RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF55344.1 spne4 atpA GIB00761CH01 "ATP synthase F0, A chain"
         (238 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1c17M [f.18.1.1] ATP SYNTHASE SUBUNIT A                               100   1e-24

>1c17M [f.18.1.1] ATP SYNTHASE SUBUNIT A
          Length = 142

 Score =  100 bits (252), Expect = 1e-24
 Identities = 32/156 (20%), Positives = 61/156 (39%), Gaps = 19/156 (12%)

Query: 74  KDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIES 133
           K  +   L +F+++ + N + L+              P          +  V+    +  
Sbjct: 5   KLIAPLALTIFVWVFLMNLMDLLP---------IDLLPYIAEHVLGLPALRVVPSADVNV 55

Query: 134 VRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAI 193
                    I           + +    +  +SL LR+FGN++AGE++  L+  L     
Sbjct: 56  TLSMALGVFILILF-----YSIKMKSLLSKPVSLGLRLFGNMYAGELIFILIAGLL---- 106

Query: 194 YWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYL 229
             +   +  N+ W  F + I  +QA++F +LT VYL
Sbjct: 107 -PWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYL 141


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.317    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0622    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 10,406,074
Number of extensions: 737188
Number of successful extensions: 3048
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 2975
Number of HSP's successfully gapped: 72
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.7 bits)