RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF55614.1 spne4 radC GIB00761CH01 "DNA repair protein RadC"
         (226 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 ...    33   5e-04

>2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
           134
          Length = 98

 Score = 32.5 bits (74), Expect = 5e-04
 Identities = 8/79 (10%), Positives = 28/79 (35%), Gaps = 5/79 (6%)

Query: 41  QASVFEIAQKVLNNLSSLTDLKKMTLQELQSLSGIGRVKAIELQAMIELGHRIHKHETLE 100
           +  V  + +K+        DL    +       G+    A   + +++        + L 
Sbjct: 1   EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLA---KLIVKNAPYESVEDVLN 57

Query: 101 MESILSSQKLAKKMQQELG 119
           +  +  +++  + +++ L 
Sbjct: 58  IPGL--TERQKQILRENLE 74


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.321    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0585    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,077,268
Number of extensions: 844492
Number of successful extensions: 3941
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3747
Number of HSP's successfully gapped: 164
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)