RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF55996.1 spne4 ACF55996.1 GIB00761CH01 "primosomal protein
N'"
         (798 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --...   164   1e-43
1gm5A3 [c.37.1.19] RECG A:286 -- 549                                  149   3e-39
1cevA [c.42.1.1] PROTEIN (ARGINASE)                                   145   7e-38
1dzfA1 [c.52.3.1] DNA-DIRECTED RNA POLYMERASES I, II, AND III 27...   140   1e-36
2gnrA1 [b.40.4.15] CONSERVED HYPOTHETICAL PROTEIN A:8 -- 144          137   2e-35
2nwuA1 [d.77.1.2] UPF0201 PROTEIN SSO1042 A:3 -- 144                   97   2e-23
2conA1 [g.41.15.1] NIN ONE BINDING PROTEIN A:8 -- 73                   84   2e-19
2eyqA5 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:779 --...    68   9e-15
1nltA3 [g.54.1.1] MITOCHONDRIAL PROTEIN IMPORT PROTEIN MAS5 A:13...    62   1e-12
1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325                  59   5e-12
2dktA1 [g.89.1.1] RING FINGER AND CHY ZINC FINGER DOMAIN- A:8 -- 81    56   4e-11
1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250                           55   1e-10
2p6rA4 [c.37.1.19] AFUHEL308 HELICASE A:203 -- 403                     55   1e-10
1c7sA1 [b.1.18.2] BETA-N-ACETYLHEXOSAMINIDASE A:781 -- 885             55   1e-10
1i3qL [g.41.9.2] DNA-DIRECTED RNA POLYMERASE II 7.7KD POLYPEPTIDE      54   2e-10
1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:18...    54   2e-10
1rifA [c.37.1.23] DNA HELICASE UVSW                                    54   2e-10
2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256                53   5e-10
2hf1A1 [b.171.1.1] TETRAACYLDISACCHARIDE-1-P 4-KINASE A:2 -- 60        51   1e-09
1exkA [g.54.1.1] DNAJ PROTEIN                                          51   1e-09
1a6yA [g.39.1.2] ORPHAN NUCLEAR RECEPTOR NR1D1                         51   1e-09
2p6rA3 [c.37.1.19] AFUHEL308 HELICASE A:1 -- 202                       50   2e-09
1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:...    50   3e-09
1imlA2 [g.39.1.3] CYSTEINE RICH INTESTINAL PROTEIN A:29 -- 76          50   3e-09
1fp0A1 [g.50.1.2] KAP-1 COREPRESSOR A:19 -- 88                         46   6e-08
2bhrA2 [c.37.1.14] RNA HELICASE A:178 -- 482                           44   1e-07
2fwrA1 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:257 -- 456               44   2e-07
1pjrA1 [c.37.1.19] PCRA A:1 -- 318                                     44   2e-07
1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 ...    43   5e-07
1rybA [c.56.3.1] CRS2                                                  43   5e-07
1d4cA1 [a.138.1.3] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:1 -- 102     42   7e-07
1w36B1 [c.37.1.19] EXODEOXYRIBONUCLEASE V BETA CHAIN B:1 -- 485        41   2e-06
2yrbA1 [b.7.1.1] PROTEIN FANTOM A:596 -- 737                           38   1e-05
1hh5A [a.138.1.1] CYTOCHROME C7                                        37   3e-05
1wp9A2 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:201 --...    36   4e-05
1oftA [c.37.1.22] HYPOTHETICAL PROTEIN PA3008                          36   7e-05
2jneA1 [g.41.18.1] HYPOTHETICAL PROTEIN YFGJ A:1 -- 71                 35   1e-04
1oywA2 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:1 -- 206               35   1e-04
1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:...    34   3e-04
1gm5A4 [c.37.1.19] RECG A:550 -- 755                                   33   3e-04
1m2vB5 [g.41.10.1] PROTEIN TRANSPORT PROTEIN SEC24 B:216 -- 300        33   5e-04
1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360       32   9e-04
1t5iA [c.37.1.19] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT        32   0.001

>2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --
           778
          Length = 233

 Score =  164 bits (416), Expect = 1e-43
 Identities = 50/188 (26%), Positives = 84/188 (44%), Gaps = 16/188 (8%)

Query: 255 EASRPLELNPEQRQARDAVVSSIGSSQP-PFLLQGITGSGKTEVYLQIIQGALDKGKTAI 313
             S P E  P+Q QA +AV+S +        L+ G  G GKTEV ++    A+D  K   
Sbjct: 49  CDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVA 108

Query: 314 LLVPEISLTPQMTERFIARFGD---KVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSA 370
           +LVP   L  Q  + F  RF +   ++ ++    S  E+     +V  G   +++G    
Sbjct: 109 VLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKL 168

Query: 371 IFA--PLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESR 428
           + +    K+LG++I+DEEH          R+  R    ++A      ++  +ATP   + 
Sbjct: 169 LQSDVKFKDLGLLIVDEEH----------RFGVRHKERIKAMRANVDILTLTATPIPRTL 218

Query: 429 ARAGKGVY 436
             A  G+ 
Sbjct: 219 NMAMSGMR 226



 Score = 33.7 bits (77), Expect = 2e-04
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGT-QMIAKGLDFP 617
            Q+ YD   + F    +    +   R       +L +   G+ DIL+GT +++   + F 
Sbjct: 117 AQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFK 176

Query: 618 NVTLVGVLNAD 628
           ++ L+ V    
Sbjct: 177 DLGLLIVDEEH 187


>1gm5A3 [c.37.1.19] RECG A:286 -- 549
          Length = 259

 Score =  149 bits (378), Expect = 3e-39
 Identities = 63/229 (27%), Positives = 90/229 (39%), Gaps = 29/229 (12%)

Query: 230 FFVDQGAVTIVQKEVRRSAAYFEGIE--------ASRPLELNPEQRQARDAVVSSIGSSQ 281
            FV Q A   ++KE  +     + IE         S P +L   Q++A   + + + S +
Sbjct: 44  LFVLQLAFQKIRKEREKHGGIPKKIEGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEK 103

Query: 282 P-PFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGD---KV 337
           P   LLQG  GSGKT V    I    + G     +VP   L  Q   R +  F      V
Sbjct: 104 PMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFNIHV 163

Query: 338 AILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPL--KNLGVMIIDEEHEAAYKQDS 395
           A+L    +  EK      +  G   VV+G  + I   +  KNLG++IIDE+H      + 
Sbjct: 164 ALLIGATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHRFEALMNK 223

Query: 396 NPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQR 444
                              TLV+ SATP   S A A  G      + + 
Sbjct: 224 GKMVD--------------TLVM-SATPIPRSMALAFYGDLDVTVIDEM 257


>1cevA [c.42.1.1] PROTEIN (ARGINASE)
          Length = 299

 Score =  145 bits (366), Expect = 7e-38
 Identities = 29/221 (13%), Positives = 65/221 (29%), Gaps = 12/221 (5%)

Query: 271 DAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFI 330
           D   +  G    P     +  +G  E   ++     D G   I     +        R +
Sbjct: 12  DLGQTRRGVDMGP---SAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNL 68

Query: 331 ARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAA 390
               +    L + +    +   +  V  GD  + +G  + +    + LGV+  D   +  
Sbjct: 69  KAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVN 128

Query: 391 YKQDSNPRY-HAREVAILRAQYNQATLVLGSATPSLESRARAGKGVYQHLRLTQRANPLA 449
             + S     H   +A      + A   +G  +P ++       GV       ++     
Sbjct: 129 TAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKF---I 185

Query: 450 TIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV 490
               +++    +             ++E     L ++   V
Sbjct: 186 REKGIKIYTMHE-----VDRLGMTRVMEETIAYLKERTDGV 221


>1dzfA1 [c.52.3.1] DNA-DIRECTED RNA POLYMERASES I, II, AND III 27
           A:5 -- 143
          Length = 139

 Score =  140 bits (355), Expect = 1e-36
 Identities = 11/138 (7%), Positives = 32/138 (23%), Gaps = 14/138 (10%)

Query: 485 KKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLT---------LHMDTKTMNCHYCG 535
           ++    L    R  +   M ++ G   T    ++ L          +    + M      
Sbjct: 2   ERNISRLWRAFR--TVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQAN 59

Query: 536 FSKDIPQVCPNCKSRSIRYYGTGTQ--KAYDELAELFPQARILRMDVDTTRKKGSH-QAL 592
            +++     P+  S  + +    +   K          +                    L
Sbjct: 60  PTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKL 119

Query: 593 LDQFGRGEADILLGTQMI 610
           +        +      ++
Sbjct: 120 VPSIPPATIETFNEAALV 137


>2gnrA1 [b.40.4.15] CONSERVED HYPOTHETICAL PROTEIN A:8 -- 144
          Length = 137

 Score =  137 bits (345), Expect = 2e-35
 Identities = 12/137 (8%), Positives = 27/137 (19%), Gaps = 10/137 (7%)

Query: 495 RRGY--SSFVMCRECGTVDTCPNCDISLTLHMDTKT---MNCHYCGFSKDIPQ-VCPNCK 548
           + G     + +        T           +         C  CG      +  C +C 
Sbjct: 1   KEGSLLRWYDVXEAERYEYTVGPAGEQFFNGLKQNKIIGSKCSKCGRIFVPARSYCEHCF 60

Query: 549 SRSIRYY--GTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQF-GRGEADILL 605
            +   Y                        ++             +        E ++ +
Sbjct: 61  VKIENYVEINKDEAYVDSYTIIYNDDEGN-KLAQPVYIALIRFPNIEGGLLCYAEGNVKV 119

Query: 606 GTQMIAKGLDFPNVTLV 622
           G +       +P    V
Sbjct: 120 GAKAKILSFQWPLRVKV 136


>2nwuA1 [d.77.1.2] UPF0201 PROTEIN SSO1042 A:3 -- 144
          Length = 130

 Score = 96.9 bits (241), Expect = 2e-23
 Identities = 13/130 (10%), Positives = 35/130 (26%), Gaps = 18/130 (13%)

Query: 550 RSIRYYGTGTQKAYDELAELFPQAR----ILRMDVDTTRKKGSHQALLDQFGRGEADILL 605
            +         K    ++  F   +    I+ + V   R   S             + +L
Sbjct: 5   VAEVRPSEDVNKVLSAISNFFDFEKXNTGIIDILVLEARTLKSLLKFHRV---LRNERIL 61

Query: 606 GTQMIAKGLDFPNVTLVGVLNADTA-LNLPDFRSSERT------FQLLTQVAGRAGRAEK 658
            +            T+   ++   A + +  F + +         +++  +A +      
Sbjct: 62  DSARKYLXKGIEGNTIAFXIHKQAAAVGVLSFVAIKFYIEYQNPKEIVDWLAPKTAH--- 118

Query: 659 AGQVLIQSYN 668
            G  L  +  
Sbjct: 119 -GVPLWDNPV 127


>2conA1 [g.41.15.1] NIN ONE BINDING PROTEIN A:8 -- 73
          Length = 66

 Score = 84.2 bits (208), Expect = 2e-19
 Identities = 7/64 (10%), Positives = 18/64 (28%), Gaps = 4/64 (6%)

Query: 523 HMDTKTMNCHYCGF--SKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARI--LRM 578
              +  + CH C    S      C +C +++++                    ++   R 
Sbjct: 3   EARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNPRG 62

Query: 579 DVDT 582
              +
Sbjct: 63  LRYS 66


>2eyqA5 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:779 --
           989
          Length = 211

 Score = 68.4 bits (167), Expect = 9e-15
 Identities = 26/112 (23%), Positives = 47/112 (41%), Gaps = 13/112 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
            QKA + LAEL P+ARI         ++   + +++ F     ++L+ T +I  G+D P 
Sbjct: 44  IQKAAERLAELVPEARIAIGHGQMRERE--LERVMNDFHHQRFNVLVCTTIIETGIDIPT 101

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQ 670
              + +  AD                 L Q+ GR GR+       + + + +
Sbjct: 102 ANTIIIERAD-----------HFGLAQLHQLRGRVGRSHHQAYAWLLTPHPK 142


>1nltA3 [g.54.1.1] MITOCHONDRIAL PROTEIN IMPORT PROTEIN MAS5 A:139
           -- 212
          Length = 74

 Score = 61.6 bits (149), Expect = 1e-12
 Identities = 10/64 (15%), Positives = 16/64 (25%), Gaps = 9/64 (14%)

Query: 500 SFVMCRECGT--VDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGT 557
           +   C  C    +         +     T+   CH  G   D    C +C        G 
Sbjct: 17  AVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCN-------GK 69

Query: 558 GTQK 561
             + 
Sbjct: 70  KVEN 73


>1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
          Length = 136

 Score = 59.2 bits (142), Expect = 5e-12
 Identities = 21/139 (15%), Positives = 34/139 (24%), Gaps = 14/139 (10%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGL 344
            L   TGSGK+            +G   ++L P ++ T           G     + +G+
Sbjct: 12  HLHAPTGSGKSTKVPAAY---AAQGYKVLVLNPSVAATLGFGAYMSKAHGVDP-NIRTGV 67

Query: 345 SNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREV 404
                         G      G     +  +        D                   V
Sbjct: 68  RTITTGSPITYSTYGKFLADGGXSGGAYDIIICDECHSTDATSILGIGT----------V 117

Query: 405 AILRAQYNQATLVLGSATP 423
                      +VL +ATP
Sbjct: 118 LDQAETAGARLVVLATATP 136


>2dktA1 [g.89.1.1] RING FINGER AND CHY ZINC FINGER DOMAIN- A:8 -- 81
          Length = 74

 Score = 56.4 bits (135), Expect = 4e-11
 Identities = 11/61 (18%), Positives = 19/61 (31%), Gaps = 6/61 (9%)

Query: 494 NRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKT----MNCHYCGFSKDIPQVCPNCKS 549
             R     +    C  + TC  C  +   H   +     + C  C   +   Q C +C +
Sbjct: 15  YDRACL--LKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDCST 72

Query: 550 R 550
            
Sbjct: 73  L 73


>1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250
          Length = 237

 Score = 54.9 bits (131), Expect = 1e-10
 Identities = 32/209 (15%), Positives = 61/209 (29%), Gaps = 30/209 (14%)

Query: 228 VNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQ 287
           +  F +      + KE      + + +      E    Q+     ++         F   
Sbjct: 21  LCLFPEDF----LLKEFV--EFFRKCVG-----EPRAIQKMWAKRILRK-----ESFAAT 64

Query: 288 GITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTE---RFIARFGDKVAILHSGL 344
             TG GKT   L +      KGK   ++ P   L  Q  E   ++  + G     L    
Sbjct: 65  APTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIGYY 124

Query: 345 SNGEKYDEWRKVER--GDAQVVVGARSAIFAPLKNLG------VMIIDEEHEAAYKQDSN 396
                  E     +   + ++V+     +    + LG      V  +D   +A+   D  
Sbjct: 125 HGRIPKREKENFMQNLRNFKIVITTTQFLSKHYRELGHFDFIFVDDVDAILKASKNVDKL 184

Query: 397 PRYHARE---VAILRAQYNQATLVLGSAT 422
                              +  L++ +AT
Sbjct: 185 LHLLGFHYDLKTKSWVGEARGCLMVSTAT 213


>2p6rA4 [c.37.1.19] AFUHEL308 HELICASE A:203 -- 403
          Length = 201

 Score = 54.7 bits (130), Expect = 1e-10
 Identities = 28/202 (13%), Positives = 59/202 (29%), Gaps = 11/202 (5%)

Query: 474 PLLEAIQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHY 533
           PL+E +      +         R      +  EC   +       S       +      
Sbjct: 3   PLVEGVLCEGTLELFDGAFSTSRRVKFEELVEECVAENGGVLVFES-----TRRGAEKTA 57

Query: 534 CGFSKDIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALL 593
              S    +   N              +   +LAE   +             +   + + 
Sbjct: 58  VKLSAITAKYVENEGLEKAILE-ENEGEMSRKLAE-CVRKGAAFHHAGLLNGQ--RRVVE 113

Query: 594 DQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRA 653
           D F RG   +++ T  +A G++ P   ++         +    R     ++ +   AGR 
Sbjct: 114 DAFRRGNIKVVVATPTLAAGVNLPARRVIVRSLYR--FDGYSKRIKVSEYKQMAGRAGRP 171

Query: 654 GRAEKAGQVLIQSYNSQHYAIR 675
           G  E+   ++I     +  A++
Sbjct: 172 GMDERGEAIIIVGKRDREIAVK 193


>1c7sA1 [b.1.18.2] BETA-N-ACETYLHEXOSAMINIDASE A:781 -- 885
          Length = 105

 Score = 54.7 bits (131), Expect = 1e-10
 Identities = 7/106 (6%), Positives = 19/106 (17%), Gaps = 15/106 (14%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
                    +    A IL         K         +        +    +   +  P 
Sbjct: 5   FVDTQALEKDWLRFANILGQRELAKLDK-----GGVAYRLPVPGARVAGGKLEANIALPG 59

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQL---------LTQVAGRAGR 655
           + +    +            ++                +   RA +
Sbjct: 60  LGIEYSTDGGKQ-WQRYDAKAKPAVSGEVQVRSVSPDGKRYSRAEK 104


>1i3qL [g.41.9.2] DNA-DIRECTED RNA POLYMERASE II 7.7KD POLYPEPTIDE
          Length = 46

 Score = 54.3 bits (130), Expect = 2e-10
 Identities = 9/45 (20%), Positives = 12/45 (26%), Gaps = 1/45 (2%)

Query: 509 TVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIR 553
               C  C   L+L   T  + C  CG    +            R
Sbjct: 3   LKYICAECSSKLSLS-RTDAVRCKDCGHRILLKARTKRLVQFEAR 46


>1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
           -- 324
          Length = 140

 Score = 54.2 bits (129), Expect = 2e-10
 Identities = 28/139 (20%), Positives = 47/139 (33%), Gaps = 10/139 (7%)

Query: 285 LLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGL 344
           +L    G+GKT  +L  I     + +        + L P        +       +    
Sbjct: 11  VLDFHPGAGKTRRFLPQILAECARRRL-----RTLVLAPTRVVLSEMKEAFHGLDVKFHT 65

Query: 345 SNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREV 404
                +   R+V        +  R      + N  V+I+DE H             AR  
Sbjct: 66  QAFSAHGSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFL-----DPASIAARGW 120

Query: 405 AILRAQYNQATLVLGSATP 423
           A  RA+ N++  +L +ATP
Sbjct: 121 AAHRARANESATILMTATP 139


>1rifA [c.37.1.23] DNA HELICASE UVSW
          Length = 282

 Score = 54.0 bits (128), Expect = 2e-10
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 15/184 (8%)

Query: 242 KEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQI 301
           K+     +  E    ++ +E +  Q+ A    +          +L   T +G++ +   +
Sbjct: 94  KDFDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLV-----NRRRILNLPTSAGRSLIQALL 148

Query: 302 IQGALDKGKTAI-LLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGD 360
            +  L+  +  I ++VP  +LT QM + F+       A++        K D+++      
Sbjct: 149 ARYYLENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKNDAPVV 208

Query: 361 AQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS 420
                             G+M+ DE H A  K  S         +I+    N       S
Sbjct: 209 VGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSIS---------SIISGLNNCMFKFGLS 259

Query: 421 ATPS 424
            +  
Sbjct: 260 GSLR 263


>2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256
          Length = 234

 Score = 52.6 bits (125), Expect = 5e-10
 Identities = 33/180 (18%), Positives = 57/180 (31%), Gaps = 27/180 (15%)

Query: 244 VRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQ 303
           V  +A           + L   Q +A +  +           +   TGSGKT V +  I 
Sbjct: 54  VDNAADPIPTPYFDAEISLRDYQEKALERWLV-----DKRGCIVLPTGSGKTHVAMAAIN 108

Query: 304 GALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQV 363
              +     +++VP ++L  Q  ER    FG++     SG          ++++      
Sbjct: 109 ---ELSTPTLIVVPTLALAEQWKERL-GIFGEEYVGEFSG--------RIKELKPLTVST 156

Query: 364 VVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATP 423
              A            ++I DE H    +             I +       L L +AT 
Sbjct: 157 YDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQ---------IAQMSIAPFRLGL-TATF 206


>2hf1A1 [b.171.1.1] TETRAACYLDISACCHARIDE-1-P 4-KINASE A:2 -- 60
          Length = 59

 Score = 51.5 bits (123), Expect = 1e-09
 Identities = 6/38 (15%), Positives = 10/38 (26%)

Query: 505 RECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQ 542
            +   +  CP C   L        + C     +  I  
Sbjct: 2   AKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKD 39


>1exkA [g.54.1.1] DNAJ PROTEIN
          Length = 79

 Score = 51.3 bits (122), Expect = 1e-09
 Identities = 9/68 (13%), Positives = 13/68 (19%), Gaps = 13/68 (19%)

Query: 498 YSSFVMCREC-------GTVDTCPNC-----DISLTLHMDTKTMNCHYCGFS-KDIPQVC 544
             +   C  C       GT             + +          C +C      I   C
Sbjct: 8   IPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPC 67

Query: 545 PNCKSRSI 552
             C     
Sbjct: 68  NKCHGHGR 75


>1a6yA [g.39.1.2] ORPHAN NUCLEAR RECEPTOR NR1D1
          Length = 78

 Score = 51.2 bits (121), Expect = 1e-09
 Identities = 10/73 (13%), Positives = 17/73 (23%), Gaps = 13/73 (17%)

Query: 502 VMCRECG--------TVDTCPNCDISLTLHMDTKTMN-----CHYCGFSKDIPQVCPNCK 548
           ++C+ CG         V  C  C       +              C   +     C  C+
Sbjct: 1   LLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCR 60

Query: 549 SRSIRYYGTGTQK 561
            +     G     
Sbjct: 61  FKKCLSVGMSRDA 73


>2p6rA3 [c.37.1.19] AFUHEL308 HELICASE A:1 -- 202
          Length = 199

 Score = 50.5 bits (119), Expect = 2e-09
 Identities = 31/166 (18%), Positives = 58/166 (34%), Gaps = 9/166 (5%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           EL P Q +A + V      S    LL   T +GKT +    +     KG  ++ +VP  +
Sbjct: 22  ELFPPQAEAVEKV-----FSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRA 76

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYD--EWRKVERGDAQVVVGARSAIFAPLKNL 378
           L  +  E F       + I  S      + +      +    ++          + +K +
Sbjct: 77  LAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAV 136

Query: 379 GVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGSATPS 424
             +++DE H    ++          V  +R       ++  SAT  
Sbjct: 137 SCLVVDEIHLLDSEKRGATLEIL--VTKMRRMNKALRVIGLSATAP 180


>1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:-
           -- - D:- -- -
          Length = 623

 Score = 50.2 bits (118), Expect = 3e-09
 Identities = 19/99 (19%), Positives = 31/99 (31%), Gaps = 14/99 (14%)

Query: 252 EGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYL----QIIQGALD 307
             +       LN EQ++A    V +      P L+    GSGKT V       ++     
Sbjct: 2   NFLSEQLLAHLNKEQQEA----VRTTEG---PLLIMAGAGSGKTRVLTHRIAYLMAEKHV 54

Query: 308 KGKTAILLVPEISLTPQMTERFIARF---GDKVAILHSG 343
                + +        +M ER  +      + V I    
Sbjct: 55  APWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFH 93


>1imlA2 [g.39.1.3] CYSTEINE RICH INTESTINAL PROTEIN A:29 -- 76
          Length = 48

 Score = 49.9 bits (119), Expect = 3e-09
 Identities = 5/40 (12%), Positives = 9/40 (22%), Gaps = 3/40 (7%)

Query: 513 CPNCDISL---TLHMDTKTMNCHYCGFSKDIPQVCPNCKS 549
           C  C  +L             C++  +S            
Sbjct: 2   CEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGG 41


>1fp0A1 [g.50.1.2] KAP-1 COREPRESSOR A:19 -- 88
          Length = 70

 Score = 45.7 bits (107), Expect = 6e-08
 Identities = 8/50 (16%), Positives = 17/50 (34%), Gaps = 1/50 (2%)

Query: 502 VMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRS 551
           VMC +C           +L      +  +C  C    D+ +   + ++  
Sbjct: 20  VMCNQCEFCFHLDCHLPALQDVPG-EEWSCSLCHVLPDLKEEDVDLQACK 68


>2bhrA2 [c.37.1.14] RNA HELICASE A:178 -- 482
          Length = 295

 Score = 44.5 bits (105), Expect = 1e-07
 Identities = 29/140 (20%), Positives = 51/140 (36%), Gaps = 22/140 (15%)

Query: 285 LLQGITGSGKTEVYL-QIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSG 343
           ++    G+GKT+ YL  I++ A+ +G   ++L P   +  +M E      G  +      
Sbjct: 13  IMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALR---GLPIRYQREI 69

Query: 344 LSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHARE 403
           +                A      R      + N  ++I+DE H      D      AR 
Sbjct: 70  VD-----------LMCHA--TFTMRLLSPIRVPNYNLIIMDEAHFT----DPA-SIAARG 111

Query: 404 VAILRAQYNQATLVLGSATP 423
               R +  +A  +  +ATP
Sbjct: 112 YISTRVEMGEAAGIFMTATP 131


>2fwrA1 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:257 -- 456
          Length = 200

 Score = 44.0 bits (102), Expect = 2e-07
 Identities = 21/196 (10%), Positives = 63/196 (32%), Gaps = 19/196 (9%)

Query: 479 IQDRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSK 538
            + R    +Q +         +    +             +L    + + +  +     +
Sbjct: 23  YEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARRIAFNSKNKIR 82

Query: 539 DIPQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGR 598
            + ++    +   I  +    +  Y           I  +   T+R++   + +L+ F  
Sbjct: 83  KLREILERHRKDKIIIFTRHNELVYRISKVF----LIPAITHRTSREE--REEILEGFRT 136

Query: 599 GEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEK 658
           G    ++ +Q++ +G+D P+  +  +++               + +   Q  GR  R  K
Sbjct: 137 GRFRAIVSSQVLDEGIDVPDANVGVIMSGS------------GSAREYIQRLGRILRPSK 184

Query: 659 AGQ-VLIQSYNSQHYA 673
             +  ++    S+   
Sbjct: 185 GKKEAVLYELISRGTG 200


>1pjrA1 [c.37.1.19] PCRA A:1 -- 318
          Length = 315

 Score = 43.9 bits (102), Expect = 2e-07
 Identities = 17/99 (17%), Positives = 29/99 (29%), Gaps = 14/99 (14%)

Query: 252 EGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVY----LQIIQGALD 307
             +       LN EQ++A       +       L+    GSGKT V       ++     
Sbjct: 2   NFLSEQLLAHLNKEQQEAVRTTEGPL-------LIMAGAGSGKTRVLTHRIAYLMAEKHV 54

Query: 308 KGKTAILLVPEISLTPQMTERFIARF---GDKVAILHSG 343
                + +        +M ER  +      + V I    
Sbjct: 55  APWNILAITFTNKAAREMRERVQSLLGGAAEDVWISTFH 93


>1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 --
           395
          Length = 273

 Score = 42.8 bits (100), Expect = 5e-07
 Identities = 27/167 (16%), Positives = 48/167 (28%), Gaps = 16/167 (9%)

Query: 258 RPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVP 317
           R   + P + Q    V    G+     + +  TG GKT      +      GK   ++  
Sbjct: 75  RVTGMFPFKVQLMGGVALHDGN-----IAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTV 129

Query: 318 EISLTPQMTE---RFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVG-------- 366
              L  +  E   +     G  V +  + +S  EK + +           +G        
Sbjct: 130 NEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGFDYLRDNM 189

Query: 367 ARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQ 413
                    + L   +IDE       +   P   + +   L     Q
Sbjct: 190 VLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQSMTLATITFQ 236


>1rybA [c.56.3.1] CRS2
          Length = 186

 Score = 42.6 bits (99), Expect = 5e-07
 Identities = 15/127 (11%), Positives = 33/127 (25%), Gaps = 5/127 (3%)

Query: 502 VMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQK 561
           ++ +    ++        L  +      +         +P      + +       G Q 
Sbjct: 59  LVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQN 118

Query: 562 AYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTL 621
             + L       R+         K      LL +F   E   +     + +G+D      
Sbjct: 119 VIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQI--DTALEQGVDAVRTL- 175

Query: 622 VGVLNAD 628
             VL  +
Sbjct: 176 --VLKGE 180


>1d4cA1 [a.138.1.3] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:1 -- 102
          Length = 102

 Score = 42.2 bits (98), Expect = 7e-07
 Identities = 10/70 (14%), Positives = 16/70 (22%), Gaps = 4/70 (5%)

Query: 496 RGYSSFVMCRECGTVDT--CPNCDISLTLHMDTKTMNCHYCGFS-KDIPQVCPNCKSRS- 551
                 V C           P   +S         + C  C    +     C  C S   
Sbjct: 33  HENGQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACTSCHKGHEKSVAYCDACHSFGF 92

Query: 552 IRYYGTGTQK 561
              +G   ++
Sbjct: 93  DMPFGGKWER 102


>1w36B1 [c.37.1.19] EXODEOXYRIBONUCLEASE V BETA CHAIN B:1 -- 485
          Length = 469

 Score = 41.0 bits (94), Expect = 2e-06
 Identities = 16/106 (15%), Positives = 35/106 (33%), Gaps = 18/106 (16%)

Query: 262 LNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEV----YLQIIQG-----ALDKGKTA 312
              E        +          L++   G+GKT      YL+++ G     A  +  T 
Sbjct: 3   DVAETLDPLRLPLQG------ERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTV 56

Query: 313 --ILLV-PEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRK 355
             +L+V    + T ++  R  +   +         ++   Y+   +
Sbjct: 57  EELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLE 102


>2yrbA1 [b.7.1.1] PROTEIN FANTOM A:596 -- 737
          Length = 142

 Score = 38.0 bits (88), Expect = 1e-05
 Identities = 6/47 (12%), Positives = 11/47 (23%)

Query: 257 SRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQ 303
           S   E     +     ++   G       L G  G       ++   
Sbjct: 92  STEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWF 138


>1hh5A [a.138.1.1] CYTOCHROME C7
          Length = 68

 Score = 36.6 bits (84), Expect = 3e-05
 Identities = 9/68 (13%), Positives = 13/68 (19%), Gaps = 16/68 (23%)

Query: 499 SSFVMCRECG-----------TVDTCPNCDISLTLHMDTKTM-----NCHYCGFSKDIPQ 542
           +  V                     C  C       +           C  C  S + P 
Sbjct: 1   ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPT 60

Query: 543 VCPNCKSR 550
            C  C  +
Sbjct: 61  KCGGCHIK 68


>1wp9A2 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:201 --
           486
          Length = 279

 Score = 36.2 bits (82), Expect = 4e-05
 Identities = 30/174 (17%), Positives = 59/174 (33%), Gaps = 12/174 (6%)

Query: 503 MCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQKA 562
             +E  +          L    +    +       + I +     ++  I  +    + A
Sbjct: 115 ASKEIFSDKRMKKAISLLVQAKEIGLDHPKMDKLKEIIREQLQRKQNSKIIVFTNYRETA 174

Query: 563 YDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLV 622
              + EL       +  V    K+   + +LD+F RGE ++L+ T +  +GLD P V LV
Sbjct: 175 KKIVNELVKDGIKAKRFVGQASKQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLV 234

Query: 623 GVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRF 676
                              +     Q  GR GR      +++ +  ++  A  +
Sbjct: 235 VFYEPV------------PSAIRSIQRRGRTGRHMPGRVIILMAKGTRDEAYYW 276


>1oftA [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
          Length = 119

 Score = 35.5 bits (81), Expect = 7e-05
 Identities = 15/113 (13%), Positives = 31/113 (27%), Gaps = 13/113 (11%)

Query: 285 LLQGITGSGKTEVYLQIIQ--GALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHS 342
           L           +   I++        +   L+ P  SLT +   R      +++ +L +
Sbjct: 7   LSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEW-LRRAGLNRERILLLQA 65

Query: 343 GLSNGEKYDEWRKVERGDAQVVVGARSAI----------FAPLKNLGVMIIDE 385
             +          +  G +  VV     +           A L     + I  
Sbjct: 66  KDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRL 118


>2jneA1 [g.41.18.1] HYPOTHETICAL PROTEIN YFGJ A:1 -- 71
          Length = 71

 Score = 34.8 bits (79), Expect = 1e-04
 Identities = 11/49 (22%), Positives = 15/49 (30%), Gaps = 2/49 (4%)

Query: 512 TCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ 560
            CP C   L          C  CG   ++  +CP+C          G  
Sbjct: 4   HCPQCQHVLDQD--NGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAV 50


>1oywA2 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:1 -- 206
          Length = 206

 Score = 34.6 bits (79), Expect = 1e-04
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 26/199 (13%)

Query: 261 ELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEIS 320
           +  P Q +  D V+S  G      L+   TG GK+  Y   I   L  G T + + P IS
Sbjct: 25  QFRPGQEEIIDTVLS--GRD---CLVVXPTGGGKSLCYQ--IPALLLNGLTVV-VSPLIS 76

Query: 321 LTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGA-----RSAIFAPL 375
           L     ++  A  G   A L+S  +  ++ +       G  +++  A            L
Sbjct: 77  LXKDQVDQLQAN-GVAAACLNSTQTREQQLEVXTGCRTGQIRLLYIAPERLXLDNFLEHL 135

Query: 376 KNLGV--MIIDEEHEAA-YKQDSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAG 432
            +     + +DE H  + +  D  P Y    +  LR ++   TL   + T + +   R  
Sbjct: 136 AHWNPVLLAVDEAHCISQWGHDFRPEY--AALGQLRQRF--PTLPFXALTATADDTTR-- 189

Query: 433 KGVYQHLRLTQRANPLATI 451
           + + + L L    +PL  I
Sbjct: 190 QDIVRLLGLN---DPLIQI 205


>1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
           -- 409
          Length = 330

 Score = 33.7 bits (75), Expect = 3e-04
 Identities = 29/323 (8%), Positives = 65/323 (20%), Gaps = 30/323 (9%)

Query: 315 LVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAP 374
            +  +    +  ERF+   G          + G                     +     
Sbjct: 16  AIAGLVEALRDGERFVTLLG----------ATGTGKTVTMAKVIEALGRPALVLAPNKIL 65

Query: 375 LKNLGVMIIDEEHEAAYKQ--DSNPRYHAREVAILRAQYNQATLVLG--------SATPS 424
              L     +   E A +        Y        +  Y +    +         S T S
Sbjct: 66  AAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRS 125

Query: 425 LESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLV 484
           L +R R    V     +    +      E +  +   ++    T   +P  LE I   + 
Sbjct: 126 LLTR-RDVIVVASVSAIYGLGD----PREYRARNLVGFVLFPATHYLSPEGLEEILKEIE 180

Query: 485 KK---EQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIP 541
           K+                +  +               +     +                
Sbjct: 181 KELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYT 240

Query: 542 QVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEA 601
            +    +   +    +       +       AR   +     R   +      +F     
Sbjct: 241 LLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLE 300

Query: 602 DILLG--TQMIAKGLDFPNVTLV 622
            +             +  +   V
Sbjct: 301 RVSQVVFVSATPGPFELAHSGRV 323


>1gm5A4 [c.37.1.19] RECG A:550 -- 755
          Length = 191

 Score = 33.3 bits (75), Expect = 3e-04
 Identities = 22/113 (19%), Positives = 44/113 (38%), Gaps = 15/113 (13%)

Query: 554 YYGTGTQKAYDELAELF--PQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIA 611
           +      K+  E+ E       ++  M    ++++     ++ +F  G  DIL+ T +I 
Sbjct: 33  FIVYPLIKSAVEMYEYLSKEVFKLGLMHGRLSQEE--KDRVMLEFAEGRYDILVSTTVIE 90

Query: 612 KGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
            G+D P   ++ + N +        R        L Q+ GR GR  +     +
Sbjct: 91  VGIDVPRANVMVIENPE--------RFGLA---QLHQLRGRVGRGGQEAYCFL 132


>1m2vB5 [g.41.10.1] PROTEIN TRANSPORT PROTEIN SEC24 B:216 -- 300
          Length = 85

 Score = 32.6 bits (74), Expect = 5e-04
 Identities = 6/60 (10%), Positives = 12/60 (20%), Gaps = 18/60 (30%)

Query: 513 CPNCDISLTLHMDT----KTMNCHYCG--------------FSKDIPQVCPNCKSRSIRY 554
           C  C   +   +      +   C++C                           K   + Y
Sbjct: 16  CRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEY 75


>1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
          Length = 348

 Score = 31.9 bits (71), Expect = 9e-04
 Identities = 12/97 (12%), Positives = 29/97 (29%), Gaps = 5/97 (5%)

Query: 259 PLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPE 318
             +    Q+ A    ++         ++ G  G+GKT    +++   +         +  
Sbjct: 146 VSDEINWQKVAAAVALTR-----RISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRL 200

Query: 319 ISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRK 355
            + T +   R     G  +  L       ++  E   
Sbjct: 201 AAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDAS 237


>1t5iA [c.37.1.19] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT
          Length = 159

 Score = 31.8 bits (71), Expect = 0.001
 Identities = 16/106 (15%), Positives = 32/106 (30%), Gaps = 12/106 (11%)

Query: 559 TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPN 618
           + +    LA+L  +     + +     +    +   QF   +  IL+ T +  +G+D   
Sbjct: 36  SVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIER 95

Query: 619 VTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLI 664
           V +    +                         RAGR    G  + 
Sbjct: 96  VNIAFNYDMP------------EDSDTYLHRVARAGRFGTKGLAIT 129


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0603    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 17,096,634
Number of extensions: 1255773
Number of successful extensions: 5927
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5776
Number of HSP's successfully gapped: 243
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)