BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ55030.1 tfus0 AAZ55030.1 GIB00263CH01 "Lipoate-protein
ligase B"
         (236 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1w66A [x.x.x] LIPOYLTRANSFERASE                                       213   5e-58
2qhsA [x.x.x] LIPOYLTRANSFERASE                                       142   1e-36

>1w66A [x.x.x] LIPOYLTRANSFERASE
          Length = 218

 Score =  213 bits (542), Expect = 5e-58
 Identities = 111/187 (59%), Positives = 133/187 (71%), Gaps = 8/187 (4%)

Query: 17  VPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAPVIDIDR 76
           V Y   W+LQR+L   RVA    DT+LLLEH  VYTAG+RT   +RP+   G PV+D DR
Sbjct: 22  VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTPVVDTDR 78

Query: 77  GGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLA 136
           GGKITWHGPGQL  YPI+ L  PLDVV YVR LEE++I+V  D GL   RV+GR+GVWL 
Sbjct: 79  GGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP 138

Query: 137 AAPDRGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELD 196
                G P RK+AAIG R+++  T+HGFALNC+ DL+ F  IVPCGI DA VTSL+AEL 
Sbjct: 139 -----GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELG 193

Query: 197 RTVGVGD 203
           RTV V +
Sbjct: 194 RTVTVDE 200


>2qhsA [x.x.x] LIPOYLTRANSFERASE
          Length = 210

 Score =  142 bits (358), Expect = 1e-36
 Identities = 85/209 (40%), Positives = 115/209 (55%), Gaps = 21/209 (10%)

Query: 17  VPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKR-TGP-------WDRPLTDPG 68
           VPY E W  Q+++H+  VA   P T+LLLEH  V T G++ TG        W R   + G
Sbjct: 11  VPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYR---ENG 67

Query: 69  APVIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVE 128
             +  ++RGG +T+HGPGQL  YPI   P   +V  ++R +EEAI+RV   +G+S     
Sbjct: 68  FELYWVERGGDVTYHGPGQLVGYPI--FPVGREVRRFLRQIEEAIVRVAAGYGISAYPTP 125

Query: 129 GRTGVWLAAAPDRGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGV 188
           G  GVW+         E K+ AIG  + +GV+ HGFALN N DL+ F  IVPCG++  GV
Sbjct: 126 GYAGVWVG--------EDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGV 177

Query: 189 TSLTAELDRTVGVGDILEATEHHLAAVLG 217
           TSL   L R V + +         A V G
Sbjct: 178 TSLEKLLGRKVPMEEAKARVVAAFAEVFG 206


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.137    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 916,950,512
Number of extensions: 36645028
Number of successful extensions: 91089
Number of sequences better than 1.0e-03: 2985
Number of HSP's gapped: 87100
Number of HSP's successfully gapped: 3214
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)