RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACF56378.1 spne4 ACF56378.1 GIB00761CH01 "ABC transporter,
ATP-binding protein"
         (210 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1b0uA [c.37.1.12] HISTIDINE PERMEASE                                  144   8e-38
1sgwA [c.37.1.12] PUTATIVE ABC TRANSPORTER                            131   6e-34
1ji0A [c.37.1.12] ABC TRANSPORTER                                     129   4e-33
1q3hA [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE           126   2e-32
1l7vC [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD      115   6e-29
1e69A [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN                  112   3e-28
1mukA [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3                           112   4e-28
1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERAS...   108   6e-27
1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564    104   8e-26
2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336              101   9e-25
1ex6A [c.37.1.1] GUANYLATE KINASE                                     100   2e-24
1qhlA [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)                 99   4e-24
1e9rA [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB                       92   6e-22
2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253             91   1e-21
1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A...    90   2e-21
1urjA [e.58.1.1] MAJOR DNA-BINDING PROTEIN                             89   4e-21
1mjgM [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT           89   6e-21
1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223                86   3e-20
1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198                      86   4e-20
1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379          84   1e-19
1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --...    83   2e-19
1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:...    81   9e-19
1e6cA [c.37.1.2] SHIKIMATE KINASE                                      80   2e-18
2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251          79   4e-18
1tljA [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622                 79   4e-18
2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489                     79   6e-18
1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278                              78   8e-18
1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321                     78   8e-18
1t06A [a.118.1.17] HYPOTHETICAL PROTEIN                                78   1e-17
1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150             77   2e-17
1f46A [d.129.4.1] CELL DIVISION PROTEIN ZIPA                           76   3e-17
1kgdA [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK                       76   4e-17
1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181             76   4e-17
1i1qA [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I                    75   6e-17
1jjvA [c.37.1.1] DEPHOSPHO-COA KINASE                                  75   9e-17
1jb1A [c.91.1.2] HPRK PROTEIN                                          74   1e-16
2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165             74   2e-16
1rkbA [c.37.1.1] PROTEIN AD-004                                        74   2e-16
1l3aA [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2            73   3e-16
1grqA [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE                73   3e-16
1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -                  72   7e-16
1poiA [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE                   71   1e-15
1s9hA [c.37.1.20] REP 40 PROTEIN                                       71   1e-15
1t3wA [a.236.1.1] DNA PRIMASE                                          71   1e-15
1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180           70   2e-15
1vplA [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN                 70   2e-15
1fl9A [c.37.1.18] HYPOTHETICAL PROTEIN HI0065                          70   2e-15
1g6oA [c.37.1.11] CAG-ALPHA                                            70   3e-15
1n25A [c.37.1.20] LARGE T ANTIGEN                                      69   4e-15
1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173                       69   4e-15
1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411          69   4e-15
3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348    69   6e-15
2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373                     68   8e-15
1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395           67   1e-14
1mi8A [b.86.1.2] DNAB INTEIN                                           66   5e-14
1ffhA2 [c.37.1.10] FFH A:89 -- 295                                     65   6e-14
2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445      65   6e-14
1cd5A [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)          65   7e-14
1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173            65   8e-14
1udwA [c.37.1.6] URIDINE-CYTIDINE KINASE 2                             65   9e-14
1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228                64   1e-13
1d6jA [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE                     64   1e-13
1jbkA [c.37.1.20] CLPB PROTEIN                                         64   2e-13
1w1wA [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1               63   4e-13
2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123                63   4e-13
1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800       62   5e-13
2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87        62   7e-13
1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177...    61   1e-12
1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132     61   2e-12
1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188          61   2e-12
1np6A [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS      61   2e-12
3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180      60   2e-12
1viaA [c.37.1.2] SHIKIMATE KINASE                                      60   2e-12
1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607       60   3e-12
1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603...    60   3e-12
2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225              59   4e-12
2vgmA3 [d.79.3.2] DOM34 A:278 -- 381                                   58   8e-12
1g6hA [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID              58   8e-12
1gm5A1 [a.24.21.1] RECG A:7 -- 105                                     58   1e-11
1l7lA [b.18.1.16] PA-I GALACTOPHILIC LECTIN                            57   2e-11
2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143     56   3e-11
1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397            55   6e-11
1mm8A [c.55.3.4] TN5 TRANSPOSASE                                       55   9e-11
2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494       54   1e-10
1ckvA [d.137.1.1] PROTEIN (PROTEIN B)                                  53   3e-10
1g8yA [c.37.1.11] REGULATORY PROTEIN REPA                              53   3e-10
1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298                     52   6e-10
1bccF [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE                 52   6e-10
1vhhA [d.65.1.2] SONIC HEDGEHOG                                        52   7e-10
1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135                          52   8e-10
2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 -...    51   1e-09
2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206                          51   1e-09
1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306                 51   1e-09
1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -                  50   2e-09
2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --...    50   2e-09
1d8jA [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA               50   2e-09
1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706           50   3e-09
1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366         49   7e-09
1v37A [c.60.1.1] PHOSPHOGLYCERATE MUTASE                               48   8e-09
1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, ...    48   1e-08
1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 ...    48   1e-08
1afrA [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE       48   1e-08
1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511            46   3e-08
1odfA [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2            46   4e-08
1l1oA [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT                  45   7e-08
1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171                                45   7e-08
1tmkA [c.37.1.1] THYMIDYLATE KINASE                                    44   1e-07
1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200                            44   1e-07
1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244         44   1e-07
1f8xA [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE                 44   1e-07
1cr0A [c.37.1.11] DNA PRIMASE/HELICASE                                 44   1e-07
1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172         43   2e-07
1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283             43   3e-07
1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92                            42   7e-07
1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244                  41   1e-06
1iioA [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865                 41   2e-06
1em8A [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT                       41   2e-06
1oa8A [b.145.1.1] ATAXIN-1                                             40   3e-06
2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70                      40   3e-06
1j90A [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE                            39   4e-06
1esmA [c.37.1.6] PANTOTHENATE KINASE                                   37   2e-05
1e2hA [c.37.1.1] THYMIDINE KINASE                                      37   2e-05
1tueA [c.37.1.20] REPLICATION PROTEIN E1                               36   5e-05
1sbxA [a.6.1.4] SKI ONCOGENE                                           36   6e-05
1q3tA [c.37.1.1] CYTIDYLATE KINASE                                     34   2e-04
1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 ...    34   2e-04
1ckeA [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)               33   2e-04
1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342    32   7e-04
1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480                 32   7e-04

>1b0uA [c.37.1.12] HISTIDINE PERMEASE
          Length = 258

 Score =  144 bits (364), Expect = 8e-38
 Identities = 60/223 (26%), Positives = 107/223 (47%), Gaps = 15/223 (6%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYD-GTIFY 59
            + +  + K +G  E+   +S+   AG V ++IGSSGSGK+T +  I  LE    G I  
Sbjct: 2   KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIV 61

Query: 60  RGKDLANYKSSDFFRHE------------LGYLFQNFGLIENQSIEENLKLGLIG-QKLS 106
            G+++   +  D                 L  +FQ+F L  + ++ EN+    I    LS
Sbjct: 62  NGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLS 121

Query: 107 RSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASID 166
           + + R R  + L +VG+      K    LSGG+ QRV++A+ +   P  +L DEPT+++D
Sbjct: 122 KHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALD 181

Query: 167 PATSQLIMEILLSLRDDNRLIIIATHNPA-IWEMADEVFTMDH 208
           P     ++ I+  L ++ + +++ TH       ++  V  +  
Sbjct: 182 PELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQ 224


>1sgwA [c.37.1.12] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score =  131 bits (331), Expect = 6e-34
 Identities = 49/210 (23%), Positives = 92/210 (43%), Gaps = 16/210 (7%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
            +E++ +S  + +  L   ++MT E G V    G +G GKTTL+  I   L+P  G I Y
Sbjct: 2   KLEIRDLSVGYDKPVL-ERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIY 60

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
            G  +         + ++ +L +   +    S+E+ LK       +  ++  +       
Sbjct: 61  NGVPITKV------KGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALES- 113

Query: 120 QVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
              +  LDL K++ ELS G  +RV LA  +L N    + D+P  +ID  +   +++ +L 
Sbjct: 114 ---VEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILE 170

Query: 180 LRDDNRLIIIA-THNPAIWEMADEVFTMDH 208
           +  +  ++II+           D    +  
Sbjct: 171 ILKEKGIVIISSREEL---SYCDVNENLHK 197


>1ji0A [c.37.1.12] ABC TRANSPORTER
          Length = 240

 Score =  129 bits (324), Expect = 4e-33
 Identities = 42/210 (20%), Positives = 91/210 (43%), Gaps = 3/210 (1%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
           ++E++ +   +G       + +    G++  LIG++G+GKTT ++ I G +    G I +
Sbjct: 6   VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIF 65

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
            G+D+ N  +    R  +  + +   +    ++ ENL  G   +K     +R   +    
Sbjct: 66  NGQDITNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKR-DLEWIFS 124

Query: 120 QVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
                   L +    LSGGE Q +A+ + +   P  +  DEP+  + P     + E++  
Sbjct: 125 LFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQK 184

Query: 180 LRDDNRLIIIATHNP-AIWEMADEVFTMDH 208
           +  +   I++   N     ++A   + ++ 
Sbjct: 185 INQEGTTILLVEQNALGALKVAHYGYVLET 214


>1q3hA [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score =  126 bits (318), Expect = 2e-32
 Identities = 44/209 (21%), Positives = 84/209 (40%), Gaps = 13/209 (6%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
           + ++           +  N+++  E G++ A+ GS+GSGKT+L+ +I G+LE  +G I +
Sbjct: 20  LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKH 79

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
            G+     + S                   ++I   +       K      +L+Q     
Sbjct: 80  SGRVSFCSQFSWIMPG-----------TIKENIIFGVSYDEYRYKSVVKACQLQQDITKF 128

Query: 120 QVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
                   L +    LSGG+  R++LA+ + K+    L D P   +D  T + + E  + 
Sbjct: 129 AEQD-NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVC 187

Query: 180 LRDDNRLIIIATHNPAIWEMADEVFTMDH 208
               N+  I+ T        AD++  +  
Sbjct: 188 KLMANKTRILVTSKMEHLRKADKILILHQ 216


>1l7vC [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
          Length = 231

 Score =  115 bits (288), Expect = 6e-29
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 19/214 (8%)

Query: 3   ELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGK 62
           +L+ V     E      LS    AG++  L+G +G+GK+TL+          G+I + G+
Sbjct: 5   QLQDV----AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSGKGSIQFAGQ 60

Query: 63  DLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVG 122
            L  + ++    H   YL Q         +   L L    +  +     +    AL+   
Sbjct: 61  PLEAWSATKLALH-RAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDD-- 117

Query: 123 LAYLDLDKRIFELSGGESQRVALAKIILKNPP-------FILADEPTASIDPATSQLIME 175
                L +   +LSGGE QRV LA ++L+  P        +L DEP  S+D A    + +
Sbjct: 118 ----KLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPXNSLDVAQQSALDK 173

Query: 176 ILLSLRDDNRLIIIATHNPA-IWEMADEVFTMDH 208
           IL +L      I+ ++H+       A   + +  
Sbjct: 174 ILSALCQQGLAIVXSSHDLNHTLRHAHRAWLLKG 207


>1e69A [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
          Length = 263

 Score =  112 bits (281), Expect = 3e-28
 Identities = 36/247 (14%), Positives = 76/247 (30%), Gaps = 50/247 (20%)

Query: 8   SKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANY 67
                  + F   S+   + +V A++G +GSGK+ +++ I  +      + + G +    
Sbjct: 5   KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPP 64

Query: 68  KSSDFFRHELGYLFQNFGLIENQS------------------------------------ 91
             S +         +   +                                         
Sbjct: 65  AGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIV 124

Query: 92  --------IEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRV 143
                   +    ++     +         + +    +       D+++  LSGGE   V
Sbjct: 125 GQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGR-RDQKLSLLSGGEKALV 183

Query: 144 ALAKIIL----KNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEM 199
            LA +      K  PF + DE  + +D   ++    +L       + I+I THN  + E 
Sbjct: 184 GLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI-THNKIVMEA 242

Query: 200 ADEVFTM 206
           AD +  +
Sbjct: 243 ADLLHGV 249


>1mukA [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
          Length = 1256

 Score =  112 bits (281), Expect = 4e-28
 Identities = 21/166 (12%), Positives = 48/166 (28%), Gaps = 6/166 (3%)

Query: 29   VYALIGSSGSGKTTL-MNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLI 87
            V   +  +      L + +   ++P +   F +   +     S   R            +
Sbjct: 1050 VKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQS--TRKYFAQTLFMAKTV 1107

Query: 88   ENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAK 147
                +       L  + L   ++ L  +     VGL   + D    ++   +   V LA+
Sbjct: 1108 SGLDVNAIDSALLRLRTLGADKKALTAQL--LMVGLQESEADALAGKIMLQDVNTVQLAR 1165

Query: 148  IILKNPPFILADEPTASIDPATSQLIMEILLSL-RDDNRLIIIATH 192
            ++    P         S+     +L+ +    L  D    +     
Sbjct: 1166 VVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWLRA 1211


>1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
           A:1 -- 250
          Length = 250

 Score =  108 bits (270), Expect = 6e-27
 Identities = 21/209 (10%), Positives = 45/209 (21%), Gaps = 13/209 (6%)

Query: 8   SKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLAN 66
           +K +               G    + G    G    +     K    + T       + N
Sbjct: 1   TKFYT---DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDN 57

Query: 67  YKSSDFFRHEL-----GYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQV 121
           +      + +                E Q +   L++ L  Q       R          
Sbjct: 58  FGLGLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFY 117

Query: 122 GLAYLD--LDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
                   + +    +   +   +A+A    +   F                L+      
Sbjct: 118 TSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA- 176

Query: 180 LRDDNRLIIIATHNPA-IWEMADEVFTMD 207
            +  N     +  N       A E   ++
Sbjct: 177 DQAGNVTFRKSARNFNLPXCKAAETTVVE 205


>1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
          Length = 244

 Score =  104 bits (260), Expect = 8e-26
 Identities = 54/214 (25%), Positives = 103/214 (48%), Gaps = 9/214 (4%)

Query: 2   IELKQVSKSF--GERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIF 58
           +++K V+ ++   E+   S++S +   GK  AL+G SGSGK+T+ N+     +   G+I 
Sbjct: 22  VDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSIC 81

Query: 59  YRGKDLANYKSSDFFRH---ELGYLFQNFGLIENQSIEE-NLKLGLIGQKLSRSEQRLRQ 114
             G D+ +YK ++  RH       +      I N        +      + +  +    +
Sbjct: 82  LDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAME 141

Query: 115 KQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIM 174
                  GL    + +    LSGG+ QRVA+A+ +L++ P ++ DE T+++D  + + I 
Sbjct: 142 FIENMPQGLDT-VIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQ 200

Query: 175 EILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
             L  L+ +  +++I  H  +  E ADE+  +D 
Sbjct: 201 AALDELQKNKTVLVI-AHRLSTIEQADEILVVDE 233


>2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
          Length = 182

 Score =  101 bits (252), Expect = 9e-25
 Identities = 21/180 (11%), Positives = 51/180 (28%), Gaps = 15/180 (8%)

Query: 25  EAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNF 84
           + G++  L    G+G        G L+  D           N K+ +           + 
Sbjct: 7   QVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDV 66

Query: 85  G------LIENQSIEENLKLGLIGQKLSRSE--QRLRQKQALEQVGLAYLDLDKRIFELS 136
                     N     N+   +  +K+   +  + L +K+   +  +  L    + +  S
Sbjct: 67  TGFGLLGHAWNICKNSNIGARIFFEKVPYYQLSENLVKKKIYPKGAIENL-NFVKNYLKS 125

Query: 137 GGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAI 196
             ++ ++ L    + +   +                I E    L  +  +I        +
Sbjct: 126 NLDNWKLILLSDPVTSGGLLFTINKEKLEK------IDETAKELEVNYWIIGETIAENVL 179


>1ex6A [c.37.1.1] GUANYLATE KINASE
          Length = 186

 Score =  100 bits (249), Expect = 2e-24
 Identities = 19/189 (10%), Positives = 46/189 (24%), Gaps = 14/189 (7%)

Query: 28  KVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
           +   + G SG+GK+TL+  +  +     G                   +   Y F +   
Sbjct: 2   RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGE----VNGKDYNFVSVDE 57

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALA 146
            ++                         KQ  +      L         S      +   
Sbjct: 58  FKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCIL-DIDMQGVKSVKAIPELNAR 116

Query: 147 KIILKNPPFILADEPTASIDPATSQLIMEILLSLRDD-------NRLIIIATHNPA-IWE 198
            + +  P      +        T + I + L + + +           +I   +    ++
Sbjct: 117 FLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYK 176

Query: 199 MADEVFTMD 207
              +    +
Sbjct: 177 ELKDFIFAE 185


>1qhlA [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
          Length = 203

 Score = 99.2 bits (246), Expect = 4e-24
 Identities = 30/208 (14%), Positives = 52/208 (25%), Gaps = 39/208 (18%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRG 61
            + + ++        F   +   +      L G +G+GK+T M         D T+   G
Sbjct: 2   GKFRSLTLINWN--GFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHG 58

Query: 62  KDLANYKSSDFFRHELGYLFQN-------------FGLIENQSIEENLKLGLIGQKLSRS 108
           K  A           L  +                 G      I+     GL        
Sbjct: 59  KLKAGV-----CYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQ 113

Query: 109 EQRLRQKQALEQVGLAYLDLDK----------RIFELSGGESQRVALAKI------ILKN 152
                  +   +V       DK          +   ++   S    L  I          
Sbjct: 114 LVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDR 173

Query: 153 PPFILADEPT--ASIDPATSQLIMEILL 178
             F    E +    I  A ++ + + LL
Sbjct: 174 SKFYRLIEASLYGGISSAITRSLRDYLL 201


>1e9rA [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 420

 Score = 92.0 bits (227), Expect = 6e-22
 Identities = 15/210 (7%), Positives = 52/210 (24%), Gaps = 7/210 (3%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAG-KVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
            +LK++++   ++   + + M  +A  +   + G++G+GK+ L+  +          +  
Sbjct: 24  GKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVI 83

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
              +         F  +   +   +          N        +        R K    
Sbjct: 84  VDPNGDMLS---KFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEA 140

Query: 120 QVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
           +   +Y                     + +         D+    ++   ++ +      
Sbjct: 141 EEWASYGR-LLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNE 199

Query: 180 LRDD-NRLIIIATHNPAIWEMADEVFTMDH 208
                     + +          +      
Sbjct: 200 ASKALTSARFVLSDKLPEHVTMPDGDFSIR 229


>2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
          Length = 246

 Score = 90.7 bits (224), Expect = 1e-21
 Identities = 13/140 (9%), Positives = 26/140 (18%), Gaps = 14/140 (10%)

Query: 77  LGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLD------LDK 130
           L  LF       +    +              E      + L + G+             
Sbjct: 1   LKVLFIGESWHIHXIHSKGYDSF---TSSKYEEGATWLLECLRKGGVDIDYXPAHTVQIA 57

Query: 131 RIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDD--NRLII 188
               +       V +   I  N   +  +              +E +     +    L I
Sbjct: 58  FPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIK---PNALESIKEYVKNGGGLLXI 114

Query: 189 IATHNPAIWEMADEVFTMDH 208
               +    E          
Sbjct: 115 GGYLSFXGIEAKANYKNTVL 134


>1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
           A:260 -- 622
          Length = 353

 Score = 90.3 bits (222), Expect = 2e-21
 Identities = 22/202 (10%), Positives = 33/202 (16%), Gaps = 4/202 (1%)

Query: 11  FGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS 70
             E  L   ++      K  A    S  GKT L  M   L  +             + + 
Sbjct: 2   LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQ 61

Query: 71  DFFRHELGYLFQNFGLIENQSIEENL--KLGLIGQKLSRSEQRLRQKQALEQVGLAYLDL 128
              R                        K        +   +        E +       
Sbjct: 62  GHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLA-S 120

Query: 129 DKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLII 188
              I      E            N  F         ID A        +  +    R   
Sbjct: 121 GVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPA 180

Query: 189 IATHNPAIWEMADEVFTMDHLK 210
                            +    
Sbjct: 181 GVPLVYEA-LSWQHGVFVGAAM 201


>1urjA [e.58.1.1] MAJOR DNA-BINDING PROTEIN
          Length = 1028

 Score = 89.3 bits (221), Expect = 4e-21
 Identities = 19/236 (8%), Positives = 55/236 (23%), Gaps = 34/236 (14%)

Query: 2   IELKQVSKSFGERE--------LFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEP 52
              + + +  G           +             +  +G  GS K T+      ++  
Sbjct: 126 TTGEALCERLGLDPDRALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPV 183

Query: 53  YDGTIFYRGKD--LANYKSSDFFRHELGYLFQNFGLIE------NQSIEENLKLGLIGQK 104
           Y   +F       +A   +++       + +              +++     + L  + 
Sbjct: 184 YPLQLFMPDFSRVIAEPFNANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPAAVALRSRN 243

Query: 105 L---SRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILK-----NPPFI 156
           +   +R+   L   +  E       D+    F     +     +A              +
Sbjct: 244 VDAVARAAAHLAFDENHEGAA-LPADITFTAFAGGFEQRLASVMAGDAALALESIVSMAV 302

Query: 157 LADEPTASIDPATSQL------IMEILLSLRDDNRLIIIATHNPAIWEMADEVFTM 206
             + PT        +           + +       ++ A        +       
Sbjct: 303 FDEPPTDISAWPLFEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDD 358


>1mjgM [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
          Length = 728

 Score = 88.6 bits (218), Expect = 6e-21
 Identities = 28/206 (13%), Positives = 60/206 (29%), Gaps = 5/206 (2%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR 60
            I+L ++          +    +   G +Y  +G + +    L+  + + E  DG I   
Sbjct: 309 GIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVI 368

Query: 61  GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ 120
           G D+      +  +  LG L   +G       E  L+          +            
Sbjct: 369 GPDIDQI--PEGSKLPLGILVDIYGRKMQADFEGVLE---RRIHDFINYGEGLWHTGQRN 423

Query: 121 VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL 180
           +    +  D             + +AK+  + P  +   + T   D A  +  ME+    
Sbjct: 424 INWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREK 483

Query: 181 RDDNRLIIIATHNPAIWEMADEVFTM 206
             +    +    +  +      V   
Sbjct: 484 YKERDDRMRGLTDETVDTFYSCVLCQ 509


>1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
          Length = 222

 Score = 86.2 bits (212), Expect = 3e-20
 Identities = 22/184 (11%), Positives = 49/184 (26%), Gaps = 11/184 (5%)

Query: 27  GKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFG 85
             V  L G  G+GKTTL+  I  +   Y   +                      +     
Sbjct: 3   IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGE-VSVDDQLIGDRATQIKTLTN 61

Query: 86  LIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVAL 145
                S    L+  L    L   +   +     +++ +           +         L
Sbjct: 62  GCICCSRSNELEDAL----LDLLDNLDKGNIQFDRLVI-ECTGMADPGPIIQTFFSHEVL 116

Query: 146 AKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPA-IWEMADEVF 204
            +  L +    L D   A        +       +   +R+++  T       ++ + + 
Sbjct: 117 CQRYLLDGVIALVDAVHADEQMNQFTIAQSQ---VGYADRILLTKTDVAGEAEKLHERLA 173

Query: 205 TMDH 208
            ++ 
Sbjct: 174 RINA 177


>1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
          Length = 157

 Score = 85.7 bits (212), Expect = 4e-20
 Identities = 10/150 (6%), Positives = 37/150 (24%), Gaps = 13/150 (8%)

Query: 51  EPYDGTIFYRGKDLANYKSSDFF-RHELGYLFQNFG-LIENQSIEENLKLGLIGQKLSRS 108
                 ++    D   +       +      + +    +E ++   +   G +   +   
Sbjct: 1   RDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADF--GPLNLAMVY- 57

Query: 109 EQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPA 168
               +  + L+ + +      K +      + ++   A ++       L   P  +    
Sbjct: 58  RYCCKINKKLKSITML---RKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRIL 114

Query: 169 TSQLIMEILL-----SLRDDNRLIIIATHN 193
                  I          +    ++   H 
Sbjct: 115 IFGETSYIPFRDAAYGSCNFYITLLDCFHA 144


>1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
          Length = 285

 Score = 84.5 bits (207), Expect = 1e-19
 Identities = 20/213 (9%), Positives = 54/213 (25%), Gaps = 6/213 (2%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLE-PYDGTIFY 59
           +I    V +         +  +    G+   +IG   +GKT++       +  ++     
Sbjct: 42  IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDE 101

Query: 60  RGKDLANYKSSDFFRHELGYLFQNF----GLIENQSIEENLKLGLIGQKLSRSEQRLRQK 115
           + K    Y +    R  +  L +       +     +          Q L+        +
Sbjct: 102 KKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE 161

Query: 116 QALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIME 175
              +    A   +   + + +    Q   L +       +        S     +  + +
Sbjct: 162 YFRDNGKHAL-IIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMND 220

Query: 176 ILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
                      +I          +   V ++  
Sbjct: 221 AFGGGSLTALPVIETQAGDVSAYIPTNVISITD 253


>1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
           417
          Length = 282

 Score = 83.5 bits (205), Expect = 2e-19
 Identities = 18/219 (8%), Positives = 51/219 (23%), Gaps = 28/219 (12%)

Query: 2   IELKQVSKSFGERELFS-----------NLSMTFEAGKVYALIGSSGSGKTTLMNMI-GK 49
           I  + ++       L             +L+     G+   ++    +GKT L+  I   
Sbjct: 3   ILFENLTPLHANSRLRXGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQS 62

Query: 50  LEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSE 109
           +             +      +             G +   + +E     +   +    +
Sbjct: 63  IAYNHPDCVLXVLLI-----DERPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEK 117

Query: 110 QRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPAT 169
            +   +   + + L                +    +  ++           P      A 
Sbjct: 118 AKRLVEHKKDVIIL-------LDSITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAAR 170

Query: 170 SQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
           +      L          +I T +     + +E     +
Sbjct: 171 NVEEGGSLT----IIATALIDTGSKXDEVIYEEFKGTGN 205


>1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
           -- 409
          Length = 330

 Score = 81.4 bits (199), Expect = 9e-19
 Identities = 22/213 (10%), Positives = 52/213 (24%), Gaps = 10/213 (4%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAGKVY-ALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
              +  S    + +  + L      G+ +  L+G++G+GKT  M  +   L      +  
Sbjct: 2   FRYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAP 61

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFG----LIENQSIEENLKLGLIGQKLSRSEQRLRQK 115
                A   +          +               +            ++   +RLR  
Sbjct: 62  NKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHS 121

Query: 116 QALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIME 175
                +       D  +              +   +N    +    T  + P   + I++
Sbjct: 122 TTRSLL----TRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILK 177

Query: 176 ILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
            +     +              +   E    D 
Sbjct: 178 EIEKELWERVRYFEERGEVLYAQRLKERTLYDL 210


>1e6cA [c.37.1.2] SHIKIMATE KINASE
          Length = 170

 Score = 80.0 bits (196), Expect = 2e-18
 Identities = 17/167 (10%), Positives = 48/167 (28%), Gaps = 13/167 (7%)

Query: 28  KVYALIGSSGSGKTTLMNMIGKLEPYDGT---IFYRGKDLANYKSSDFFRHELGYLFQNF 84
           +   ++G+ G G TT+   + +   Y+     IF +                 G+  +  
Sbjct: 3   EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRES 62

Query: 85  GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDK--------RIFELS 136
             ++  +    +     G  L    ++  +         A  +                +
Sbjct: 63  EALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPT 122

Query: 137 GGESQRVALAKIILKNPPFILADEPTASIDPATS--QLIMEILLSLR 181
                     + +L+    +  D     +D       ++ E++ ++R
Sbjct: 123 LTGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAAIVCELMQTMR 169


>2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
          Length = 217

 Score = 79.4 bits (194), Expect = 4e-18
 Identities = 18/198 (9%), Positives = 51/198 (25%), Gaps = 6/198 (3%)

Query: 15  ELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFR 74
           +    L+   +  K   ++ +  S +T  + ++   + + G +   G+D++  +     +
Sbjct: 4   QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXGRDISEARPDITHQ 63

Query: 75  HELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFE 134
             L  L           +      G++ +           K+                 E
Sbjct: 64  CLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLL-HKLSIRSE 122

Query: 135 LSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIA--TH 192
               +  +  +   +      +        I        +E L         +       
Sbjct: 123 EKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQD---YIEKLDDDESICVFVGAXARGK 179

Query: 193 NPAIWEMADEVFTMDHLK 210
           +    E  DE   + +  
Sbjct: 180 DNFADEYVDEKVGLSNYP 197


>1tljA [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
          Length = 189

 Score = 79.3 bits (194), Expect = 4e-18
 Identities = 10/192 (5%), Positives = 43/192 (22%), Gaps = 11/192 (5%)

Query: 7   VSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLAN 66
           +       +  + +    E G +   I         L+                G+    
Sbjct: 1   LVWEELREKALNKIYHDKEIGYLDPDIL------GFLLAFYRNRNDVYTQSSCSGRITIV 54

Query: 67  YKSSD---FFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGL 123
                        +          + + +    ++  +   +      +  K       +
Sbjct: 55  DAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDI 114

Query: 124 AYLDLDKRIF--ELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLR 181
             +  +       +     + V +          +L +  T  +D    + ++ +   + 
Sbjct: 115 LKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVL 174

Query: 182 DDNRLIIIATHN 193
              +  +    +
Sbjct: 175 ARGKQKMNLLKD 186


>2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
          Length = 426

 Score = 78.6 bits (192), Expect = 6e-18
 Identities = 19/218 (8%), Positives = 48/218 (22%), Gaps = 18/218 (8%)

Query: 2   IELKQVSKSFGERELFS---------NLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEP 52
            E++++ +     +  +         + ++     +    +  +G        M G   P
Sbjct: 75  EEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLP 134

Query: 53  YDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRL 112
                             +  R  +         I  + +   LK             ++
Sbjct: 135 RRSGAAGAAVKGVGTMVMELIRM-IKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQV 193

Query: 113 RQKQALEQVGLAYLD-LDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQ 171
           R+ +         L  L +    L G  + +  L   +  +      D            
Sbjct: 194 RESRNPGNAEFEDLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGID 253

Query: 172 LIMEILLSLRDDNRLIIIATHNPA-IWEMADEVFTMDH 208
                       N  +             +  V+   H
Sbjct: 254 PFR------LLQNSQVYSLIRPNENPAHKSQLVWMACH 285


>1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
          Length = 263

 Score = 78.3 bits (191), Expect = 8e-18
 Identities = 18/186 (9%), Positives = 46/186 (24%), Gaps = 3/186 (1%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
           G    ++G    GK+TL N + K  P+       G         D     +         
Sbjct: 2   GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTT 61

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALA 146
           +        L  G    +   ++     ++      +     +    +     +  +ALA
Sbjct: 62  M-EFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDTINTELALA 120

Query: 147 KIILKNPPFILADEPTASIDPATSQLIMEILLS--LRDDNRLIIIATHNPAIWEMADEVF 204
            +           +     D      +  +     + ++  +I     +    +      
Sbjct: 121 DLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYN 180

Query: 205 TMDHLK 210
            +    
Sbjct: 181 FLTLKP 186


>1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
          Length = 109

 Score = 78.2 bits (192), Expect = 8e-18
 Identities = 13/112 (11%), Positives = 27/112 (24%), Gaps = 5/112 (4%)

Query: 78  GYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSG 137
           G L           +   L        L+  E+      +L+   +           + G
Sbjct: 1   GALRPGISFHPK--LRPILLPNKNSADLTSPEKIQAIMTSLQDFKI---VPIDPTKNIMG 55

Query: 138 GESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIII 189
            E     + K+    P   +       +DP     +  ++    D       
Sbjct: 56  IEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS 107


>1t06A [a.118.1.17] HYPOTHETICAL PROTEIN
          Length = 235

 Score = 77.6 bits (190), Expect = 1e-17
 Identities = 13/202 (6%), Positives = 47/202 (23%), Gaps = 20/202 (9%)

Query: 19  NLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELG 78
                    +   +  S+G+ +       G ++P         ++LA  +      ++  
Sbjct: 8   QELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAK-KIKLNQELA-EELYATGNYDAM 65

Query: 79  YLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGG 138
           Y        +  S  +  +       +  +   +     +               +    
Sbjct: 66  YFAGIIADPKAMSESDFDRW------IDGAYFYMLSDYVVAVTLSESNIAQDVADKWIAS 119

Query: 139 ESQR------VALAKIILKNPPFILADEPTASIDPA-TSQLIMEILLSLRDDNRLIIIAT 191
             +            ++        ++   + +       +      +    N  +    
Sbjct: 120 GDELKMSAGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVA 179

Query: 192 HNP-----AIWEMADEVFTMDH 208
            +         E+A EV  ++ 
Sbjct: 180 ISYVPLHEKAVEIAKEVGIVEV 201


>1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
          Length = 119

 Score = 77.2 bits (189), Expect = 2e-17
 Identities = 16/127 (12%), Positives = 34/127 (26%), Gaps = 11/127 (8%)

Query: 27  GKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFG 85
           G++  ++G   SGK+T +     + +                        ++        
Sbjct: 2   GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRALPACLLRDVAQEALGVA 61

Query: 86  LIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVAL 145
           +I     +               E       A + V +A         +  G     V L
Sbjct: 62  VIGIDEGQFF---------PDIVEFCEAMANAGKTVIVAA-LDGTFQRKPFGAILNLVPL 111

Query: 146 AKIILKN 152
           A+ ++K 
Sbjct: 112 AESVVKL 118


>1f46A [d.129.4.1] CELL DIVISION PROTEIN ZIPA
          Length = 139

 Score = 76.4 bits (187), Expect = 3e-17
 Identities = 12/143 (8%), Positives = 39/143 (27%), Gaps = 14/143 (9%)

Query: 42  TLMNMIGKLE-PYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLG- 99
            +MN+        +G +                  + G++F +  +       +      
Sbjct: 6   IIMNVAAHHGSELNGELLLNS------------IQQAGFIFGDMNIYHRHLSPDGSGPAL 53

Query: 100 LIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILAD 159
                + +      + +     G+          +        +  A+ I      ++ D
Sbjct: 54  FSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLD 113

Query: 160 EPTASIDPATSQLIMEILLSLRD 182
           +    + P   +   +I+  ++D
Sbjct: 114 DQRRMMTPQKLREYQDIIREVKD 136


>1kgdA [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
          Length = 175

 Score = 75.9 bits (185), Expect = 4e-17
 Identities = 15/180 (8%), Positives = 39/180 (21%), Gaps = 15/180 (8%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKL-EPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFG 85
            K   L+G+ G G+  + N +                        +++      + Q+  
Sbjct: 3   RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDIS 62

Query: 86  LIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRI-FELSGGESQRVA 144
             E                         + + + ++    L     +  +          
Sbjct: 63  NNEYLEYG-----------SHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEF 111

Query: 145 LAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPA-IWEMADEV 203
              ++    P I              +    +  +      L II  +         +E 
Sbjct: 112 APFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTII-NNEIDETIRHLEEA 170


>1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
          Length = 176

 Score = 75.9 bits (185), Expect = 4e-17
 Identities = 20/187 (10%), Positives = 36/187 (19%), Gaps = 18/187 (9%)

Query: 26  AGKVYALIGSSGSGKTTLMNMIGKLE-PYDGTIFYRGKDLANYKSSDFFRHELGYLFQNF 84
            G +  L G  GSGK+T+   +  L                             +L Q+ 
Sbjct: 3   GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDD-----LWGYIKHGRIDPWLPQSH 57

Query: 85  GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGG----ES 140
                         G   ++          +        A       I   +      E 
Sbjct: 58  QQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIER 117

Query: 141 QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMA 200
                   +             A +      ++           +  I A          
Sbjct: 118 CLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQ-------- 169

Query: 201 DEVFTMD 207
              F +D
Sbjct: 170 SGRFRID 176


>1i1qA [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
          Length = 513

 Score = 75.3 bits (184), Expect = 6e-17
 Identities = 20/148 (13%), Positives = 33/148 (22%), Gaps = 26/148 (17%)

Query: 1   MIELKQVSKSFG--ERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIF 58
           +     V         EL  +L           +   SG+ K   M +I   E       
Sbjct: 386 VDRYSYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQR---- 441

Query: 59  YRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQAL 118
                         +   +GY   +  L     I   L    I    + +   L      
Sbjct: 442 -----------RGSYGGAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQS 490

Query: 119 EQVGLAYLDLDKRIFELSGGESQRVALA 146
           E                +    + +A A
Sbjct: 491 EADETR---------NKARAVLRAIATA 509


>1jjvA [c.37.1.1] DEPHOSPHO-COA KINASE
          Length = 194

 Score = 74.7 bits (182), Expect = 9e-17
 Identities = 22/182 (12%), Positives = 45/182 (24%), Gaps = 17/182 (9%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
             +  L G  GSGKTT+ N+   L           +++           ++   F    L
Sbjct: 2   TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVV--AKDSPLLSKIVEHFGAQIL 59

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALA 146
                 E                     K  L  +       ++   +L+   +      
Sbjct: 60  NRAALRERV-------------FNHDEDKLWLNNLLHPA-IRERMKQKLAEQTAPYTLFV 105

Query: 147 KIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTM 206
             +L         +    +D +    +       +    +           + AD+V   
Sbjct: 106 VPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQ-VSQQERLKWADDVINN 164

Query: 207 DH 208
           D 
Sbjct: 165 DA 166


>1jb1A [c.91.1.2] HPRK PROTEIN
          Length = 161

 Score = 74.2 bits (181), Expect = 1e-16
 Identities = 18/164 (10%), Positives = 39/164 (23%), Gaps = 6/164 (3%)

Query: 13  ERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDF 72
           ER     + +    G    + G SG GK+     + +                + ++   
Sbjct: 1   ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVG 59

Query: 73  FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLD--K 130
               +              I +   L   G     +   L              D+   K
Sbjct: 60  AAPPILSHLLEIR---GLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPK 116

Query: 131 RIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIM 174
               +  G +  + +              + T + +   + LI 
Sbjct: 117 ITVPVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE 160


>2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
          Length = 164

 Score = 73.9 bits (180), Expect = 2e-16
 Identities = 18/160 (11%), Positives = 39/160 (24%), Gaps = 13/160 (8%)

Query: 31  ALIGSSGSGKTTLMNMIGKLEPYDGTIFY----RGKDLANYKSSDFFRHELGYLFQNFGL 86
            L G     K+T+   + K   Y                          +   +  +  +
Sbjct: 4   ILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFV 63

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLA--YLDLDKRI------FELSGG 138
             N    +  K   I  +        + K   + V L      + KR+      +     
Sbjct: 64  YSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKD 123

Query: 139 ESQRVALAKIILKNPPFILADEPTASIDPATS-QLIMEIL 177
               + L + +  N         T         + I+ ++
Sbjct: 124 IDSILELYREVXSNAGLHTYSWDTGQWSSDEIAKDIIFLV 163


>1rkbA [c.37.1.1] PROTEIN AD-004
          Length = 173

 Score = 73.9 bits (180), Expect = 2e-16
 Identities = 18/173 (10%), Positives = 43/173 (24%), Gaps = 6/173 (3%)

Query: 25  EAGKVYALIGSSGSGKTTLMNMIGKLEPYD----GTIFYRGKDLANYKSSDFFRHELGYL 80
                  L G+ G GKTTL   +           G +    +    Y             
Sbjct: 2   MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDR 61

Query: 81  FQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES 140
             +    + +     +          R    +   +    V    L   +   E    ++
Sbjct: 62  VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERL-ETRGYNEKKLTDN 120

Query: 141 QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHN 193
            +  + +++ +       +E    +     + +   +  +        I  HN
Sbjct: 121 IQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE-QWIKDHN 172


>1l3aA [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
          Length = 166

 Score = 73.2 bits (179), Expect = 3e-16
 Identities = 15/153 (9%), Positives = 44/153 (28%), Gaps = 12/153 (7%)

Query: 51  EPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQ 110
           + + G   Y+GK     +               F L     +          ++   S +
Sbjct: 3   KVFVGYSIYKGKAALTVE--PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRK 60

Query: 111 RLRQKQA---LEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDP 167
           ++           + L   D  +   + + G S    + K++   P     D      + 
Sbjct: 61  QVFSLSVTEIGSIISLGTKDSCEFFHDPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNL 117

Query: 168 ATSQLIMEILLSLRDD----NRLIIIATHNPAI 196
           +    ++ +  ++          ++++  N  +
Sbjct: 118 SVQNKLINLDENIYIPVTKAEFAVLVSAFNFVM 150


>1grqA [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
          Length = 178

 Score = 72.8 bits (177), Expect = 3e-16
 Identities = 14/180 (7%), Positives = 44/180 (24%), Gaps = 11/180 (6%)

Query: 26  AGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNF 84
             ++  L G S +GK+ ++  +   L                                + 
Sbjct: 2   TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLI-EAMPLKMQSAEGGIEFDADG 60

Query: 85  GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVA 144
           G+                     +E  +   +A  ++ +  + L     +          
Sbjct: 61  GVSIGPEFRALEGA--------WAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDL 112

Query: 145 LAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDD-NRLIIIATHNPAIWEMADEV 203
               +       +A+    +     + +  +    + +     + + T +    E A  +
Sbjct: 113 DVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAI 172


>1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
          Length = 288

 Score = 71.9 bits (175), Expect = 7e-16
 Identities = 21/105 (20%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 108 SEQRLRQKQALEQVGLAYLDLDKRIFELSGGE------SQRVALAKIILKNPPFILADEP 161
           SE  +R ++   ++ + +   ++ +  LSGGE      + R+A++  +      ++ DEP
Sbjct: 171 SEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEP 230

Query: 162 TASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTM 206
           T  +D    + ++ I+         +I+ +H+  + + AD V  +
Sbjct: 231 TPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRI 275


>1poiA [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
          Length = 317

 Score = 71.2 bits (174), Expect = 1e-15
 Identities = 15/187 (8%), Positives = 39/187 (20%), Gaps = 12/187 (6%)

Query: 19  NLSMTFEAGKVYALIGSSGSGK--TTLMNMIGKLEP-YDGTIFYRGKDLANYKSSDFFRH 75
            ++    +G   AL G +   K    +  ++ +      G     G D      +   + 
Sbjct: 9   AIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQGITDLTGLGGAAGGDWDMLIGNGRVKA 68

Query: 76  -ELGYLFQNFGLIENQSIEENLKLGLIG---QKLSRSEQRLRQKQALEQVGLAYLDLDKR 131
               Y   +     ++   +  + G +                           L     
Sbjct: 69  YINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPVTLMQGSG 128

Query: 132 IFE----LSGGESQRVALAKIILKNPP-FILADEPTASIDPATSQLIMEILLSLRDDNRL 186
           + +              +     K         E   ++      + +        D  +
Sbjct: 129 LTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTV 188

Query: 187 IIIATHN 193
            I     
Sbjct: 189 RIWGGKF 195


>1s9hA [c.37.1.20] REP 40 PROTEIN
          Length = 268

 Score = 71.2 bits (173), Expect = 1e-15
 Identities = 17/193 (8%), Positives = 51/193 (26%), Gaps = 8/193 (4%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR 60
           ++EL      +         +  F       L G + +GKT +   I    P+ G + + 
Sbjct: 79  ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWT 138

Query: 61  GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ 120
            ++      +D     + +  +     +     + +  G           +  +  A   
Sbjct: 139 NENF---PFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSK-----VRVDQKCKSSAQID 190

Query: 121 VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL 180
                +  +  +  +  G S      + +                    ++  ++     
Sbjct: 191 PTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRW 250

Query: 181 RDDNRLIIIATHN 193
             D+ + +     
Sbjct: 251 AKDHVVEVEHEFY 263


>1t3wA [a.236.1.1] DNA PRIMASE
          Length = 134

 Score = 71.1 bits (173), Expect = 1e-15
 Identities = 19/145 (13%), Positives = 38/145 (26%), Gaps = 15/145 (10%)

Query: 40  KTTLMNMIGKLEPYD---GTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENL 96
           K T   ++  L   +    T+    ++L   K           L          +  + L
Sbjct: 1   KRTTXRILIGLLVQNPELATLVPPLENLDENKLPGLGLF--RELVNTCLSQPGLTTGQLL 58

Query: 97  KLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFI 156
           +         R        + L          DK I E +  +S       ++      +
Sbjct: 59  EHY-------RGTNNAATLEKLSXWDD---IADKNIAEQTFTDSLNHXFDSLLELRQEEL 108

Query: 157 LADEPTASIDPATSQLIMEILLSLR 181
           +A E T  +       +  +   L 
Sbjct: 109 IARERTHGLSNEERLELWTLNQELA 133


>1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
          Length = 178

 Score = 70.3 bits (171), Expect = 2e-15
 Identities = 16/137 (11%), Positives = 36/137 (26%), Gaps = 8/137 (5%)

Query: 1   MIELKQVSKSFGERE--LFSNLSMTFEAGKVYALIGSSGSGKTTLMN-MIGKLEPYDGTI 57
           +I+   +       E                 AL+ + G G+ + MN + G    +   +
Sbjct: 36  VIDSPDICWVGCANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVL 95

Query: 58  FYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQK-- 115
              G               L +   +        + E + +         +   + +   
Sbjct: 96  HIVGAPGTAA---QQRGELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEIDRVLT 152

Query: 116 QALEQVGLAYLDLDKRI 132
             L +    YL L   +
Sbjct: 153 TMLRERRPGYLMLPADV 169


>1vplA [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 70.1 bits (170), Expect = 2e-15
 Identities = 38/208 (18%), Positives = 86/208 (41%), Gaps = 3/208 (1%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRG 61
           + +K + K  G++E+   +S   E G+++ LIG +G+GKTT + +I  L      I    
Sbjct: 3   VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVF 62

Query: 62  KDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQV 121
                 +  +  +                         + G   S S +     +   ++
Sbjct: 63  GKNVVEEPHEVRKL--ISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEI 120

Query: 122 GLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLR 181
                 +  R+   S G  +++ +A+ ++ NP   + DEPT+ +D   ++ + +IL    
Sbjct: 121 AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQAS 180

Query: 182 DDNRLIIIATHN-PAIWEMADEVFTMDH 208
            +   I++++HN   +  + D +  + +
Sbjct: 181 QEGLTILVSSHNMLEVEFLCDRIALIHN 208


>1fl9A [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
          Length = 157

 Score = 70.0 bits (170), Expect = 2e-15
 Identities = 24/151 (15%), Positives = 44/151 (29%), Gaps = 9/151 (5%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYR 60
           I  +     FG++     L +  E   +  L G  G+GKTTL   +   +          
Sbjct: 8   IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPT 67

Query: 61  GKDLANYKSSDF-FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
              +  Y  +     H   Y   +   +E   I +          +   E   + +  L 
Sbjct: 68  YTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDY----FNTDSICLIEWSEKGQGILP 123

Query: 120 QVGL---AYLDLDKRIFELSGGESQRVALAK 147
           +  +        D R  EL    +    +  
Sbjct: 124 EADILVNIDYYDDARNIELIAQTNLGKNIIS 154


>1g6oA [c.37.1.11] CAG-ALPHA
          Length = 323

 Score = 69.8 bits (169), Expect = 3e-15
 Identities = 25/187 (13%), Positives = 45/187 (24%), Gaps = 10/187 (5%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
             E    +    + +  S +      GK   + G +GSGKTT +  I   +   +  I  
Sbjct: 140 FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISI 199

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
              +   +            LF    +     ++  L+       L              
Sbjct: 200 EDTEEIVF----KHHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNV 255

Query: 120 QVGLAYLDLDKRIFELSGGESQRVA---LAKIILKNPPFIL-ADEPTASIDPATSQLIME 175
                   L       S     R+A    +    +N  F    +     ID     +   
Sbjct: 256 LCSGHKGTLTTLHAGSSEEAFIRLANXSSSNSAARNIKFESLIEGFKDLID-XIVHINHH 314

Query: 176 ILLSLRD 182
                  
Sbjct: 315 KQCDEFY 321



 Score = 34.7 bits (78), Expect = 1e-04
 Identities = 4/44 (9%), Positives = 12/44 (27%)

Query: 156 ILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEM 199
              D+    ++ A  +  +  L    ++     +   N      
Sbjct: 2   SAEDKKFLEVERALKEAALNPLRHATEELFGDFLKXENITEICY 45


>1n25A [c.37.1.20] LARGE T ANTIGEN
          Length = 362

 Score = 69.4 bits (168), Expect = 4e-15
 Identities = 20/201 (9%), Positives = 56/201 (27%), Gaps = 11/201 (5%)

Query: 20  LSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRG---------KDLANYKSS 70
           +       + +   G   SGKTTL   + +L                      +  +   
Sbjct: 147 MVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVV 206

Query: 71  DFFRHELGYLFQNFGLIENQSIEENL-KLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLD 129
                  G   ++    +  +  +NL        K++  ++ L ++  +   G+  ++  
Sbjct: 207 FEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEY 266

Query: 130 KRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATS-QLIMEILLSLRDDNRLII 188
                L     +++              ++         +   L++ ++           
Sbjct: 267 SVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQS 326

Query: 189 IATHNPAIWEMADEVFTMDHL 209
           I +      E  D+ F++   
Sbjct: 327 IQSRIVEWKERLDKEFSLSVY 347


>1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
          Length = 173

 Score = 69.2 bits (168), Expect = 4e-15
 Identities = 12/174 (6%), Positives = 40/174 (22%), Gaps = 25/174 (14%)

Query: 44  MNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIG 102
           M  +    EP    +   G                   ++ F  ++  +      +  + 
Sbjct: 1   MRGMLPLFEPKGRVLLVDGH---------------HLAYRTFHALKGLTTSRGEPVQAVY 45

Query: 103 -----QKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPP-FI 156
                   +  E         +    ++   +      +G         + +        
Sbjct: 46  GFAKSLLKALKEDGDAVIVVFDAKAPSF-RHEAYGGYKAGRAPTPEDFPRQLALIKELVD 104

Query: 157 LADEPTASIDPATSQLIMEILLSL-RDDNRLIIIATHNPA-IWEMADEVFTMDH 208
           L       +    +  ++  L      +   + I T +      ++D +  +  
Sbjct: 105 LLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHP 158


>1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
          Length = 181

 Score = 69.1 bits (168), Expect = 4e-15
 Identities = 21/179 (11%), Positives = 52/179 (29%), Gaps = 20/179 (11%)

Query: 25  EAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNF 84
              K  A++G   SGK+ L+N +  +        Y  + +      D    +     Q  
Sbjct: 5   FFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXA 64

Query: 85  GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVA 144
                                   +  +R    +  +   ++   +       G++    
Sbjct: 65  -----------------LGHQRYIDYAVRHSHKIAFIDTDFI-TTQAFCIQYEGKAHPFL 106

Query: 145 LAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEV 203
            + I        +  +     +    Q   ++L  L D  ++  I   +P+  +  ++V
Sbjct: 107 DSXIKEYPFDVTILLKNN--TEQKQRQQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQV 163


>3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
          Length = 149

 Score = 68.8 bits (167), Expect = 6e-15
 Identities = 13/110 (11%), Positives = 25/110 (22%), Gaps = 4/110 (3%)

Query: 102 GQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEP 161
             K       +         G       +            V  ++I    P  I+ +E 
Sbjct: 1   ASKTKAGVSLILGDNVKAARGRFSW-RQRFSKFTIKAAKADVTDSEIGRYRPLIIVNEEV 59

Query: 162 TASIDPATSQLIMEILLSLRDDNRLI---IIATHNPAIWEMADEVFTMDH 208
           TA       Q   +  +   +                +W +   V  +D 
Sbjct: 60  TAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVPVIDE 109


>2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
          Length = 359

 Score = 68.3 bits (165), Expect = 8e-15
 Identities = 13/201 (6%), Positives = 36/201 (17%), Gaps = 24/201 (11%)

Query: 22  MTFEAGKVYALIGSSGSGKTTLMNMIGKLE-PYDG---------TIFYRGKDLANYKSSD 71
              +A               T  +       P            TI              
Sbjct: 148 EVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQR------K 201

Query: 72  FFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKR 131
             +  +          +   ++                 +           +    LD +
Sbjct: 202 VIKAMVTAHPYEEVAYDVYPLDNKG---ETLGLGKIGYLQEEMTLGQFAEHV-KQSLDVK 257

Query: 132 IFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL-RDDNRLIIIA 190
              + G    +V    ++  +    +        D   +  +   +          I+  
Sbjct: 258 GARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDP 317

Query: 191 THNP---AIWEMADEVFTMDH 208
            HN        +  ++     
Sbjct: 318 GHNVEKVMKQGVQKQLQEKVD 338


>1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
          Length = 221

 Score = 67.4 bits (163), Expect = 1e-14
 Identities = 13/138 (9%), Positives = 35/138 (25%), Gaps = 12/138 (8%)

Query: 73  FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRI 132
           +  +   L  ++     +        G+       ++       A E V +     +   
Sbjct: 2   YSMDANLLHISYEGGVLEDPWAEPPKGM----FRMTQDPEEAPDAPEYVEVE--FFEGDP 55

Query: 133 FELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNR--LIIIA 190
             ++G      AL     +    I        +D   ++ +      + +     ++  A
Sbjct: 56  VAVNGERLSPAALL----QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHA 111

Query: 191 THNPAIWEMADEVFTMDH 208
                   +  EV     
Sbjct: 112 RRAVESLTLDREVLHQRD 129


>1mi8A [b.86.1.2] DNAB INTEIN
          Length = 141

 Score = 65.7 bits (159), Expect = 5e-14
 Identities = 8/119 (6%), Positives = 26/119 (21%), Gaps = 2/119 (1%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
            + +K +           N           + +  +G     ++    G+         +
Sbjct: 18  RVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATANHRF 77

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQAL 118
              D    +  +    E   L +   +  +  +            L+           +
Sbjct: 78  LTID-GWKRLDELSLKEHIALPRKSDISWDSIVSITETGVEEVFDLTVPGPHNFVANDI 135


>1ffhA2 [c.37.1.10] FFH A:89 -- 295
          Length = 200

 Score = 65.4 bits (158), Expect = 6e-14
 Identities = 22/201 (10%), Positives = 49/201 (24%), Gaps = 33/201 (16%)

Query: 19  NLSMTFEAGKVYALIGSSGSGKTTLMNMIGK-LEPYDGTIFYRGKDLANYKSSD-----F 72
                 +   ++ L+G  GSGKTT    +    +           D     + +      
Sbjct: 2   ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLG 61

Query: 73  FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRI 132
            +  +  L    G           +   +  +                        D  +
Sbjct: 62  EKVGVPVLEVMDGESPESIRRRVEEKARLEAR------------------------DLIL 97

Query: 133 FELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDD-NRLIIIAT 191
            + +G       L   + +    +  DE    +D  T Q  + +  +  +      ++ T
Sbjct: 98  VDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLT 157

Query: 192 HNP--AIWEMADEVFTMDHLK 210
                A    A     +    
Sbjct: 158 KLDGDARGGAALSARHVTGKP 178


>2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
          Length = 392

 Score = 65.3 bits (158), Expect = 6e-14
 Identities = 9/102 (8%), Positives = 27/102 (26%), Gaps = 5/102 (4%)

Query: 108 SEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDP 167
           S Q   QK  ++ +       +           + +   K  + N  ++   E T     
Sbjct: 1   SGQS-VQKNIVKSIQS---QANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSE 56

Query: 168 ATSQLIMEILLSLRDDNRLIIIATHN-PAIWEMADEVFTMDH 208
             +     +   + +          +     ++ + + T   
Sbjct: 57  IFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKG 98


>1cd5A [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
          Length = 266

 Score = 65.1 bits (157), Expect = 7e-14
 Identities = 18/205 (8%), Positives = 45/205 (21%), Gaps = 22/205 (10%)

Query: 2   IELKQVSKSFG-ERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFY 59
           +  K V      E               ++             +N++ G     D     
Sbjct: 61  VSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ 120

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
             + + +Y     F   +G            S+    ++  +      +  R       +
Sbjct: 121 YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQ 180

Query: 120 QVGLAYLDLDKRIF--------------------ELSGGESQRVALAKIILKNPPFILAD 159
               A       +                      + G  +    ++ + L     ++ D
Sbjct: 181 VPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD 240

Query: 160 EPTASIDPATSQLIMEILLSLRDDN 184
           EP+       +      L +     
Sbjct: 241 EPSTMELKVKTLRYFNELEAENIKG 265


>1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
          Length = 171

 Score = 65.0 bits (158), Expect = 8e-14
 Identities = 16/136 (11%), Positives = 43/136 (31%), Gaps = 9/136 (6%)

Query: 78  GYLFQNFGLIEN--QSIEENLKLGL--IGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIF 133
             +  +          +  NL +    + Q    ++  ++ +   E      ++   +I 
Sbjct: 16  AEIDHHKPTAGAMLGHVLSNLFIENIRLTQAGIYAKSPVKCEYLREIAQRE-VEYFFKIS 74

Query: 134 ELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLI---IIA 190
           +L   E++ V             + ++P A        L+   ++  +  N  I   I  
Sbjct: 75  DLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTD-EDLLESFIVDFQAQNMFITRAIKL 133

Query: 191 THNPAIWEMADEVFTM 206
            +    + +A  V  +
Sbjct: 134 ANKEEKFALAAGVVEL 149


>1udwA [c.37.1.6] URIDINE-CYTIDINE KINASE 2
          Length = 204

 Score = 64.8 bits (156), Expect = 9e-14
 Identities = 20/186 (10%), Positives = 49/186 (26%), Gaps = 13/186 (6%)

Query: 27  GKVYALIGSSGSGKTTL-MNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFG 85
             +  + G + SGK+++   ++  L+     +                  +  + F +  
Sbjct: 2   PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPD 61

Query: 86  LIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVAL 145
             +N+ I + LK    G+ +                        +    +   +      
Sbjct: 62  AFDNELILKTLKEITEGKTVQIPVYDFVSHSR-----------KEETVTVYPADVVLFEG 110

Query: 146 AKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNP-AIWEMADEVF 204
                      L          A ++L   +L  + +  R +           + A E F
Sbjct: 111 ILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEF 170

Query: 205 TMDHLK 210
            +   K
Sbjct: 171 CLPTKK 176


>1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
          Length = 118

 Score = 64.5 bits (156), Expect = 1e-13
 Identities = 14/120 (11%), Positives = 33/120 (27%), Gaps = 5/120 (4%)

Query: 18  SNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHEL 77
           +++    +A  +  L+  S      L      +   DG I   G +          ++ L
Sbjct: 2   ASVITEIKAEDLQQLLRVS----RGLQIDTIAITNKDGKIVINGYNKVEDSGLTRPKYSL 57

Query: 78  GYLFQNF-GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELS 136
                +            N+K+     K+       +     E   ++Y+   +      
Sbjct: 58  TLTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEADSTHD 117


>1d6jA [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 177

 Score = 64.3 bits (155), Expect = 1e-13
 Identities = 19/183 (10%), Positives = 38/183 (20%), Gaps = 15/183 (8%)

Query: 11  FGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS 70
                      +  + G    L G S SGK+TL   +            R          
Sbjct: 2   ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVR-----DRRVHAYRLDGD 56

Query: 71  DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDK 130
           +        L  +                L     S +                     +
Sbjct: 57  NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYR-----KDRDTARQ 111

Query: 131 RIFELSGGESQRVALAKIILKNPPFILADEPTA-----SIDPATSQLIMEILLSLRDDNR 185
                + GE   +   ++ +  P     + P              Q  ++ ++   D   
Sbjct: 112 LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKG 171

Query: 186 LII 188
            + 
Sbjct: 172 YLP 174


>1jbkA [c.37.1.20] CLPB PROTEIN
          Length = 189

 Score = 63.6 bits (153), Expect = 2e-13
 Identities = 21/177 (11%), Positives = 44/177 (24%), Gaps = 8/177 (4%)

Query: 2   IELKQVS--KSFGERELFSNLSMTFE--AGKVYALIGSSGSGKTTLMNMIGKLEPYDGTI 57
              +Q       G  E         +        LIG  G GKT ++  + +        
Sbjct: 14  ERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVP 73

Query: 58  FYR-GKDLANYKSSDFFR--HELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQ 114
               G+ +               G   +    + N   ++   + L   +L      +  
Sbjct: 74  EGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDA 133

Query: 115 KQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQ 171
              L+       +L            Q +     + +    +   EP+     A  +
Sbjct: 134 GNMLKPALARG-ELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAILR 189


>1w1wA [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
          Length = 274

 Score = 62.8 bits (152), Expect = 4e-13
 Identities = 45/244 (18%), Positives = 76/244 (31%), Gaps = 56/244 (22%)

Query: 9   KSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLA--- 65
           KS+            F      ++IG +GSGK+ +M+ I  +      + YRG   A   
Sbjct: 12  KSYRGVTKVG-----FGESNFTSIIGPNGSGKSNMMDAISFVLGVLKDLIYRGPQSAYVK 66

Query: 66  ------------------NYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSR 107
                             N  +S     +          +EN++I    K  L+ Q    
Sbjct: 67  AFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVE 126

Query: 108 SEQRLRQKQALEQVGLAYLDLD--------------------------KRIFELSGGESQ 141
                   +        Y+                             K +  LSGGE  
Sbjct: 127 QIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNASLTKYHATPPLKRFKDMEYLSGGEKT 186

Query: 142 RVALAKII----LKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIW 197
             ALA +      +  PF + DE  A++D    Q I   +   R+ +   I+ +    ++
Sbjct: 187 VAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMF 246

Query: 198 EMAD 201
           E +D
Sbjct: 247 EKSD 250


>2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
          Length = 121

 Score = 62.6 bits (151), Expect = 4e-13
 Identities = 13/118 (11%), Positives = 33/118 (27%), Gaps = 9/118 (7%)

Query: 73  FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRI 132
                    +   ++  ++  + LK   + Q     +Q    +    ++G        ++
Sbjct: 10  IGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNY-TITKV 68

Query: 133 FELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL-RDDNRLIII 189
              +    Q +A + +I         D PT   D   + + +             I  
Sbjct: 69  GSFANSNLQSIAHSTLIFA-------DAPTDEDDVIRNGVYLTPHQLPKITIGTTIDY 119


>1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
          Length = 223

 Score = 62.3 bits (150), Expect = 5e-13
 Identities = 15/194 (7%), Positives = 38/194 (19%), Gaps = 11/194 (5%)

Query: 2   IELKQVS----KSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEP-YDGT 56
           I + +      +        +N        +   + G +  GK+T       +       
Sbjct: 12  IRITEGRHPVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIG 71

Query: 57  IFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQ 116
            +   + +        F    G+  +               L L  +    +        
Sbjct: 72  SYVPAQKVEIGPIDRIFTRV-GFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSL 130

Query: 117 ALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEI 176
           A          +       +          K        +      A     T      +
Sbjct: 131 AWACAENLANKIKALTLFATHYFELTQLPEK-----XEGVANVHLDALEHGDTIAFXHSV 185

Query: 177 LLSLRDDNRLIIIA 190
                  +  + +A
Sbjct: 186 QDGAASKSYGLAVA 199


>2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
          Length = 84

 Score = 61.8 bits (150), Expect = 7e-13
 Identities = 17/87 (19%), Positives = 24/87 (27%), Gaps = 11/87 (12%)

Query: 108 SEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDP 167
           SE   +  Q    +        +    LS    Q V +    L        DEP A I  
Sbjct: 1   SEHVGKTCQIDVLIEEHDE-RTRAKARLSWAGRQXVGVGLARLDPA-----DEPVAQIGD 54

Query: 168 ATSQLIMEILLSLRDDNRLIIIATHNP 194
                   I  +L D    +   T + 
Sbjct: 55  EL-----AIARALSDLANQLFALTSSD 76


>1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
           233
          Length = 190

 Score = 61.4 bits (147), Expect = 1e-12
 Identities = 19/182 (10%), Positives = 42/182 (23%), Gaps = 5/182 (2%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
           G    L+G  G+GK T    + K                    S+  +     +     +
Sbjct: 3   GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV 62

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLD---KRIFELSGGESQRV 143
            +   +E   K        +        +   +   L  L      K    +       +
Sbjct: 63  SDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSL 122

Query: 144 ALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNR-LIIIATHNPA-IWEMAD 201
            + +I  +        +       A       ++           I A+  P  ++    
Sbjct: 123 LIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASIL 182

Query: 202 EV 203
             
Sbjct: 183 AA 184


>1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
          Length = 132

 Score = 60.7 bits (146), Expect = 2e-12
 Identities = 10/102 (9%), Positives = 27/102 (26%), Gaps = 5/102 (4%)

Query: 110 QRLRQK--QALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDP 167
           +RL        +     +  L K +  ++ G +   AL +   +     +       +  
Sbjct: 3   ERLGYLGFAVKDVPAWDHF-LTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAY 61

Query: 168 ATSQLIMEIL--LSLRDDNRLIIIATHNPAIWEMADEVFTMD 207
           A  ++              +  +  T          +V  + 
Sbjct: 62  AGLEVDDAAALERMADKLRQAGVAFTRGDEALMQQRKVMGLL 103


>1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
          Length = 187

 Score = 60.5 bits (145), Expect = 2e-12
 Identities = 17/183 (9%), Positives = 42/183 (22%), Gaps = 32/183 (17%)

Query: 18  SNLSMTFEAGKVYALIGSSGSGKTT-LMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHE 76
              ++  + G  Y+ +G    GK   + N  G         F   + L    + +     
Sbjct: 2   KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 61

Query: 77  L-----------------GYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQ--------- 110
                               +  +        + +  +  +  +    ++          
Sbjct: 62  PTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSM 121

Query: 111 ----RLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASID 166
                    +A     +            +  + Q    A  I       + +EPTA+  
Sbjct: 122 VLTKMKEIAEAYLGKTVTNAV-VTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI 180

Query: 167 PAT 169
              
Sbjct: 181 AYG 183


>1np6A [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
          Length = 158

 Score = 60.5 bits (145), Expect = 2e-12
 Identities = 24/169 (14%), Positives = 44/169 (26%), Gaps = 19/169 (11%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
             + A    SG+GKTTL+  +       G      K   +          +    Q + L
Sbjct: 2   IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWAL 61

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALA 146
           +     EE L L  +  ++                          +      E  ++ L 
Sbjct: 62  MTETPDEEELDLQFLASRMDT-----------------SKLDLILVEGFKHEEIAKIVLF 104

Query: 147 KIILKNPPFILADEPTASIDP-ATSQLIMEILLSLRDDNRL-IIIATHN 193
           +    + P  L  +             +   LL + D   L   +    
Sbjct: 105 RDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWM 153


>3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
          Length = 179

 Score = 60.2 bits (144), Expect = 2e-12
 Identities = 14/174 (8%), Positives = 39/174 (22%), Gaps = 8/174 (4%)

Query: 2   IELKQVS----KSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTI 57
           ++            G        S  F+    Y  +G+    K  +  +           
Sbjct: 6   LKAGGKIYQGWTKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIG 65

Query: 58  FYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQA 117
             R            +      +  +        ++ ++             Q       
Sbjct: 66  GERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCK 125

Query: 118 LE---QVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPA 168
                 +    +    +  ++  GE+    LA  + K    +L  +   ++   
Sbjct: 126 PFGIKVIVNTDVGEPFQRIQIEQGETPHELLA-RLAKQRGVLLTSDTFGNLVIT 178


>1viaA [c.37.1.2] SHIKIMATE KINASE
          Length = 161

 Score = 60.0 bits (144), Expect = 2e-12
 Identities = 26/161 (16%), Positives = 50/161 (31%), Gaps = 12/161 (7%)

Query: 28  KVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDF--FRHELGYLFQNF 84
           K    IG  GSGK+TL   +   L+       +  +   N K S+    + E  +  Q  
Sbjct: 1   KNIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQEQ 60

Query: 85  GLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDL--------DKRIFELS 136
              +  S  E   +   G  ++ S           +    YL           + +F   
Sbjct: 61  KXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRLDKDEISKRPLFYDE 120

Query: 137 GGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEIL 177
               +         +     + +    +ID   S+ I +++
Sbjct: 121 IKAKKLYNERLSKYEQKANFILNIENKNIDELLSE-IKKVI 160


>1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
          Length = 124

 Score = 59.8 bits (144), Expect = 3e-12
 Identities = 13/83 (15%), Positives = 22/83 (26%), Gaps = 2/83 (2%)

Query: 128 LDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLI 187
           L      L   E     + +    N  F L  EP A +         ++L +    +   
Sbjct: 6   LQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPT 65

Query: 188 IIATHNPAIWEMADEVFTMDHLK 210
            + T+              D L 
Sbjct: 66  TVVTYL--FKLTHQVSSCYDVLW 86


>1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
           875 E:885 -- 1007
          Length = 470

 Score = 59.8 bits (144), Expect = 3e-12
 Identities = 2/74 (2%), Positives = 18/74 (24%), Gaps = 1/74 (1%)

Query: 135 LSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNP 194
            +    +   + ++ +    +++ D     +      +       L     +  +   + 
Sbjct: 28  YNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAV-GFSI 86

Query: 195 AIWEMADEVFTMDH 208
                      + +
Sbjct: 87  YSVSQMPRDLVIQN 100


>2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
          Length = 124

 Score = 59.3 bits (143), Expect = 4e-12
 Identities = 6/94 (6%), Positives = 14/94 (14%), Gaps = 7/94 (7%)

Query: 2   IELKQVSKSFGERE----LFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTI 57
                  KSF           +  +      V                ++  L+      
Sbjct: 30  TITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGY 89

Query: 58  FYRGKDLANYKSSD---FFRHELGYLFQNFGLIE 88
                                   ++  +F    
Sbjct: 90  GVICDFNLGDDDHADCKIVVPSSLFVCAHFNAQR 123


>2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
          Length = 104

 Score = 58.3 bits (141), Expect = 8e-12
 Identities = 13/90 (14%), Positives = 36/90 (40%), Gaps = 5/90 (5%)

Query: 113 RQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQL 172
           ++   +++     L L+K   +   GE + V  A         +L D+   S + A  + 
Sbjct: 2   KEIMVMDEF---LLHLNKDDDKAWYGE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREE 57

Query: 173 IMEILLSLRDDNRLIIIATHNPA-IWEMAD 201
            ++++ S+  +    ++ +   +   E+  
Sbjct: 58  YLKLMDSVESNGGKALVLSTLHSLGEELDQ 87


>1g6hA [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score = 58.3 bits (139), Expect = 8e-12
 Identities = 51/222 (22%), Positives = 105/222 (47%), Gaps = 14/222 (6%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGK-TTLMNMIGKLEPYDGTIFY 59
           ++  + + K FGE +    +S++   G V  +IG +GSGK T +  + G L+  +G +++
Sbjct: 4   ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYF 63

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLG----------LIGQKLSRSE 109
             KD+ N + ++ + + +   FQ    ++  ++ ENL +G           +  K    +
Sbjct: 64  ENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPK 123

Query: 110 QRLRQKQALEQVGLAYLD--LDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDP 167
           +    ++A + +    L    D++  ELSGG+ + V + + ++ NP  I+ DEP A + P
Sbjct: 124 EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 168 ATSQLIMEILLSLRDDNR-LIIIATHNPAIWEMADEVFTMDH 208
             +  I   +L L+      +II      +    D ++ M +
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN 225


>1gm5A1 [a.24.21.1] RECG A:7 -- 105
          Length = 99

 Score = 57.8 bits (139), Expect = 1e-11
 Identities = 9/97 (9%), Positives = 22/97 (22%), Gaps = 7/97 (7%)

Query: 84  FGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRV 143
             L         L    + +     + ++  ++  + +     D      +L       +
Sbjct: 3   SSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKE-LDDPLLENKDLEEKLQAFL 61

Query: 144 ALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL 180
                           E         S  ++E L S 
Sbjct: 62  DYV------KEIPNLPEARKRYRIQKSLEMIEKLRSW 92


>1l7lA [b.18.1.16] PA-I GALACTOPHILIC LECTIN
          Length = 121

 Score = 57.2 bits (137), Expect = 2e-11
 Identities = 20/129 (15%), Positives = 30/129 (23%), Gaps = 15/129 (11%)

Query: 19  NLSMTFEAGKVYALIGSSGSGKTT-LMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHEL 77
            +    EAG+V ++I + G   T                     +               
Sbjct: 5   EVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGL--ICHDAFC 62

Query: 78  GYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSG 137
           G L    G     S    +  GL       + Q            L Y D+       SG
Sbjct: 63  GALVMKIGN----SGTIPVNTGLFRWVAPNNVQGAIT--------LIYNDVPGTYGNNSG 110

Query: 138 GESQRVALA 146
             S  +   
Sbjct: 111 SFSVNIGKD 119


>2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
          Length = 133

 Score = 56.3 bits (136), Expect = 3e-11
 Identities = 8/60 (13%), Positives = 19/60 (31%), Gaps = 5/60 (8%)

Query: 35  SSGSGKTTLMNMIGKLE-PYDG----TIFYRGKDLANYKSSDFFRHELGYLFQNFGLIEN 89
               G      +   L+    G     +     +  + K +     E+ + F++F + E 
Sbjct: 73  YVKKGSDPYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLDEEEVPFTFEDFDVPEK 132


>1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
          Length = 213

 Score = 55.4 bits (132), Expect = 6e-11
 Identities = 10/96 (10%), Positives = 26/96 (27%), Gaps = 4/96 (4%)

Query: 1   MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR 60
                +        E   N ++     +   L  +S +    + ++  +     G +F  
Sbjct: 120 SGIKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEYAIPVGPVFPP 179

Query: 61  GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENL 96
           G +  +  ++               +    SI   L
Sbjct: 180 GMNWTDLITN---YSPSREDNLQR-VFTVASIRSML 211


>1mm8A [c.55.3.4] TN5 TRANSPOSASE
          Length = 455

 Score = 54.9 bits (130), Expect = 9e-11
 Identities = 21/137 (15%), Positives = 43/137 (31%), Gaps = 16/137 (11%)

Query: 80  LFQNFGLIENQ----SIEENLKLGLI---GQKLSRSEQRLRQKQALEQVGLAYLDLDKRI 132
           +F +  L + +     +    +L         +S    +  Q+ A   +    +  +   
Sbjct: 12  VFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEA-- 69

Query: 133 FELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATH 192
                G  Q V LA+      P +LA E T S+     Q+  E+       ++      H
Sbjct: 70  -IRKAGAMQTVKLAQE----FPELLAIEDTTSL-SYRHQVAEELGKLGSIQDKSRGWWVH 123

Query: 193 NP-AIWEMADEVFTMDH 208
           +   +         + H
Sbjct: 124 SVLLLEATTFRTVGLLH 140


>2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
          Length = 95

 Score = 54.2 bits (130), Expect = 1e-10
 Identities = 7/55 (12%), Positives = 21/55 (38%), Gaps = 4/55 (7%)

Query: 1  MIELKQVSKSFGERELFSNLS----MTFEAGKVYALIGSSGSGKTTLMNMIGKLE 51
           I  ++ ++   +R + S  S      +  G     +G+  S +     ++ + +
Sbjct: 36 RIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHD 90


>1ckvA [d.137.1.1] PROTEIN (PROTEIN B)
          Length = 141

 Score = 53.3 bits (127), Expect = 3e-10
 Identities = 13/138 (9%), Positives = 29/138 (21%), Gaps = 19/138 (13%)

Query: 2   IELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYR 60
             +  +       + F++ +          L+        T +  I       +      
Sbjct: 10  AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVN 69

Query: 61  GKDLANYKSSDF----------FRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQ 110
            +D A Y                   LG  F  +  + + S            +      
Sbjct: 70  VEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIG--------RAYTLGN 121

Query: 111 RLRQKQALEQVGLAYLDL 128
           +      L  +     D 
Sbjct: 122 KFTITSELMGLDRKLEDY 139


>1g8yA [c.37.1.11] REGULATORY PROTEIN REPA
          Length = 242

 Score = 53.2 bits (126), Expect = 3e-10
 Identities = 23/210 (10%), Positives = 51/210 (24%), Gaps = 19/210 (9%)

Query: 2   IELKQVSKSF-GERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR 60
            +   + ++F         +     AG V AL+   G+GK+ L   +         +   
Sbjct: 3   HKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEV 62

Query: 61  GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ 120
           G+                 +      +      E               ++      L Q
Sbjct: 63  GELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEE--------------RQAVADGLLIQ 108

Query: 121 VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL 180
             +     +    E   G  +     ++++ +       E   +  P     I  +    
Sbjct: 109 PLIGS-LPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQV-IGRMEAIA 166

Query: 181 RDDNRLIIIATHNP--AIWEMADEVFTMDH 208
            D    I+   H            + +M  
Sbjct: 167 ADTGCSIVFLHHAVLVDNIRWQSYLSSMTS 196


>1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
          Length = 212

 Score = 52.1 bits (123), Expect = 6e-10
 Identities = 15/88 (17%), Positives = 24/88 (27%), Gaps = 9/88 (10%)

Query: 55  GTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQ 114
           G +       ++ + +D    ELGY F +     +                   E +   
Sbjct: 130 GGLVADTPGFSSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLK--------EPKCAV 181

Query: 115 KQALEQVGLAYLDLDKRIFELSGGESQR 142
           KQA+E   L          E       R
Sbjct: 182 KQAVEDGELKQY-RYDHYVEFMTEIKDR 208


>1bccF [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
          Length = 100

 Score = 52.1 bits (124), Expect = 6e-10
 Identities = 9/84 (10%), Positives = 27/84 (32%), Gaps = 4/84 (4%)

Query: 74  RHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIF 133
            +     F  +GL+ + +I EN  +    ++L  +    R  +    + L      ++  
Sbjct: 10  WYYNAAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLN----MRQQI 65

Query: 134 ELSGGESQRVALAKIILKNPPFIL 157
                 ++       +      ++
Sbjct: 66  LPKEQWTKYEEDVPYLEPYLKEVI 89


>1vhhA [d.65.1.2] SONIC HEDGEHOG
          Length = 157

 Score = 51.9 bits (123), Expect = 7e-10
 Identities = 16/111 (14%), Positives = 26/111 (23%), Gaps = 12/111 (10%)

Query: 104 KLSRSEQRLRQKQALEQ-VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPT 162
           KL+    +       E+ +G                E  +         NP  I  DE  
Sbjct: 1   KLTPLAYKQFIPNVAEKTLGA---SGRYEGKITRNSERFK---ELTPNYNPDIIFKDEEN 54

Query: 163 ASIDPATSQLIMEILLSL-----RDDNRLIIIATHNPAIWEMADEVFTMDH 208
              D   +Q   + L +L          + +  T          E      
Sbjct: 55  TGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYE 105


>1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
          Length = 132

 Score = 51.7 bits (123), Expect = 8e-10
 Identities = 3/74 (4%), Positives = 14/74 (18%), Gaps = 7/74 (9%)

Query: 141 QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILL---SLRDDNRLIIIATHNP--- 194
             + + +    +   +        +    ++     +     L       I         
Sbjct: 3   PALEIGEDERLDLENLA-TGAFFPVKGFMTREEALSVAHEMRLPTGEVWTIPILLQFREK 61

Query: 195 AIWEMADEVFTMDH 208
                 + V  +  
Sbjct: 62  PRVGPGNTVALLHG 75


>2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
           136
          Length = 135

 Score = 51.2 bits (122), Expect = 1e-09
 Identities = 7/100 (7%), Positives = 26/100 (26%), Gaps = 3/100 (3%)

Query: 110 QRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPAT 169
           +R+      +          K++ ++    +    +          I  D P   +    
Sbjct: 31  KRVYYIFDTKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYV-- 88

Query: 170 SQLIMEILLSLRDDNRLIIIATHNPA-IWEMADEVFTMDH 208
              +   +     D  ++++A+        +        +
Sbjct: 89  GPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKY 128


>2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
          Length = 152

 Score = 51.0 bits (120), Expect = 1e-09
 Identities = 20/150 (13%), Positives = 48/150 (32%), Gaps = 10/150 (6%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANY------KSSDFFRHELGYL 80
           G +Y +   SG+GK++L+  + K +P   T     + LA              +     +
Sbjct: 2   GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKM 61

Query: 81  FQNFGLIENQSIEENLKL-GLIGQKLSRSEQRLRQKQALEQVGLA---YLDLDKRIFELS 136
                +      +  L        + S      R  QA+ ++         +    F+ +
Sbjct: 62  PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA 121

Query: 137 GGESQRVALAKIILKNPPFILADEPTASID 166
             + + +  A+ +  +      D   + + 
Sbjct: 122 LTDLKTIIRAERLRMSRQKQRHDALISKLL 151


>1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
          Length = 296

 Score = 51.0 bits (121), Expect = 1e-09
 Identities = 16/146 (10%), Positives = 35/146 (23%), Gaps = 5/146 (3%)

Query: 19  NLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDG---TIFYRGKDLANYKSSDFFRH 75
                        ++G    GK+T    I K    +           + A     D    
Sbjct: 2   VQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKVAVPDERFD 61

Query: 76  ELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKR-IFE 134
            L   ++    +       ++  GL     +           +  V   Y  +      E
Sbjct: 62  WLCEAYKPKSRVPAFLTVFDI-AGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDDAE 120

Query: 135 LSGGESQRVALAKIILKNPPFILADE 160
           +   E     +  + +     ++ D 
Sbjct: 121 IIHVEGDVDPIRDLSIIVDELLIKDA 146


>1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
          Length = 369

 Score = 50.4 bits (118), Expect = 2e-09
 Identities = 19/149 (12%), Positives = 56/149 (37%), Gaps = 6/149 (4%)

Query: 66  NYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAY 125
              + +       Y         ++  E   ++     +   SE  +R ++   ++ + +
Sbjct: 210 KDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVW 269

Query: 126 LDLDK------RIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS 179
              ++          ++ G + R+A++  +      ++ DEPT  +D    + ++ I+  
Sbjct: 270 EGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMER 329

Query: 180 LRDDNRLIIIATHNPAIWEMADEVFTMDH 208
                  +I+ +H+  + + AD V  +  
Sbjct: 330 YLKKIPQVILVSHDEELKDAADHVIRISL 358



 Score = 33.8 bits (75), Expect = 2e-04
 Identities = 17/93 (18%), Positives = 32/93 (34%), Gaps = 1/93 (1%)

Query: 17  FSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHE 76
            S+  + F+ G    +IG +GSGK++L++ I     +   I    KD      +     +
Sbjct: 14  HSDTVVEFKEGINL-IIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYID 72

Query: 77  LGYLFQNFGLIENQSIEENLKLGLIGQKLSRSE 109
           L +          +   +    G I        
Sbjct: 73  LIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVG 105


>2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
          221
          Length = 61

 Score = 50.3 bits (120), Expect = 2e-09
 Identities = 9/58 (15%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 18 SNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRH 75
          + + +     KV  +IG + S   TL +        +G I+   +++           
Sbjct: 1  NGIVIDIMPVKVPRVIGKNKSMYETLTSKSI-FVANNGRIWAFSEEILIEAIRKIENE 57


>1d8jA [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
          Length = 81

 Score = 50.0 bits (119), Expect = 2e-09
 Identities = 11/81 (13%), Positives = 19/81 (23%), Gaps = 11/81 (13%)

Query: 99  GLIGQKLSRSEQRLRQKQALEQVGLAYLDL-------DKRIFELSGGESQRVALAK-IIL 150
           G  G K        +    ++                      L  G  Q+  L    ++
Sbjct: 4   GSSGYKFGVLA---KIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALV 60

Query: 151 KNPPFILADEPTASIDPATSQ 171
            NP   + D   A       +
Sbjct: 61  NNPKIEVIDGKYAFKPKYNVR 81


>1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
          Length = 377

 Score = 50.0 bits (119), Expect = 3e-09
 Identities = 16/188 (8%), Positives = 46/188 (24%), Gaps = 23/188 (12%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGK-DLANYKSSDFFRHELGY-----L 80
           GK   L  +    K  L+ +I                +   Y        +        L
Sbjct: 72  GKSLILAQTREEAKEKLIPVI---NKIKDVDLVIVFLEFLLYDFVKRELLKKXIPSQVIL 128

Query: 81  FQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES 140
            +       + +  N+   ++ +  +   +    +  ++        +   I  ++    
Sbjct: 129 NRTLKNENLKFVLLNVAEQVLAKTGNIPYKLKEIEGKVDAF------VGIDISRITRDGK 182

Query: 141 QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMA 200
              A+A   + N    L      S      +L  + +         +         ++  
Sbjct: 183 TVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAI-------GDVFSL-LEKLGFKKG 234

Query: 201 DEVFTMDH 208
            ++     
Sbjct: 235 SKIVVHRD 242


>1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
          Length = 122

 Score = 48.5 bits (115), Expect = 7e-09
 Identities = 10/124 (8%), Positives = 28/124 (22%), Gaps = 20/124 (16%)

Query: 2   IELKQV--SKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFY 59
             LKQ     +    E F  + +     ++     +    +   +            + Y
Sbjct: 17  DLLKQAFARAAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEILD----------VTY 66

Query: 60  RGKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALE 119
            G ++    +  +    L  L      +   +   +                      + 
Sbjct: 67  SGAEMEIGFNVSYVLDVLNALKCENVRM-MLTDSVSSVQI-------EDAASQSAAYVVM 118

Query: 120 QVGL 123
            + L
Sbjct: 119 PMRL 122


>1v37A [c.60.1.1] PHOSPHOGLYCERATE MUTASE
          Length = 171

 Score = 48.4 bits (114), Expect = 8e-09
 Identities = 7/82 (8%), Positives = 22/82 (26%), Gaps = 1/82 (1%)

Query: 129 DKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLS-LRDDNRLI 187
              + E+  G  +      +  +    +L  +        +     E +   L       
Sbjct: 69  YPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPA 128

Query: 188 IIATHNPAIWEMADEVFTMDHL 209
           ++ TH   +  +   +     +
Sbjct: 129 VLFTHGGVVRAVLRALGEDGLV 150


>1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
           -- 73
          Length = 69

 Score = 47.9 bits (114), Expect = 1e-08
 Identities = 6/52 (11%), Positives = 13/52 (25%), Gaps = 1/52 (1%)

Query: 74  RHELGYLFQNFGLIENQ-SIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLA 124
                 L  +  L +   +  E   +  I      +    R    L    ++
Sbjct: 13  VANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTIS 64


>1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
           522
          Length = 172

 Score = 47.9 bits (112), Expect = 1e-08
 Identities = 12/153 (7%), Positives = 27/153 (17%), Gaps = 4/153 (2%)

Query: 33  IGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLIENQSI 92
           +G  G+GK+T +        Y               SS       G          +   
Sbjct: 20  VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPS 79

Query: 93  EENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES---QRVALAKII 149
                       +              +    + +                 R       
Sbjct: 80  RARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXFSYRKQFEPPT 139

Query: 150 LKNPPFILADEPTASIDPATSQLIMEILLSLRD 182
           L      + + P    +      +  +     +
Sbjct: 140 LAEGFLEILEIPFRLQEHL-DPALQRLYRQFSE 171


>1afrA [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
          Length = 345

 Score = 47.5 bits (111), Expect = 1e-08
 Identities = 4/63 (6%), Positives = 16/63 (25%), Gaps = 1/63 (1%)

Query: 14 RELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDF 72
          RE+   ++ +    K+          +  ++  +    + +    F        +     
Sbjct: 4  REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQVR 63

Query: 73 FRH 75
             
Sbjct: 64 ELR 66



 Score = 37.5 bits (85), Expect = 1e-05
 Identities = 4/56 (7%), Positives = 10/56 (17%), Gaps = 5/56 (8%)

Query: 153 PPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
                A E            I        +             ++E+  +   +  
Sbjct: 187 NTARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEIDPDGTVLAF 237


>1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
          Length = 122

 Score = 46.4 bits (109), Expect = 3e-08
 Identities = 15/117 (12%), Positives = 28/117 (23%), Gaps = 17/117 (14%)

Query: 25  EAGKVYALIGSSGSGKTTLMNMIGKLEPYDGT-IFYRGKDLANYKSSDF-------FRHE 76
           + G    L  S    +  L   +       G   +Y+  +  N                 
Sbjct: 4   KQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTELLSLIQDFIGSGSG 63

Query: 77  LGYLFQNFGLIENQSIEENL---------KLGLIGQKLSRSEQRLRQKQALEQVGLA 124
           L    Q     ++   ++N+          + L       S    +    LE  G  
Sbjct: 64  LIIPDQWEDDKDSVVGKQNVYLLDTSSSADIQLESADEPISHIVQKVVLFLEDNGFF 120


>1odfA [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
          Length = 280

 Score = 45.9 bits (108), Expect = 4e-08
 Identities = 25/188 (13%), Positives = 58/188 (30%), Gaps = 15/188 (7%)

Query: 4   LKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGK--LEPYDGTIFYRG 61
           +   +  F ++ +        +        G  GSGK+     I    +E Y G      
Sbjct: 4   VLDYTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGY 63

Query: 62  KDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQV 121
             + ++  +   + +L   F+N  L++ + +     + L+ + L      +  +  +   
Sbjct: 64  ASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVL----NTIFNQDTVV-- 117

Query: 122 GLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLI-MEILLSL 180
                 L K       GE  R    + I       + +      +P    +   ++L   
Sbjct: 118 ------LPKYDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDLLTGD 171

Query: 181 RDDNRLII 188
             D    +
Sbjct: 172 MVDVNAKL 179


>1l1oA [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
          Length = 115

 Score = 45.2 bits (106), Expect = 7e-08
 Identities = 9/109 (8%), Positives = 23/109 (21%), Gaps = 4/109 (3%)

Query: 12  GERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSD 71
             R   +   +     K    +G       T    I   +           +    +   
Sbjct: 5   LPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILS-DGEGKNGTIELMEP-LDEEIS 62

Query: 72  FFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ 120
                +G +     ++   S  +          L    + ++      Q
Sbjct: 63  GIVEVVGRVTAKATILCT-SYVQFK-EDSHPFDLGLYNEAVKIIHDFPQ 109


>1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
          Length = 170

 Score = 45.1 bits (106), Expect = 7e-08
 Identities = 12/109 (11%), Positives = 24/109 (22%), Gaps = 12/109 (11%)

Query: 103 QKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPT 162
           +   R        +AL +  +  L +      L     +R                 E  
Sbjct: 8   RGDLRLHDHPALLEALARGPVVGL-VVLDPNNLKTTPRRRAWF------LENVRALREAY 60

Query: 163 ASIDPATSQLI----MEILLSLRDDNRLIIIATHNPA-IWEMADEVFTM 206
            +   A   L      ++  + R      + A  +        D     
Sbjct: 61  RARGGALWVLEGLPWEKVPEAARRLKAKAVYALTSHTPYGRYRDGRVRE 109


>1tmkA [c.37.1.1] THYMIDYLATE KINASE
          Length = 204

 Score = 44.3 bits (103), Expect = 1e-07
 Identities = 18/183 (9%), Positives = 50/183 (27%), Gaps = 14/183 (7%)

Query: 27  GKVYALIGSSGSGKTTL-MNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFG 85
           GK+  + G   +GKTT    +  KL+P    + +  +        + +         +F 
Sbjct: 3   GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLT-----DDSFQ 57

Query: 86  LIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVAL 145
           L +                  + +    +   +++   +           +G +      
Sbjct: 58  LSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSG-VAYSAAKGTNGMDLDWCLQ 116

Query: 146 AKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFT 205
             + L  P   L                    +  ++  +   +   +  I +  + +  
Sbjct: 117 PDVGLLKPDLTLFLST-------QFGDERYETVKFQEKVKQTFMKLLDKEIRKGDESITI 169

Query: 206 MDH 208
           +D 
Sbjct: 170 VDV 172


>1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
          Length = 200

 Score = 44.3 bits (103), Expect = 1e-07
 Identities = 7/131 (5%), Positives = 27/131 (20%), Gaps = 16/131 (12%)

Query: 82  QN-FGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES 140
            +     ++  + +NL L               +  +   + L      ++    +    
Sbjct: 2   THLVWFRQDLRLHDNLALA-----------AACRNSSARVLALYIA-TPRQWATHNMSPR 49

Query: 141 QR--VALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPA-IW 197
           Q   +      L+                     +  +     +++   +   +      
Sbjct: 50  QAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNE 109

Query: 198 EMADEVFTMDH 208
              D       
Sbjct: 110 RARDVEVERAL 120


>1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
          Length = 122

 Score = 44.2 bits (104), Expect = 1e-07
 Identities = 16/119 (13%), Positives = 38/119 (31%), Gaps = 12/119 (10%)

Query: 93  EENLKLGLIGQKLSRSEQRLRQKQALEQV-----GLAYLDLDKRIFELSGGESQRVALAK 147
           +  ++  L    + R  +  +   A + V     G+   + +         +  R+A+  
Sbjct: 1   QSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGM-LFETEGEELRTVATDGHRLAVCS 59

Query: 148 IILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTM 206
           + +           +  +       +M +L     DN L +    N     + D +FT 
Sbjct: 60  MPIGQS----LPSHSVIVPRKGVIELMRMLDGG--DNPLRVQIGSNNIRAHVGDFIFTS 112


>1f8xA [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
          Length = 156

 Score = 44.2 bits (103), Expect = 1e-07
 Identities = 12/84 (14%), Positives = 25/84 (29%), Gaps = 5/84 (5%)

Query: 130 KRIFE----LSGGESQRVALAKIILKNPPFILADEPTASIDPATSQ-LIMEILLSLRDDN 184
           K I+      +  +++    A   LK  P I  +     +D       + E    L D  
Sbjct: 3   KTIYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKV 62

Query: 185 RLIIIATHNPAIWEMADEVFTMDH 208
                  ++    +  D +  +  
Sbjct: 63  WATATYNNDLNGIKTNDIMLGVYI 86


>1cr0A [c.37.1.11] DNA PRIMASE/HELICASE
          Length = 241

 Score = 44.1 bits (103), Expect = 1e-07
 Identities = 25/211 (11%), Positives = 67/211 (31%), Gaps = 28/211 (13%)

Query: 6   QVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEP--YDGTIFYRGKD 63
            V   F      ++ ++    G+V  +   SG GK+T +              +     +
Sbjct: 14  SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE 73

Query: 64  LANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGL 123
            +  ++++        +         + I EN K                  Q  ++  L
Sbjct: 74  ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKF----------------DQWFDE--L 115

Query: 124 AYLDLDKRIFELSGGESQRVALAKIILKN---PPFILADEPTASIDPATSQLIMEILLSL 180
              D        +  E+ R+      +++      I+ D  +  I      L+ ++    
Sbjct: 116 FGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHIS--IRKMIDNLMTKLKGFA 173

Query: 181 RDDNRLIIIATHNP---AIWEMADEVFTMDH 208
           +    ++++  H     A+ +++D +  ++ 
Sbjct: 174 KSTGVVLVVICHLKDLRALRQLSDTIIALER 204


>1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
          Length = 157

 Score = 43.5 bits (101), Expect = 2e-07
 Identities = 22/130 (16%), Positives = 40/130 (30%), Gaps = 2/130 (1%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
             V  ++G    GK+TL N + K    D   +Y            F   +     +   +
Sbjct: 1   ATVL-IVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXKEV 59

Query: 87  IENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALA 146
             N   E +L L ++  K   +++       L +  +  + L     E      + V   
Sbjct: 60  TLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTI-LVANKAENLREFEREVKPE 118

Query: 147 KIILKNPPFI 156
              L     I
Sbjct: 119 LYSLGFGEPI 128


>1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
          Length = 176

 Score = 43.2 bits (100), Expect = 3e-07
 Identities = 15/116 (12%), Positives = 29/116 (25%), Gaps = 7/116 (6%)

Query: 93  EENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKN 152
            E +   L     S        K  +    L Y+           G     +L K     
Sbjct: 2   SEGIACILGTGSNSCLFDGREIKANV--SPLGYIL-GDEGSGAVLGRLFIGSLLKGQXPE 58

Query: 153 PPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDH 208
               L +         ++ +I  +       NR +   +   A       V+++  
Sbjct: 59  G---LCEAFLQEYGLTSADIIESVYR-KPFPNRFLAGFSPFIAQHLDIPAVYSLVQ 110


>1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
          Length = 91

 Score = 41.8 bits (98), Expect = 7e-07
 Identities = 6/56 (10%), Positives = 13/56 (23%), Gaps = 1/56 (1%)

Query: 105 LSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADE 160
            +       +        L  +        +   E QR  L ++        +  E
Sbjct: 29  ANAFSLPTPEIXVRFYQDLXRM-FRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESE 83


>1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
          Length = 244

 Score = 40.8 bits (93), Expect = 1e-06
 Identities = 11/62 (17%), Positives = 20/62 (32%), Gaps = 1/62 (1%)

Query: 29 VYALIGSSGSGKTTLMNMI-GKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGLI 87
          +   +G++GSGKTTL       LE      +            +       ++     + 
Sbjct: 2  IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMR 61

Query: 88 EN 89
          E 
Sbjct: 62 EG 63


>1iioA [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
          Length = 84

 Score = 40.7 bits (95), Expect = 2e-06
 Identities = 9/80 (11%), Positives = 20/80 (25%), Gaps = 10/80 (12%)

Query: 94  ENLKLGLIGQKLSRSEQRLRQKQ-----ALEQVGLAYLDLDKRIFE----LSGGESQRVA 144
            ++K+G+      +    L           E +       D         L   ++ +V 
Sbjct: 2   SHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVL 61

Query: 145 LAK-IILKNPPFILADEPTA 163
            A     K+   +       
Sbjct: 62  TADDFPFKSAEEVADTIVNK 81


>1em8A [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
          Length = 147

 Score = 40.6 bits (95), Expect = 2e-06
 Identities = 15/63 (23%), Positives = 22/63 (34%), Gaps = 9/63 (14%)

Query: 151 KNPPFILADEPTASIDPAT-SQLIMEILLSLRDDNRLIIIATHNPA--------IWEMAD 201
           KN  F L D  T     +   QL+ EI        + ++IA  +          +W    
Sbjct: 2   KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPA 61

Query: 202 EVF 204
           E F
Sbjct: 62  ESF 64


>1oa8A [b.145.1.1] ATAXIN-1
          Length = 128

 Score = 40.0 bits (93), Expect = 3e-06
 Identities = 16/99 (16%), Positives = 36/99 (36%), Gaps = 2/99 (2%)

Query: 94  ENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGESQRVALAKIILKNP 153
           E+LK     Q    S         +E++  ++      + + + GE +     ++ L   
Sbjct: 31  EDLKTEDFIQSAEISNDLKIDSSTVERIEDSH-SPGVAVIQFAVGEHRAQVSVEV-LVEY 88

Query: 154 PFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATH 192
           PF +  +  +S  P  +  + ++  S      + I  T 
Sbjct: 89  PFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL 127


>2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
          Length = 68

 Score = 40.0 bits (93), Expect = 3e-06
 Identities = 9/58 (15%), Positives = 18/58 (31%), Gaps = 3/58 (5%)

Query: 90  QSIEENLKLGLI-GQKLSRSEQRLRQKQALEQVGLAYLDL--DKRIFELSGGESQRVA 144
           ++    +K       + + +E RL      +      L         E+ G E + V 
Sbjct: 10  EATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMLASIGQEIGGVELEDVR 67


>1j90A [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
          Length = 195

 Score = 39.4 bits (91), Expect = 4e-06
 Identities = 23/117 (19%), Positives = 38/117 (32%), Gaps = 11/117 (9%)

Query: 27  GKVYALIGSSGSGKTTLMNMIGKL--------EPYDGTIFYRGKDLANYKSSDFFRHELG 78
                + G+ GSGKTT +N   K         EP +      G +L      D    +  
Sbjct: 3   PFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKD--PKKWA 60

Query: 79  YLFQNFGLIEN-QSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFE 134
             FQ++  +   QS        L   + S    R    + + + G     +   + E
Sbjct: 61  MPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEE 117


>1esmA [c.37.1.6] PANTOTHENATE KINASE
          Length = 311

 Score = 37.4 bits (85), Expect = 2e-05
 Identities = 8/50 (16%), Positives = 15/50 (30%), Gaps = 4/50 (8%)

Query: 1   MIELKQVSKSFGERE----LFSNLSMTFEAGKVYALIGSSGSGKTTLMNM 46
           +  L     S   R          +       + ++ GS   GK+T   +
Sbjct: 53  LSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARV 102


>1e2hA [c.37.1.1] THYMIDINE KINASE
          Length = 306

 Score = 36.8 bits (83), Expect = 2e-05
 Identities = 8/70 (11%), Positives = 18/70 (25%), Gaps = 3/70 (4%)

Query: 27 GKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFRHELGYLFQNFGL 86
               + G  G GKTT   ++     Y        +      +S+   +      +    
Sbjct: 4  LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV---LGASETIANIYTTQHRLDQG 60

Query: 87 IENQSIEENL 96
            +      +
Sbjct: 61 EISAGDAAVV 70


>1tueA [c.37.1.20] REPLICATION PROTEIN E1
          Length = 201

 Score = 35.6 bits (81), Expect = 5e-05
 Identities = 7/92 (7%), Positives = 24/92 (26%), Gaps = 3/92 (3%)

Query: 15  ELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSSDFFR 74
               +              G + +GK+        +    G +       +++       
Sbjct: 41  GALKSFLKGTPKKNCLVFCGPANTGKSYFGMSF--IHFIQGAVISFVNSTSHFWLEPLTD 98

Query: 75  HELGYLFQNFGLIENQSIEENLKLGLIGQKLS 106
            ++  +  +         +  ++  L G  +S
Sbjct: 99  TKVA-MLDDATTTCWTYFDTYMRNALDGNPIS 129


>1sbxA [a.6.1.4] SKI ONCOGENE
          Length = 106

 Score = 35.5 bits (81), Expect = 6e-05
 Identities = 6/80 (7%), Positives = 22/80 (27%), Gaps = 7/80 (8%)

Query: 134 ELSGGESQR----VALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIII 189
           + S    +       ++  ++     +   +   S+    S    +I     + +     
Sbjct: 9   DRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSL--QQINAVCDELHIYCSR 66

Query: 190 ATHNPA-IWEMADEVFTMDH 208
            T +   I ++   +     
Sbjct: 67  CTADQLEILKVXGILPFSAP 86


>1q3tA [c.37.1.1] CYTIDYLATE KINASE
          Length = 223

 Score = 34.1 bits (77), Expect = 2e-04
 Identities = 20/177 (11%), Positives = 54/177 (30%), Gaps = 15/177 (8%)

Query: 27  GKVYALIGSSGSGKTTLMNMI----GKLEPYDGTIF--------YRGKDLANYKSSDFFR 74
               A+ G + SGK+T+  +I    G      G ++             +   ++     
Sbjct: 3   TIQIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQLGVEEVEALLALL 62

Query: 75  HELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFE 134
            +    F      +      ++ +    ++ +     +    A+ +V    + L + I +
Sbjct: 63  DQHPISFGRSETGDQLVFVGDVDITHPIRE-NEVTNHVSAIAAIPEVREKLVSLQQEIAQ 121

Query: 135 LSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIAT 191
             G       +  ++L      +     AS+D    +   E +    + +   +   
Sbjct: 122 QGGIVMDGRDIGTVVLPQAELKIFL--VASVDERAERRYKENIAKGIETDLETLKKE 176


>1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
           126
          Length = 125

 Score = 33.8 bits (76), Expect = 2e-04
 Identities = 5/58 (8%), Positives = 15/58 (25%), Gaps = 5/58 (8%)

Query: 153 PPFILADEPTASIDPATSQLIMEILLSLRD--DNRLIIIATHNPAIWEMADEVFTMDH 208
           P  IL  +            +   +  L++        +A       + ++    +  
Sbjct: 2   PAEILNGKEI---SAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKL 56


>1ckeA [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
          Length = 212

 Score = 33.4 bits (75), Expect = 2e-04
 Identities = 32/197 (16%), Positives = 64/197 (32%), Gaps = 21/197 (10%)

Query: 27  GKVYALIGSSGSGKTTLMNMI----GKLEPYDGTIF--------YRGKDLANYKSSDFFR 74
             V  + G SG+GK TL   +           G I+        +   D+A+  +     
Sbjct: 3   APVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLA 62

Query: 75  HELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQ--ALEQVGLAYLDLDKRI 132
             L   F +     N ++E  L+   +  ++   E      Q  A  +V  A L   +  
Sbjct: 63  SHLDVRFVS----TNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAF 118

Query: 133 FELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATH 192
            EL G  +    +  ++  + P  +     AS +    + ++++ +     N    +   
Sbjct: 119 RELPGLIADGRDMGTVVFPDAPVKI--FLDASSEERAHRRMLQLQVKGFSVN-FERLLAE 175

Query: 193 NPAIWEMADEVFTMDHL 209
              +      V     L
Sbjct: 176 IKLVPAADALVLDSTTL 192


>1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
          342
          Length = 185

 Score = 32.0 bits (71), Expect = 7e-04
 Identities = 7/29 (24%), Positives = 15/29 (51%)

Query: 31 ALIGSSGSGKTTLMNMIGKLEPYDGTIFY 59
           L+G    GK+TL++++   +P      +
Sbjct: 5  GLVGFPSVGKSTLLSVVSSAKPKIADYHF 33


>1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
          Length = 99

 Score = 31.9 bits (72), Expect = 7e-04
 Identities = 4/44 (9%), Positives = 12/44 (27%), Gaps = 2/44 (4%)

Query: 167 PATSQLIMEILLSL-RDDNRLIIIATHN-PAIWEMADEVFTMDH 208
               +L+     ++       + +  H   A+         +D 
Sbjct: 3   REQEELLAPADGTVELVRALPLALVLHELGALRLGVGAELLVDV 46


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.136    0.377 

Gapped
Lambda     K      H
   0.267   0.0541    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 21,685,255
Number of extensions: 1626042
Number of successful extensions: 6698
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 6329
Number of HSP's successfully gapped: 315
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)