RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF55178.1 spne4 ACF55178.1 GIB00761CH01 "serine/threonine
protein kinase"
         (543 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1nw1A [d.144.1.8] CHOLINE KINASE (49.2 KD)                             98   3e-23
2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216     93   7e-22
1mruA [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB        85   2e-19
1nd4A [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE                 80   7e-18
1v30A [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828                  64   3e-13
1tklA [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE                       63   1e-12
1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328                61   4e-12
1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363        53   1e-09
1k25A1 [d.11.1.1] LOW-AFFINITY PENICILLIN-BINDING PROTEIN 2X A:6...    52   2e-09
1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645             51   2e-09
2peiA1 [a.280.1.1] ORF134 A:3 -- 109                                   50   5e-09
1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294            50   8e-09
2ppqA1 [d.144.1.6] HOMOSERINE KINASE A:5 -- 320                        50   9e-09
1b6cB [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I                    50   9e-09
1t4hA [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1                 47   4e-08
1ia8A [d.144.1.7] CHK1 CHECKPOINT KINASE                               46   9e-08
1fo8A [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-          46   1e-07
1usuB [d.83.2.1] AHA1                                                  44   4e-07
1b49A [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)           44   5e-07
1gosA2 [d.16.1.5] MONOAMINE OXIDASE A:290 -- 401                       43   1e-06
1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79                42   1e-06
1b0pA4 [c.64.1.1] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE) A...    42   2e-06
1r4vA [a.22.1.4] HYPOTHETICAL PROTEIN AQ_328                           34   4e-04

>1nw1A [d.144.1.8] CHOLINE KINASE (49.2 KD)
          Length = 365

 Score = 97.8 bits (242), Expect = 3e-23
 Identities = 8/143 (5%), Positives = 22/143 (15%), Gaps = 3/143 (2%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSV 60
                            H DL+  NILL         ++      A              
Sbjct: 205 EFLRAHISLSKSPVTFCHNDLQEGNILLPKRLVLIDFEYASYNYRAFDFANHFIEWTIDY 264

Query: 61  HYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAEN 120
                   +        +   +      +       + +          +          
Sbjct: 265 DIDEAPFYKIQTENFPENDQMLEFFLNYLREQGNTRENELYKKSEDLVQETL---PFVPV 321

Query: 121 PSVPQALENVIIKATAKKLTNRY 143
                 +  ++    +       
Sbjct: 322 SHFFWGVWGLLQVELSPVGFGFA 344


>2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216
          Length = 124

 Score = 93.2 bits (231), Expect = 7e-22
 Identities = 10/103 (9%), Positives = 23/103 (22%), Gaps = 4/103 (3%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTA--KVTDFGIAVAFAETSLTQTNSMLG 58
                 A+       ++     P             +     +  A A  +    ++ L 
Sbjct: 8   HALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETXAVIVD-ACAAGTDGAFDAHLD 66

Query: 59  SVHYLSPEQARGSKATVQSDIYAMGI-IFYEMLTGHIPYDGDS 100
           +    +   A  S        ++    +    L G     G  
Sbjct: 67  THRQWADRPAPSSALHRALSFWSRLHGVLSLELAGQFTGXGFD 109


>1mruA [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
          Length = 269

 Score = 84.7 bits (208), Expect = 2e-19
 Identities = 59/153 (38%), Positives = 86/153 (56%), Gaps = 13/153 (8%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSV 60
           +     A+  +H  GI+HRD+KP NI+++     KV DFGIA A                
Sbjct: 117 IADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIT-------------A 163

Query: 61  HYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAEN 120
            YLSPEQARG     +SD+Y++G + YE+LTG  P+ GDS V++A QH ++      A +
Sbjct: 164 QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARH 223

Query: 121 PSVPQALENVIIKATAKKLTNRYRSVSEMYVDL 153
             +   L+ V++KA AK   NRY++ +EM  DL
Sbjct: 224 EGLSADLDAVVLKALAKNPENRYQTAAEMRADL 256


>1nd4A [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
          Length = 255

 Score = 79.8 bits (195), Expect = 7e-18
 Identities = 15/95 (15%), Positives = 24/95 (25%), Gaps = 6/95 (6%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSV 60
             ++   M       + H D    NI++     +   D G     A+       +     
Sbjct: 162 FARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLG-VADRYQDIALATRDIA 220

Query: 61  HYLSPEQARG-----SKATVQSDIYAMGIIFYEML 90
             L  E A         A   S   A   +  E  
Sbjct: 221 EELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF 255


>1v30A [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828
          Length = 118

 Score = 64.5 bits (156), Expect = 3e-13
 Identities = 8/82 (9%), Positives = 24/82 (29%), Gaps = 1/82 (1%)

Query: 34  AKVTDFGIAVAFAET-SLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTG 92
                  +         L +       +++     A   K  ++ ++Y +    +E +  
Sbjct: 9   TLRKGKPLHWYLKGAKFLGEDWIEGYQLYFEYLPYAVKGKGKLKVEVYEVDKETFERINE 68

Query: 93  HIPYDGDSAVTIALQHFQKPLP 114
                G   V ++ +  +  L 
Sbjct: 69  IEIGTGYRLVEVSTKFGKAFLW 90


>1tklA [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
          Length = 325

 Score = 62.6 bits (150), Expect = 1e-12
 Identities = 10/131 (7%), Positives = 21/131 (16%), Gaps = 2/131 (1%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSV 60
              I          GI   D   ++            D  +  ++      + +      
Sbjct: 193 YFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLP-SYLTIVKRRKDMPYTKE 251

Query: 61  HYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAEN 120
                   RG                       +     S    A   +         E 
Sbjct: 252 EQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAPGSREA 311

Query: 121 PSVPQALENVI 131
             + +      
Sbjct: 312 K-LLEVTTKPR 321


>1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328
          Length = 325

 Score = 60.7 bits (145), Expect = 4e-12
 Identities = 12/117 (10%), Positives = 19/117 (16%), Gaps = 7/117 (5%)

Query: 3   QILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHY 62
            +    R   T   +H D    NIL          D        +      N        
Sbjct: 181 AVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRM 240

Query: 63  LSPE-----QARGSKATVQSDIYAMGIIFYEMLTGHIPY--DGDSAVTIALQHFQKP 112
                    +      T +  +         +           D A           
Sbjct: 241 QLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWLTGE 297


>1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363
          Length = 355

 Score = 52.7 bits (124), Expect = 1e-09
 Identities = 16/155 (10%), Positives = 38/155 (24%), Gaps = 13/155 (8%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQN-ILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGS 59
           +   +   +     G  H+DL   + I    +G   V  +            +   +   
Sbjct: 158 LNLAMAVTKYKQRNGWSHKDLLRLSHIKPANEGLTMVAKYVSKGWKEVQEAYKEKELSPE 217

Query: 60  V----HYLSPEQ--ARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTI------ALQ 107
                 YL   +   R         +     +  E L        +   ++         
Sbjct: 218 TEKVLKYLEATERVKRTKDELEIIHLIDEYRLVREHLLTIHLKSKEIWKSLLQDMPLTAL 277

Query: 108 HFQKPLPSVIAENPSVPQALENVIIKATAKKLTNR 142
                  +  +        + +V  + T +KL  +
Sbjct: 278 LRNLGKMTADSVLAPASSEVSSVCERLTNEKLLKK 312


>1k25A1 [d.11.1.1] LOW-AFFINITY PENICILLIN-BINDING PROTEIN 2X A:632
           -- 692
          Length = 61

 Score = 52.1 bits (125), Expect = 2e-09
 Identities = 10/67 (14%), Positives = 22/67 (32%), Gaps = 7/67 (10%)

Query: 250 TPATIAIPDVAGQTVAEAKATLKKANFEIGXXXXXXXXXXXXGRIIRTDPGAGTGRKEGT 309
           T ++ A+P +   +  E    L++   +               +I  T    GT      
Sbjct: 1   TESSYAMPSIKDISPGELAEALRRNIVQPI-------VVGTGTKIKETSVEEGTNLAPNQ 53

Query: 310 KINLVVS 316
           ++ L+  
Sbjct: 54  QVLLLSD 60


>1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645
          Length = 156

 Score = 51.5 bits (122), Expect = 2e-09
 Identities = 13/95 (13%), Positives = 29/95 (30%), Gaps = 6/95 (6%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNIL--LTPDGTAKVTDFGIA-VAFAETSLTQTNSML 57
            G  +  +   H    +H  L+  N++  L      ++ D   + +      +       
Sbjct: 63  AGHEVTIVSGVHLANYMHFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDG 122

Query: 58  GSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTG 92
               Y  P  +     T    I    ++   ++TG
Sbjct: 123 SKRTYRGPGVSPRDANTSHRWIEFDSLV---LVTG 154


>2peiA1 [a.280.1.1] ORF134 A:3 -- 109
          Length = 107

 Score = 50.3 bits (120), Expect = 5e-09
 Identities = 5/56 (8%), Positives = 18/56 (32%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSM 56
              I  +        + +++L  + + +  +    V +F      ++   +  N  
Sbjct: 45  RHPIQESDLYLEAXXLENKELVLRILTVRENLAEGVLEFLPEXVLSQIKQSNGNHR 100


>1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294
          Length = 209

 Score = 49.8 bits (117), Expect = 8e-09
 Identities = 8/64 (12%), Positives = 14/64 (21%), Gaps = 2/64 (3%)

Query: 12 HTRGIVHRDLKPQNILLTPDGTAKVTDFGI--AVAFAETSLTQTNSMLGSVHYLSPEQAR 69
            R  + RD     +L        +                       G   Y+S  +  
Sbjct: 4  PLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIP 63

Query: 70 GSKA 73
           + A
Sbjct: 64 WNAA 67


>2ppqA1 [d.144.1.6] HOMOSERINE KINASE A:5 -- 320
          Length = 310

 Score = 49.6 bits (116), Expect = 9e-09
 Identities = 6/89 (6%), Positives = 16/89 (17%), Gaps = 25/89 (28%)

Query: 61  HYLSPEQARGSKATVQSDIYA---------------------MGIIFYEMLTGHIPYDGD 99
            +        +K     + Y                      +      +        G 
Sbjct: 222 CFEKDGAYNVTKGKALLEGYQSVRPLSEAELEALPLLSRGSALRFFLTRLYDWLTTPAGA 281

Query: 100 SAVTIALQHFQKPLPSVIAENPSVPQALE 128
             V      + + L      + ++    E
Sbjct: 282 LVVKKDPLEYLRKL----RFHRTIANVAE 306


>1b6cB [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I
          Length = 326

 Score = 49.5 bits (116), Expect = 9e-09
 Identities = 24/109 (22%), Positives = 42/109 (38%), Gaps = 9/109 (8%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQT------- 53
               +  +       I HRDLK +NIL+  +GT  + D G+AV     + T         
Sbjct: 140 AHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRV 199

Query: 54  --NSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDS 100
                +           +  ++  ++DIYAMG++F+E+           
Sbjct: 200 GTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHE 248


>1t4hA [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1
          Length = 270

 Score = 47.4 bits (111), Expect = 4e-08
 Identities = 31/151 (20%), Positives = 53/151 (35%), Gaps = 7/151 (4%)

Query: 1   MGQILLAMRLAHTRG--IVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLG 58
             QIL  ++  HTR   I+HRDLK  NI +T    +              S  +      
Sbjct: 118 CRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIG-- 175

Query: 59  SVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIA 118
           +  + +PE           D+YA G    E  T   PY          +     +     
Sbjct: 176 TPEFXAPEXYEEKY-DESVDVYAFGXCXLEXATSEYPYSECQNAAQIYRRVTSGVKPASF 234

Query: 119 ENPSVPQALENVIIKATAKKLTNRYRSVSEM 149
           +  ++P+  + +I     +    RY S+ ++
Sbjct: 235 DKVAIPEV-KEIIEGCIRQNKDERY-SIKDL 263


>1ia8A [d.144.1.7] CHK1 CHECKPOINT KINASE
          Length = 272

 Score = 46.2 bits (108), Expect = 9e-08
 Identities = 34/135 (25%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTN-SMLGS 59
             Q++  +   H  GI HRD+KP+N+LL      K++DFG+A  F   +  +    M G+
Sbjct: 107 FHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGT 166

Query: 60  VHYLSPEQARGSKATVQS-DIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIA 118
           + Y++PE  +  +   +  D+++ GI+   ML G +P+D  S        +++   + + 
Sbjct: 167 LPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEK-KTYLN 225

Query: 119 ENPSVPQALENVIIK 133
               +  A   ++ K
Sbjct: 226 PWKKIDSAPLALLHK 240


>1fo8A [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-
          Length = 330

 Score = 45.8 bits (108), Expect = 1e-07
 Identities = 9/103 (8%), Positives = 29/103 (28%), Gaps = 8/103 (7%)

Query: 3   QILLAMRLAHTRGIVHRDLKPQNILLTPDG-TAKVTDFGIAVAFAE----TSLTQTNSML 57
               A+       + +  ++P +         A+   + +   F       ++   + + 
Sbjct: 52  SYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDL- 110

Query: 58  GSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDS 100
             V     E  + +   +++D     +  +    G       S
Sbjct: 111 -EVAPDFFEYFQATYPLLKADPSLWCVSAWNDN-GKEQMVDSS 151


>1usuB [d.83.2.1] AHA1
          Length = 132

 Score = 44.2 bits (103), Expect = 4e-07
 Identities = 10/94 (10%), Positives = 23/94 (24%), Gaps = 11/94 (11%)

Query: 17  VHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARGSKATVQ 76
           V +     N +       K    G+        +   +S+ G          +  K    
Sbjct: 1   VDK-----NCIGWAKEYFKQKIVGVEAKK-YAKIKSVSSIEGDCEV-----NQRGKVISL 49

Query: 77  SDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQ 110
            D+    +I   + +        +   +A     
Sbjct: 50  FDLKITVLIEGHVDSALPFEGSINVPEVAFDSEA 83


>1b49A [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
          Length = 241

 Score = 43.7 bits (102), Expect = 5e-07
 Identities = 6/110 (5%), Positives = 24/110 (21%), Gaps = 13/110 (11%)

Query: 1   MGQILLAMRLAHTRGIVHRDLKPQNILL-TPDGTAKVTDFGIAVAFAETS----LTQTNS 55
            G+I      A      +         L     + +        +         ++    
Sbjct: 89  KGEINSNYGWAIWSEDNYAQYDMCLAELGQNPDSRRGIMIYTRPSMQFDYNKDGMSDFMC 148

Query: 56  MLGSVHYLSPEQARGSKAT--------VQSDIYAMGIIFYEMLTGHIPYD 97
                + +  ++                ++D      +  ++++     D
Sbjct: 149 TNTVQYLIRDKKINAVVNMRSNDVVFGFRNDYAWQKYVLDKLVSDLNAGD 198


>1gosA2 [d.16.1.5] MONOAMINE OXIDASE A:290 -- 401
          Length = 112

 Score = 42.8 bits (99), Expect = 1e-06
 Identities = 8/107 (7%), Positives = 21/107 (19%), Gaps = 5/107 (4%)

Query: 39  FGIAVAFA---ETSLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIP 95
            G  +      +    +     G++     E                  I   +L     
Sbjct: 2   LGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKAR 61

Query: 96  YDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLTNR 142
                     L+   +    V+           +   K   ++  + 
Sbjct: 62  KLARLTKEERLKKLCELYAKVLGSL--EALEPVHYEEKNWCEEQYSG 106


>1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79
          Length = 79

 Score = 42.3 bits (99), Expect = 1e-06
 Identities = 2/28 (7%), Positives = 7/28 (25%)

Query: 1  MGQILLAMRLAHTRGIVHRDLKPQNILL 28
            Q+   +            +K   ++ 
Sbjct: 52 FTQLSEEVERLKELINALNKIKKGLLVF 79


>1b0pA4 [c.64.1.1] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
           A:416 -- 668
          Length = 253

 Score = 41.9 bits (97), Expect = 2e-06
 Identities = 12/145 (8%), Positives = 35/145 (24%), Gaps = 6/145 (4%)

Query: 1   MGQILLAMR-LAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGS 59
               +            +   +K     +     + + D    +       T  N  L  
Sbjct: 68  RADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKR-TIANKKLKF 126

Query: 60  VHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIA--LQHFQKPLPSVI 117
            +  + + A       + ++      F   L G +P++    +      + + K    ++
Sbjct: 127 YNIDAVKIATDVGLGGRINMIMQTAFFK--LAGVLPFEKAVDLLKKSIHKAYGKKGEKIV 184

Query: 118 AENPSVPQALENVIIKATAKKLTNR 142
             N          + +         
Sbjct: 185 KMNTDAVDQAVTSLQEFKYPDSWKD 209


>1r4vA [a.22.1.4] HYPOTHETICAL PROTEIN AQ_328
          Length = 151

 Score = 34.0 bits (78), Expect = 4e-04
 Identities = 6/36 (16%), Positives = 11/36 (30%), Gaps = 2/36 (5%)

Query: 6   LAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGI 41
           L +  A        + KP       +  A++ D   
Sbjct: 118 LLLXHADVIKKATGERKPSR--EAXEFVAQIVDKVF 151


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0586    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,031,573
Number of extensions: 824061
Number of successful extensions: 3061
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 2955
Number of HSP's successfully gapped: 141
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)