RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACF56614.1 spne4 ACF56614.1 GIB00761CH01 "LysM domain protein"
         (195 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2djpA [x.x.x] HYPOTHETICAL PROTEIN SB145                               58   2e-11
1e01A [d.7.1 (1e0gA)] MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLA...    52   2e-09

>2djpA [x.x.x] HYPOTHETICAL PROTEIN SB145
          Length = 77

 Score = 58.4 bits (141), Expect = 2e-11
 Identities = 11/54 (20%), Positives = 25/54 (46%)

Query: 24 PSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVI 77
                +    + ++ GDTL+ +A  +  T+E++   N +     I++ + L I
Sbjct: 7  GCSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI 60


>1e01A [d.7.1 (1e0gA)] MEMBRANE-BOUND LYTIC MUREIN
          TRANSGLYCOSYLASE D
          Length = 48

 Score = 51.6 bits (124), Expect = 2e-09
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 31 ESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVI 77
          +S TY V++GD+LS IA+ H   ++ +   N   +   +    +L +
Sbjct: 1  DSITYRVRKGDSLSSIAKRHGVNIKDVMRWNS--DTANLQPGDKLTL 45


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0423    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 17,254,878
Number of extensions: 966785
Number of successful extensions: 12430
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4973
Number of HSP's successfully gapped: 636
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)