct: 443 SAVVFADEFIQRASECKWTGMFEFAWVSNLQEDGSLFQYKNLNTGAIMVPTKENNYQGQN 502

Query: 535 KAKAVGLDVYTQMLEEANKEQDPAKRYEKYADIQAWLIDSSLVLP 579
                  D + ++  +A  E DP +R + +   Q    +    LP
Sbjct: 503 IGG-WRNDEFDRLTSQAVLEFDPERRKQLFWRAQEIWAEELPALP 546


>3drfA [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
          Length = 539

 Score =  162 bits (409), Expect = 4e-42
 Identities = 89/561 (15%), Positives = 153/561 (27%), Gaps = 71/561 (12%)

Query: 34  TYNYVYSSDPSSLNYL-----AENRAATSDIVANLVDGLLENDQYGNIIPSLAEDWTVSQ 88
                Y SD             +   AT        DGL   D     I   A D  + +
Sbjct: 3   NLKVAYQSDSPMKAQWLSGLSNDATFATMSGPGGGQDGLFFTDSGFKFIKGGAADVALDK 62

Query: 89  DGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKK--SEALYLVQDSVAGLDD 146
           +  T T  LRKD KW  S+G     VTA+D+    +  A+    S+       ++ GL D
Sbjct: 63  ESKTATITLRKDLKW--SDGS---EVTAKDYEFTYETIANPAYGSDRWTDSLANIVGLSD 117

Query: 147 YITGKTSDFSTV-GVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGK 205
           Y TGK    S +      + + ++    + +           L  V              
Sbjct: 118 YHTGKAKTISGITFPDGENGKVIKVQFKEMKPGMTQSGNGYFLETVAPYQYLKDVAPKDL 177

Query: 206 AD----PSSILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLE 261
           A      +  L  GPF  + +V+  +I+Y  NP YW  K                  +L 
Sbjct: 178 ASSPKTTTKPLVTGPFKPENVVAGESIKYVPNPYYWGEKPKLNSITYEVVSTAKSVAALS 237

Query: 262 RNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSD 321
            +              SS Y+ +K      ++       S  +       + N       
Sbjct: 238 SSKYDIING-----MVSSQYKQVKNLKGYKVLGQQAMYISLMYYNLGHYDAKNS------ 286

Query: 322 IEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGATKILRNLVVP-PNFVSIKGKDF 380
           I  +  +  + ++N RQAI +A +           E   K    L  P  + +    K F
Sbjct: 287 INVQDRKTPLQDQNVRQAIGYARNV---------AEVDNKFSNGLSTPANSLIPPIFKQF 337

Query: 381 GEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXXXXXXXXXGVQFPIHLDKTVE 440
                        +       +                         G +     + ++ 
Sbjct: 338 TSSSVKGYEKQDLDKANKLLDEDGWKLNK----------------STGYREKDGKELSLV 381

Query: 441 VTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQKDYDLYHGGW 500
              +VG     +I Q+         V + +      E      F               W
Sbjct: 382 YAARVGDANAETIAQNYIQQWKKIGVKVSLYNGKLME------FNSWVDHMTTPPGANDW 435

Query: 501 GPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEE--ANKEQDPA 558
                  S   +    +                           T+ L +  + K ++P 
Sbjct: 436 DITDGSWSLASEPSQQDL---------FSAAAPYNFGHFNDSEITKDLNDIDSAKSENPT 486

Query: 559 KRYEKYADIQAWLIDSSLVLP 579
            R   +   Q  +   + V+P
Sbjct: 487 YRKAAFVKYQEDMNKKAYVIP 507


>3c18A [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
          Length = 285

 Score = 75.4 bits (185), Expect = 4e-16
 Identities = 17/137 (12%), Positives = 33/137 (24%), Gaps = 8/137 (5%)

Query: 147 YITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKA 206
           Y     +   T G+ A++ +  + +L                        +         
Sbjct: 9   YSEYA-AYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLH 67

Query: 207 ------DPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAK-NVFVDDVKLTYYDGSDQES 259
                     ++ N        VS+  I +++N    D K  +                 
Sbjct: 68  LVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQSLSFAK 127

Query: 260 LERNFTAGAYTTARLFP 276
           L R F  G    +R   
Sbjct: 128 LLRRFQDGRNLFSRGNY 144


>3c18B [x.x.x] NUCLEOTIDYLTRANSFERASE-LIKE PROTEIN
          Length = 284

 Score = 74.2 bits (182), Expect = 1e-15
 Identities = 17/137 (12%), Positives = 33/137 (24%), Gaps = 8/137 (5%)

Query: 147 YITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKA 206
           Y     +   T G+ A++ +  + +L                        +         
Sbjct: 9   YSEYA-AYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLH 67

Query: 207 DPSS------ILYNGPFLMKALVSKSAIEYKKNPNYWDAK-NVFVDDVKLTYYDGSDQES 259
                     ++ N        VS+  I +++N    D K  +                 
Sbjct: 68  LVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQSLSFAK 127

Query: 260 LERNFTAGAYTTARLFP 276
           L R F  G    +R   
Sbjct: 128 LLRRFQDGRNLFSRGNY 144


>2d05A [x.x.x] CHITOSANASE
          Length = 259

 Score = 50.3 bits (119), Expect = 2e-08
 Identities = 11/78 (14%), Positives = 20/78 (25%), Gaps = 3/78 (3%)

Query: 71  DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEE-YAPVTAQDFVTGLQYAADK 129
                +   LA   + S +         K       +      P   ++ V       D 
Sbjct: 181 GGSDTLQGLLARSGSSSNEKTFMKNFHAKRTLV--VDTNPYNKPPNGKNRVKQWDTLVDM 238

Query: 130 KSEALYLVQDSVAGLDDY 147
               L  V   +A + D+
Sbjct: 239 GKMNLKNVDSEIAQVTDW 256


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.368 

Gapped
Lambda     K      H
   0.267   0.0510    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,984,538
Number of extensions: 1339330
Number of successful extensions: 14812
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5734
Number of HSP's successfully gapped: 444
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)