BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ55524.1 tfus0 AAZ55524.1 GIB00263CH01 "NADH:flavin
oxidoreductases, Old Yellow enzyme f.."
         (656 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1djqA [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE            199   2e-53
1djnA [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE            197   7e-53
1ps9A [c.1.4 - c.4.1 - c.3.1] 2,4-DIENOYL-COA REDUCTASE               190   1e-50
1z41A [x.x.x] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE            97   2e-22
1vypX [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   97   2e-22
1vysX [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   96   2e-22
2gq9A [x.x.x] OXIDOREDUCTASE, FMN-BINDING                              96   2e-22
1vyrA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   96   4e-22
1gvrA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   96   4e-22
1gvoA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   96   4e-22
2abbA [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE                   96   4e-22
2gqaA [x.x.x] OXIDOREDUCTASE, FMN-BINDING                              94   1e-21
2gouA [x.x.x] OXIDOREDUCTASE, FMN-BINDING                              94   1e-21
2g5wB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          92   3e-21
3hgsA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          92   6e-21
2hs8B [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          91   7e-21
2hs8A [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          91   7e-21
1oyaA [x.x.x] OLD YELLOW ENZYME                                        91   1e-20
1k02A [c.1.4] NADPH DEHYDROGENASE 1                                    91   1e-20
3hgoB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          91   1e-20
3hgoA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          91   1e-20
1bwlA [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)                          91   1e-20
1q45B [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE                      89   5e-20
2hs6A [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          89   5e-20
3hgsB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          88   6e-20
1bwkA [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)                          88   6e-20
2hsaA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          88   8e-20
2hsaB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          88   8e-20
2g5wA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3                          86   3e-19
2r14A [x.x.x] MORPHINONE REDUCTASE                                     86   4e-19
1q45A [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE                      85   5e-19
3gx9A [x.x.x] MORPHINONE REDUCTASE                                     82   3e-18
1gwjA [c.1.4] MORPHINONE REDUCTASE                                     82   3e-18
3gkaB [x.x.x] N-ETHYLMALEIMIDE REDUCTASE                               82   4e-18
3gkaA [x.x.x] N-ETHYLMALEIMIDE REDUCTASE                               82   4e-18
1vjiA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE (OPR1)                     81   1e-17
1icsA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1                          78   8e-17
1icqA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1                          78   8e-17
1icpB [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1                          78   8e-17
3hgrB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 1                          78   8e-17
1icqB [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1                          77   1e-16
1icpA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1                          77   1e-16
2h8zA [x.x.x] XENOBIOTIC REDUCTASE A                                   67   1e-13
2h8xA [x.x.x] XENOBIOTIC REDUCTASE A                                   67   1e-13
2iidA [c.3.1 - d.16.1 (1f8rA)] L-AMINO-ACID OXIDASE                    43   2e-06
1f8sA [c.3.1 - d.16.1] L-AMINO ACID OXIDASE                            43   2e-06
1reoA [c.3.1 - d.16.1] AHPLAAO                                         42   5e-06
2rabB [x.x.x] GLUTATHIONE AMIDE REDUCTASE                              39   3e-05
2rabA [x.x.x] GLUTATHIONE AMIDE REDUCTASE                              39   3e-05
2r9zB [x.x.x] GLUTATHIONE AMIDE REDUCTASE                              39   3e-05
2r9zA [x.x.x] GLUTATHIONE AMIDE REDUCTASE                              39   3e-05
3e1tA [x.x.x] HALOGENASE                                               39   4e-05
1wamA [x.x.x] UDP-GALACTOPYRANOSE MUTASE                               35   6e-04
1usjA [c.4.1 - d.16.1] UDP-GALACTOPYRANOSE MUTASE                      35   6e-04
3intB [x.x.x] PROBABLE UDP-GALACTOPYRANOSE MUTASE                      35   6e-04
3inrB [x.x.x] UDP-GALACTOPYRANOSE MUTASE                               35   6e-04
3gf4A [x.x.x] UDP-GALACTOPYRANOSE MUTASE                               35   6e-04
2eq6A [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE         35   6e-04
2bi7A [x.x.x] UDP-GALACTOPYRANOSE MUTASE                               35   6e-04

>1djqA [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
          Length = 729

 Score =  199 bits (505), Expect = 2e-53
 Identities = 193/706 (27%), Positives = 289/706 (40%), Gaps = 86/706 (12%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF PI++G   L NR    PHA   G+   P    A R++                   +
Sbjct: 9   LFEPIQIGPKTLRNRFYQVPHAIGAGSD-KPGFQSAHRSVKAEGGWAALNTEYCSINPES 67

Query: 72  LENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGG------ 125
            + H +             G  R       ++ +TD +H+ GA    +L   G       
Sbjct: 68  DDTHRL------SARIWDEGDVR------NLKAMTDEVHKYGALAGVELWYGGAHAPNME 115

Query: 126 ---MPHGPSPTVTAYVANQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDL 182
               P GPS   + +        +D  +IA     Y ++A+R + AG D V ++  H  L
Sbjct: 116 SRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYL 175

Query: 183 LEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDA 242
              FL+P  N R D+YGG L  R RF LE ++ ++  VG D  +  R  +      G   
Sbjct: 176 PLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIE 235

Query: 243 AEGVDIAKALE-ATGKIDYLSVVVGD--NWGAPSYIQPHYYQ--PAQWADLAAQVTRAVS 297
           AE VD  K +E A   +D   + +GD   WG  +     Y Q     W  L  QV++   
Sbjct: 236 AE-VDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKK-- 292

Query: 298 LPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRPCIGCNEC 357
            PV+  GR TDP    +++ +G AD++G AR  I DP +  K  QGR  +IR CIGCN C
Sbjct: 293 -PVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVC 351

Query: 358 IHRRLVDKLPFACAINPYASRELDGPLPP-----ARTPRRVLVVGGGPAGMELAGLLAER 412
           I R  +   P  C  N  A  E      P      +    VL+VG GP+G E A +L E 
Sbjct: 352 ISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMES 411

Query: 413 GHEVTLWEREEQLGG---QMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELG---RTAT 466
           G+ V L +  E++GG   Q+           + D+   Q  +L +     +L    +  T
Sbjct: 412 GYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMT 471

Query: 467 VDNVLSF--------XXXXXXXXXXXXPRRLPIPGADA--PFVVDGHAVLAGTAQIGERV 516
            D+VL +                        PIPGADA  P  +    V+ G  +IG+RV
Sbjct: 472 ADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRV 531

Query: 517 LLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIXXXXXXXXXXXXXXXXM 576
           ++  A+ +    ++A  LA  GH V +V         +  Y                  +
Sbjct: 532 VILNADTYFMAPSLAEKLATAGHEVTIV-----SGVHLANYMHFTLEYPNMMRRLHELHV 586

Query: 577 QRV-----VQIEEGRVATRNIYSD-------IPG----------EITGFDSVVVAAGGVP 614
           + +      +IE GR+   NI+ D        PG              FDS+V+  G   
Sbjct: 587 EELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHS 646

Query: 615 DDSLYHELK-------RHGKANVHLLGDAYAPRRITFATQQAYALA 653
           + +L++ELK        +    ++L+GDA APR I  AT   + +A
Sbjct: 647 ECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVA 692


>1djnA [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
          Length = 729

 Score =  197 bits (501), Expect = 7e-53
 Identities = 192/706 (27%), Positives = 288/706 (40%), Gaps = 86/706 (12%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF PI++G   L NR    PH    G+   P    A R++                   +
Sbjct: 9   LFEPIQIGPKTLRNRFYQVPHCIGAGSD-KPGFQSAHRSVKAEGGWAALNTEYCSINPES 67

Query: 72  LENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGG------ 125
            + H +             G  R       ++ +TD +H+ GA    +L   G       
Sbjct: 68  DDTHRL------SARIWDEGDVR------NLKAMTDEVHKYGALAGVELWYGGAHAPNME 115

Query: 126 ---MPHGPSPTVTAYVANQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDL 182
               P GPS   + +        +D  +IA     Y ++A+R + AG D V ++  H  L
Sbjct: 116 SRATPRGPSQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYL 175

Query: 183 LEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDA 242
              FL+P  N R D+YGG L  R RF LE ++ ++  VG D  +  R  +      G   
Sbjct: 176 PLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIE 235

Query: 243 AEGVDIAKALE-ATGKIDYLSVVVGD--NWGAPSYIQPHYYQ--PAQWADLAAQVTRAVS 297
           AE VD  K +E A   +D   + +GD   WG  +     Y Q     W  L  QV++   
Sbjct: 236 AE-VDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVKQVSKK-- 292

Query: 298 LPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRPCIGCNEC 357
            PV+  GR TDP    +++ +G AD++G AR  I DP +  K  QGR  +IR CIGCN C
Sbjct: 293 -PVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRVCIGCNVC 351

Query: 358 IHRRLVDKLPFACAINPYASRELDGPLPP-----ARTPRRVLVVGGGPAGMELAGLLAER 412
           I R  +   P  C  N  A  E      P      +    VL+VG GP+G E A +L E 
Sbjct: 352 ISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMES 411

Query: 413 GHEVTLWEREEQLGG---QMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELG---RTAT 466
           G+ V L +  E++GG   Q+           + D+   Q  +L +     +L    +  T
Sbjct: 412 GYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLALGQKPMT 471

Query: 467 VDNVLSF--------XXXXXXXXXXXXPRRLPIPGADA--PFVVDGHAVLAGTAQIGERV 516
            D+VL +                        PIPGADA  P  +    V+ G  +IG+RV
Sbjct: 472 ADDVLQYGADKVIIATGARWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRV 531

Query: 517 LLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIXXXXXXXXXXXXXXXXM 576
           ++  A+ +    ++A  LA  GH V +V         +  Y                  +
Sbjct: 532 VILNADTYFMAPSLAEKLATAGHEVTIV-----SGVHLANYMHFTLEYPNMMRRLHELHV 586

Query: 577 QRV-----VQIEEGRVATRNIYSD-------IPG----------EITGFDSVVVAAGGVP 614
           + +      +IE GR+   NI+ D        PG              FDS+V+  G   
Sbjct: 587 EELGDHFCSRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIEFDSLVLVTGRHS 646

Query: 615 DDSLYHELK-------RHGKANVHLLGDAYAPRRITFATQQAYALA 653
           + +L++ELK        +    ++L+GDA APR I  AT   + +A
Sbjct: 647 ECTLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVA 692


>1ps9A [c.1.4 - c.4.1 - c.3.1] 2,4-DIENOYL-COA REDUCTASE
          Length = 671

 Score =  190 bits (482), Expect = 1e-50
 Identities = 137/517 (26%), Positives = 230/517 (44%), Gaps = 26/517 (5%)

Query: 9   FTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXI 68
           +  LF P+ +G   L NR++     T +     PD AE                     +
Sbjct: 2   YPSLFAPLDLGFTTLKNRVLMGSMHTGLEEY--PDGAER--------LAAFYAERARHGV 51

Query: 69  SAALENHLVPGFEPTGV--GAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGG- 125
           +  +   + P     G+  GA      ++P+     R +T+ +H+ G  +  Q++  G  
Sbjct: 52  ALIVSGGIAPDLTGVGMEGGAMLNDASQIPHH----RTITEAVHQEGGKIALQILHTGRY 107

Query: 126 --MPHGPSPTVTAYVANQ-VSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDL 182
              PH  +P+      N+ V H L  +EI   I+ +A  A+  + AG DGVE+  +   L
Sbjct: 108 SYQPHLVAPSALQAPINRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYL 167

Query: 183 LEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDA 242
           +  FL+  +N R D++GGD                   G DF +  R+++ + ++ G   
Sbjct: 168 INEFLTLRTNQRSDQWGGDYRNXXXXXXXXXXXXXXXXGNDFIIIYRLSMLDLVEDGGTF 227

Query: 243 AEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIY 302
           AE V++A+A+EA G     + +       P+   P       W  +  ++   VSLP++ 
Sbjct: 228 AETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPRGAFSW--VTRKLKGHVSLPLVT 285

Query: 303 TGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRPCIGCNE-CIHRR 361
           T R+ DP  A+ ++++G AD+V MAR  + D E+++K   GR  EI  CIGCN+ C+ + 
Sbjct: 286 TNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQI 345

Query: 362 LVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWER 421
            V K+  +C +NP A  E   P+ PA   +                  A RGH+VTL++ 
Sbjct: 346 FVGKVT-SCLVNPRACHETKMPILPAVQKKNXXXXXXXXXXXXXXINAAARGHQVTLFDA 404

Query: 422 EEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFXXXXXXXX 481
             ++GGQ  I         +++ + +    +   GVT++L  T T D + +F        
Sbjct: 405 HSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAF--DETILA 462

Query: 482 XXXXPRRLPIPGADAPFVVDGHAVLAGTAQIGERVLL 518
               PR  PI G D P V+    VL   A +G +V +
Sbjct: 463 SGIVPRTPPIDGIDHPKVLSYLDVLRDKAPVGNKVAI 499


>1z41A [x.x.x] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE
          Length = 327

 Score = 96.7 bits (239), Expect = 2e-22
 Identities = 75/236 (31%), Positives = 114/236 (48%), Gaps = 18/236 (7%)

Query: 104 KLTDTLHEAGAYVTAQLIMQGGMPHGP----SPTVTAYVANQVSHALDRDEIAWFINEYA 159
           KLT+ + E G+ +  QL   G          +P+  A+     +     +++   + E+ 
Sbjct: 81  KLTEQVKEQGSKIGIQLAHAGRKAELEGDIFAPSAIAFDEQSATPVESAEKVKETVQEFK 140

Query: 160 ESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAE 219
           ++A R K AG D +E+HA H  L+  FLSP SNHR DEYGG    R RFL EIID ++  
Sbjct: 141 QAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEVKQV 200

Query: 220 VGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY 279
              D  L VR++  +  D G D A+ +  AK  E    +D +    G    A   + P Y
Sbjct: 201 W--DGPLFVRVSASDYTDKGLDIADHIGFAKWKEQ--GVDLIDCSSGALVHADINVFPGY 256

Query: 280 YQP-AQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
               A+     A  T AV         +TD  +AE+++  G+ADL+ + R ++ DP
Sbjct: 257 QVSFAEKIREQADATGAVG--------ITD-GSAEEILQNGRADLIFIGRELLRDP 303


>1vypX [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 362

 Score = 96.7 bits (239), Expect = 2e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 3   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 46

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 47  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLFH 101

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 102 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 161

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 162 RQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 221

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 222 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 279

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 280 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 328

Query: 335 EIITK 339
           +++ +
Sbjct: 329 DLVAR 333


>1vysX [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 364

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 5   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 48

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 49  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLYH 103

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 104 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 163

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 164 RQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 223

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 224 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 281

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 282 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 330

Query: 335 EIITK 339
           +++ +
Sbjct: 331 DLVAR 335


>2gq9A [x.x.x] OXIDOREDUCTASE, FMN-BINDING
          Length = 362

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 86/291 (29%), Positives = 132/291 (45%), Gaps = 40/291 (13%)

Query: 81  EPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIMQGGMPH-----GP 130
           E T +   A+G    P  Y  ++I   R +T+ +H  G  + AQL   G + H     G 
Sbjct: 57  EGTQISPTAKGYAWTPGIYTPEQIAGWRIVTEAVHAKGCAIFAQLWHVGRVTHPDNIDGQ 116

Query: 131 SP---------TVTAYVANQ-------VSHALDRDEIAWFINEYAESARRGKAAGLDGVE 174
            P          V  +V N+       V  A+ + +IA  I +Y ++A     AG DG+E
Sbjct: 117 QPISSSTLKAENVKVFVDNEPGFVDVAVPRAMTKADIAQVIADYRQAALNAMEAGFDGIE 176

Query: 175 LHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYE 234
           LHA +  L+  F+   +N+R DEYGG L  R+RFL E++ A+   +G +  +GVR+    
Sbjct: 177 LHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLDEVVAALVDAIGAE-RVGVRLAPLT 235

Query: 235 ALDGGYDAAE--GVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQV 292
            L+G  DA        A AL    +I YL +   D   AP         P  +     + 
Sbjct: 236 TLNGTVDADPILTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------TPVSFKRALREA 288

Query: 293 TRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            + V   +IY GR  +   AE+ I  G AD++G  R  I +P++  +   G
Sbjct: 289 YQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG 335


>1vyrA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 363

 Score = 95.5 bits (236), Expect = 4e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 4   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 47

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 48  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLWH 102

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 103 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 162

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 163 RQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 222

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 223 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 280

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 281 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 329

Query: 335 EIITK 339
           +++ +
Sbjct: 330 DLVAR 334


>1gvrA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 364

 Score = 95.5 bits (236), Expect = 4e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 5   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 48

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 49  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLWH 103

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 104 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 163

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 164 RQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 223

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 224 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 281

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 282 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 330

Query: 335 EIITK 339
           +++ +
Sbjct: 331 DLVAR 335


>1gvoA [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 362

 Score = 95.5 bits (236), Expect = 4e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 3   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 46

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 47  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLWH 101

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 102 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 161

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 162 RQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 221

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 222 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 279

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 280 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 328

Query: 335 EIITK 339
           +++ +
Sbjct: 329 DLVAR 333


>2abbA [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
          Length = 361

 Score = 95.5 bits (236), Expect = 4e-22
 Identities = 97/365 (26%), Positives = 152/365 (41%), Gaps = 71/365 (19%)

Query: 12  LFTPIRVGRMDLPNRIMATP----HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXX 67
           LFTP++VG +  PNR+   P     +   G++ +P   E  R                  
Sbjct: 2   LFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQ----------------R 45

Query: 68  ISAALENHLVPGFEPTGVGAAARGVFRLPYFHD-----RIRKLTDTLHEAGAYVTAQLIM 122
            SA L        E T + A A+G    P  H        +K+T  +H     +  QL  
Sbjct: 46  ASAGLIIS-----EATQISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAEDGRIAVQLWH 100

Query: 123 QGGMPH------GPSP-TVTAYVANQ-----------------VSHALDRDEIAWFINEY 158
            G + H      G +P + +A  AN                     AL+ DEI   +N++
Sbjct: 101 TGRISHSSIQPGGQAPVSASALNANTRTSLRDENGNAIRVDTTTPRALELDEIPGIVNDF 160

Query: 159 AESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRA 218
            ++    + AG D VELH+ H  LL  FLSP+SN R D+YGG +  R R +LE++DA+  
Sbjct: 161 RQAVANAREAGFDLVELHSAHGFLLHQFLSPSSNQRTDQYGGSVENRARLVLEVVDAVCN 220

Query: 219 EVGPDFTLGVRMN---LYEALDGG-YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSY 274
           E   D  +G+R++    ++ +D G  + A+ + + + L   G I YL +   D  G   Y
Sbjct: 221 EWSAD-RIGIRVSPIGTFQNVDNGPNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY 278

Query: 275 IQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDP 334
                      ++   Q  R     VI          AE +I +G  D V   R  I +P
Sbjct: 279 -----------SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANP 327

Query: 335 EIITK 339
           +++ +
Sbjct: 328 DLVAR 332


>2gqaA [x.x.x] OXIDOREDUCTASE, FMN-BINDING
          Length = 364

 Score = 94.0 bits (232), Expect = 1e-21
 Identities = 86/294 (29%), Positives = 131/294 (44%), Gaps = 43/294 (14%)

Query: 81  EPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIMQGGMPH-----GP 130
           E T +   A+G    P  Y  ++I   R +T+ +H  G  + AQL   G + H     G 
Sbjct: 56  EGTQISPTAKGYAWTPGIYTPEQIAGWRIVTEAVHAKGCAIFAQLWHVGRVTHPDNIDGQ 115

Query: 131 SP---------TVTAYVAN----------QVSHALDRDEIAWFINEYAESARRGKAAGLD 171
            P          V  +V N           V  A+ + +IA  I +Y ++A     AG D
Sbjct: 116 QPISSSTLKAENVKVFVDNGSDEPGFVDVAVPRAMTKADIAQVIADYRQAALNAMEAGFD 175

Query: 172 GVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMN 231
           G+ELHA +  L+  F+   +N+R DEYGG L  R+RFL E++ A+   +G +  +GVR+ 
Sbjct: 176 GIELHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLDEVVAALVDAIGAE-RVGVRLA 234

Query: 232 LYEALDGGYDAAE--GVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLA 289
               L+G  DA        A AL    +I YL +   D   AP         P  +    
Sbjct: 235 PLTTLNGTVDADPILTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------TPVSFKRAL 287

Query: 290 AQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +  + V   +IY GR  +   AE+ I  G AD++G  R  I +P++  +   G
Sbjct: 288 REAYQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG 337


>2gouA [x.x.x] OXIDOREDUCTASE, FMN-BINDING
          Length = 365

 Score = 94.0 bits (232), Expect = 1e-21
 Identities = 86/294 (29%), Positives = 131/294 (44%), Gaps = 43/294 (14%)

Query: 81  EPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIMQGGMPH-----GP 130
           E T +   A+G    P  Y  ++I   R +T+ +H  G  + AQL   G + H     G 
Sbjct: 57  EGTQISPTAKGYAWTPGIYTPEQIAGWRIVTEAVHAKGCAIFAQLWHVGRVTHPDNIDGQ 116

Query: 131 SP---------TVTAYVAN----------QVSHALDRDEIAWFINEYAESARRGKAAGLD 171
            P          V  +V N           V  A+ + +IA  I +Y ++A     AG D
Sbjct: 117 QPISSSTLKAENVKVFVDNGSDEPGFVDVAVPRAMTKADIAQVIADYRQAALNAMEAGFD 176

Query: 172 GVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMN 231
           G+ELHA +  L+  F+   +N+R DEYGG L  R+RFL E++ A+   +G +  +GVR+ 
Sbjct: 177 GIELHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLDEVVAALVDAIGAE-RVGVRLA 235

Query: 232 LYEALDGGYDAAE--GVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLA 289
               L+G  DA        A AL    +I YL +   D   AP         P  +    
Sbjct: 236 PLTTLNGTVDADPILTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------TPVSFKRAL 288

Query: 290 AQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +  + V   +IY GR  +   AE+ I  G AD++G  R  I +P++  +   G
Sbjct: 289 REAYQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG 338


>2g5wB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 366

 Score = 92.4 bits (228), Expect = 3e-21
 Identities = 86/360 (23%), Positives = 150/360 (41%), Gaps = 59/360 (16%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+  ++GR DL +R++  P          P+ A A+                       
Sbjct: 4   LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------- 41

Query: 72  LENHLVPG----FEPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIM 122
                 PG     E T V   + G   +P  Y  +++   +++ + +H  G ++  QL  
Sbjct: 42  YAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWH 101

Query: 123 QGG------MPHGPSPTVT-----------------AYVANQVSHALDRDEIAWFINEYA 159
            G        P+G SP  +                 ++V      AL+  EI   + +Y 
Sbjct: 102 VGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYC 161

Query: 160 ESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAE 219
            SA     AG DG+E+H  H  L++ FL    N R D+YGG +A R RFL ++++ + + 
Sbjct: 162 LSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSA 221

Query: 220 VGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY 279
           +G    +GVR++   A+D   DA +   ++  L   G ++ L  V G         QP Y
Sbjct: 222 IGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRY 277

Query: 280 YQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
           +   + A L   +  A +   + +G   +     + + QG ADLV   R  I +P+++++
Sbjct: 278 HAYEEEAKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVSR 336


>3hgsA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 368

 Score = 91.7 bits (226), Expect = 6e-21
 Identities = 87/354 (24%), Positives = 145/354 (40%), Gaps = 45/354 (12%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 3   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 52

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 53  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 108

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 109 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 168

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 169 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 227

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY---QPAQW 285
           R++   A+D   DA +   ++  L    +++ + +  G         QP Y    Q  + 
Sbjct: 228 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQEEEE 284

Query: 286 ADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
           A L   +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 285 ARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 337


>2hs8B [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 363

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 85/351 (24%), Positives = 143/351 (40%), Gaps = 42/351 (11%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 2   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 51

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 52  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 107

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 108 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 167

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 168 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 226

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP      + A L
Sbjct: 227 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLGSEEEEARL 283

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 284 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 333


>2hs8A [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 367

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 85/351 (24%), Positives = 143/351 (40%), Gaps = 42/351 (11%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 6   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 55

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 56  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 111

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 112 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 171

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 172 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 230

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP      + A L
Sbjct: 231 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLGSEEEEARL 287

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 288 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 337


>1oyaA [x.x.x] OLD YELLOW ENZYME
          Length = 399

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 59/211 (27%), Positives = 102/211 (48%), Gaps = 9/211 (4%)

Query: 140 NQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYG 199
           N   H+L +DEI  +I EY ++A+   AAG DGVE+H+ +  LL  FL P SN R DEYG
Sbjct: 155 NNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYG 214

Query: 200 GDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKID 259
           G +  R RF LE++DA+   +G +  +G+R++ Y   +     AE   +A+     G+++
Sbjct: 215 GSIENRARFTLEVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE 273

Query: 260 YLSVVVGDNWGAPSYIQPHYYQP------AQWADLAAQVTRAV-SLPVIYTGRVTDPHTA 312
                 G        ++P    P       ++   +     ++   PVI  G        
Sbjct: 274 -KRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEV 332

Query: 313 EKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +   + +  L+G  R  I++P+++ +  +G
Sbjct: 333 VREEVKDKRTLIGYGRFFISNPDLVDRLEKG 363


>1k02A [c.1.4] NADPH DEHYDROGENASE 1
          Length = 399

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 59/211 (27%), Positives = 102/211 (48%), Gaps = 9/211 (4%)

Query: 140 NQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYG 199
           N   H+L +DEI  +I EY ++A+   AAG DGVE+H+ +  LL  FL P SN R DEYG
Sbjct: 155 NNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYG 214

Query: 200 GDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKID 259
           G +  R RF LE++DA+   +G +  +G+R++ Y   +     AE   +A+     G+++
Sbjct: 215 GSIENRARFTLEVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE 273

Query: 260 YLSVVVGDNWGAPSYIQPHYYQP------AQWADLAAQVTRAV-SLPVIYTGRVTDPHTA 312
                 G        ++P    P       ++   +     ++   PVI  G        
Sbjct: 274 -KRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEV 332

Query: 313 EKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +   + +  L+G  R  I++P+++ +  +G
Sbjct: 333 VREEVKDKRTLIGYGRFFISNPDLVDRLEKG 363


>3hgoB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 363

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 85/351 (24%), Positives = 143/351 (40%), Gaps = 42/351 (11%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 2   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 51

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 52  TEGTMI---SPTSAGYPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 107

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 108 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 167

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 168 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 226

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP      + A L
Sbjct: 227 RVS--PAID-YLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLGSEEEEARL 283

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 284 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 333


>3hgoA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 367

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 85/351 (24%), Positives = 143/351 (40%), Gaps = 42/351 (11%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 6   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 55

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 56  TEGTMI---SPTSAGYPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 111

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 112 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 171

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 172 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 230

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP      + A L
Sbjct: 231 RVS--PAID-YLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLGSEEEEARL 287

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 288 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 337


>1bwlA [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
          Length = 399

 Score = 90.9 bits (224), Expect = 1e-20
 Identities = 59/211 (27%), Positives = 102/211 (48%), Gaps = 9/211 (4%)

Query: 140 NQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYG 199
           N   H+L +DEI  +I EY ++A+   AAG DGVE+++ H  LL  FL P SN R DEYG
Sbjct: 155 NNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSAHGYLLNQFLDPHSNTRTDEYG 214

Query: 200 GDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKID 259
           G +  R RF LE++DA+   +G +  +G+R++ Y   +     AE   +A+     G+++
Sbjct: 215 GSIENRARFTLEVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE 273

Query: 260 YLSVVVGDNWGAPSYIQPHYYQP------AQWADLAAQVTRAV-SLPVIYTGRVTDPHTA 312
                 G        ++P    P       ++   +     ++   PVI  G        
Sbjct: 274 -KRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEV 332

Query: 313 EKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +   + +  L+G  R  I++P+++ +  +G
Sbjct: 333 VREEVKDKRTLIGYGRFFISNPDLVDRLEKG 363


>1q45B [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE
          Length = 367

 Score = 88.6 bits (218), Expect = 5e-20
 Identities = 86/361 (23%), Positives = 150/361 (41%), Gaps = 60/361 (16%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+  ++GR DL +R++  P          P+ A A+                       
Sbjct: 4   LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------- 41

Query: 72  LENHLVPG----FEPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIM 122
                 PG     E T V   + G   +P  Y  +++   +++ + +H  G ++  QL  
Sbjct: 42  YAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWH 101

Query: 123 QGG------MPHGPSPTVT-----------------AYVANQVSHALDRDEIAWFINEYA 159
            G        P+G SP  +                 ++V      AL+  EI   + +Y 
Sbjct: 102 VGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYC 161

Query: 160 ESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAE 219
            SA     AG DG+E+H  H  L++ FL    N R D+YGG +A R RFL ++++ + + 
Sbjct: 162 LSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSA 221

Query: 220 VGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY 279
           +G    +GVR++   A+D   DA +   ++  L   G ++ L  V G         QP Y
Sbjct: 222 IGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRY 277

Query: 280 Y-QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIIT 338
           +    + A L   +  A +   + +G   +     + + QG ADLV   R  I +P++++
Sbjct: 278 HAYDEEEAKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVS 336

Query: 339 K 339
           +
Sbjct: 337 R 337


>2hs6A [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 362

 Score = 88.6 bits (218), Expect = 5e-20
 Identities = 85/351 (24%), Positives = 144/351 (41%), Gaps = 45/351 (12%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 3   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 52

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 53  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 108

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 109 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 168

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 169 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 227

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP   + A+   L
Sbjct: 228 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPREEEEAR---L 281

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 282 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 331


>3hgsB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 362

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 85/351 (24%), Positives = 144/351 (41%), Gaps = 45/351 (12%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 3   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 52

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 53  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 108

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 109 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 168

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 169 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 227

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADL 288
           R++   A+D   DA +   ++  L    +++ + +  G         QP   + A+   L
Sbjct: 228 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPSEEEEAR---L 281

Query: 289 AAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
              +  A     I +G  T     E  +AQG ADLV   R  I++P+++ +
Sbjct: 282 MRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR 331


>1bwkA [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
          Length = 399

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 58/211 (27%), Positives = 102/211 (48%), Gaps = 9/211 (4%)

Query: 140 NQVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYG 199
           N   H+L +DEI  +I EY ++A+   AAG DGVE+++ +  LL  FL P SN R DEYG
Sbjct: 155 NNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSANGYLLNQFLDPHSNTRTDEYG 214

Query: 200 GDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKID 259
           G +  R RF LE++DA+   +G +  +G+R++ Y   +     AE   +A+     G+++
Sbjct: 215 GSIENRARFTLEVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE 273

Query: 260 YLSVVVGDNWGAPSYIQPHYYQP------AQWADLAAQVTRAV-SLPVIYTGRVTDPHTA 312
                 G        ++P    P       ++   +     ++   PVI  G        
Sbjct: 274 -KRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEV 332

Query: 313 EKVIAQGQADLVGMARAIITDPEIITKTAQG 343
            +   + +  L+G  R  I++P+++ +  +G
Sbjct: 333 VREEVKDKRTLIGYGRFFISNPDLVDRLEKG 363


>2hsaA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 376

 Score = 87.8 bits (216), Expect = 8e-20
 Identities = 86/361 (23%), Positives = 149/361 (41%), Gaps = 51/361 (14%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 3   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 52

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 53  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 108

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 109 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 168

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 169 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 227

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY--YQPAQWA 286
           R++   A+D   DA +   ++  L    +++ + +  G         QP Y  Y   +  
Sbjct: 228 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQTEAG 284

Query: 287 DLAAQVTRAVSLPVI---YTGR--VTDPHTAE---KVIAQGQADLVGMARAIITDPEIIT 338
            L ++   A  +  +   Y G    +  +T E   + +AQG ADLV   R  I++P+++ 
Sbjct: 285 RLGSEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVM 344

Query: 339 K 339
           +
Sbjct: 345 R 345


>2hsaB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 374

 Score = 87.8 bits (216), Expect = 8e-20
 Identities = 86/361 (23%), Positives = 149/361 (41%), Gaps = 51/361 (14%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+P ++G+ +L +R++  P               A  NI                    
Sbjct: 2   LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFLI 51

Query: 72  LENHLVPGFEPTGVGAA-ARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPH-- 128
            E  ++    PT  G     G+F      +  +K+ D +H  GA +  QL   G   H  
Sbjct: 52  TEGTMI---SPTSAGFPHVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHEV 107

Query: 129 ------GPSPTVTAYVANQ--------------VSHALDRDEIAWFINEYAESARRGKAA 168
                  P  +    ++N+                 A+   EI+  + +Y  SA     A
Sbjct: 108 YQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEA 167

Query: 169 GLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGV 228
           G DG+E+H  H  L++ FL    N R DEYGG LA R +F+ +++ A+ + +G D  +GV
Sbjct: 168 GFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGAD-RVGV 226

Query: 229 RMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY--YQPAQWA 286
           R++   A+D   DA +   ++  L    +++ + +  G         QP Y  Y   +  
Sbjct: 227 RVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQTEAG 283

Query: 287 DLAAQVTRAVSLPVI---YTGR--VTDPHTAE---KVIAQGQADLVGMARAIITDPEIIT 338
            L ++   A  +  +   Y G    +  +T E   + +AQG ADLV   R  I++P+++ 
Sbjct: 284 RLGSEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVM 343

Query: 339 K 339
           +
Sbjct: 344 R 344


>2g5wA [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
          Length = 363

 Score = 85.9 bits (211), Expect = 3e-19
 Identities = 87/360 (24%), Positives = 152/360 (42%), Gaps = 65/360 (18%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+  ++GR DL +R++  P          P+ A A+                       
Sbjct: 5   LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------- 42

Query: 72  LENHLVPG----FEPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIM 122
                 PG     E T V   + G   +P  Y  +++   +++ + +H  G ++  QL  
Sbjct: 43  YAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWH 102

Query: 123 QGG------MPHGPSPTVT-----------------AYVANQVSHALDRDEIAWFINEYA 159
            G        P+G SP  +                 ++V      AL+  EI   + +Y 
Sbjct: 103 VGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYC 162

Query: 160 ESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAE 219
            SA     AG DG+E+H  H  L++ FL    N R D+YGG +A R RFL ++++ + + 
Sbjct: 163 LSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSA 222

Query: 220 VGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY 279
           +G    +GVR++   A+D   DA +   ++  L   G ++ L    G N    +Y+  H 
Sbjct: 223 IGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQ---GVNGSKLAYL--HV 273

Query: 280 YQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITK 339
            QP + A L   +  A +   + +G   +     + + QG ADLV   R  I +P+++++
Sbjct: 274 TQPRE-AKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVSR 331


>2r14A [x.x.x] MORPHINONE REDUCTASE
          Length = 363

 Score = 85.5 bits (210), Expect = 4e-19
 Identities = 86/356 (24%), Positives = 143/356 (40%), Gaps = 66/356 (18%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LFTP+++G + LPNR++  P    +    +PD                         SA 
Sbjct: 4   LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASAG 49

Query: 72  LENHLVPGFEPTGVGAAARGVFRLPYFHDRIRK-----LTDTLHEAGAYVTAQLIMQGGM 126
           L        E T +   ARG    P      ++     + + +H  G  +  QL   G +
Sbjct: 50  LIIS-----EATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRV 104

Query: 127 PH------GPSPTVTAYVANQ-------------------VSHALDRDEIAWFINEYAES 161
            H      G  P   + +  +                      AL+ DEI   + +Y ++
Sbjct: 105 SHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQA 164

Query: 162 ARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVG 221
           A+R K AG D VE+HA +  L   FL+  +N R D+YGG +  R RF LE++DA+    G
Sbjct: 165 AQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFG 224

Query: 222 PDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQ 281
           P+  +G+R+  +  L G     +    A A    G++D   +         +Y+  H+ +
Sbjct: 225 PE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGL---------AYL--HFNE 269

Query: 282 PAQWAD-LAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEI 336
           P  + +    Q+ +     +IY G   D   A+  +    AD V   R  I +P++
Sbjct: 270 PDTYPEGFREQMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL 324


>1q45A [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE
          Length = 365

 Score = 85.1 bits (209), Expect = 5e-19
 Identities = 87/365 (23%), Positives = 150/365 (41%), Gaps = 73/365 (20%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LF+  ++GR DL +R++  P          P+ A A+                       
Sbjct: 5   LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------- 42

Query: 72  LENHLVPG----FEPTGVGAAARGVFRLP--YFHDRI---RKLTDTLHEAGAYVTAQLIM 122
                 PG     E T V   + G   +P  Y  +++   +++ + +H  G ++  QL  
Sbjct: 43  YAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWH 102

Query: 123 QGG------MPHGPSPTVT-----------------AYVANQVSHALDRDEIAWFINEYA 159
            G        P+G SP  +                 ++V      AL+  EI   + +Y 
Sbjct: 103 VGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYC 162

Query: 160 ESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAE 219
            SA     AG DG+E+H  H  L++ FL    N R D+YGG +A R RFL ++++ + + 
Sbjct: 163 LSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSA 222

Query: 220 VGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHY 279
           +G    +GVR++   A+D   DA +   ++  L   G ++ L    G N    +Y+  H 
Sbjct: 223 IGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQ---GVNGSKLAYL--HV 273

Query: 280 YQPAQWADLAAQVTRAVSLPVIYTGRVT-----DPHTAEKVIAQGQADLVGMARAIITDP 334
            QP +      +     SL + Y G        +     + + QG ADLV   R  I +P
Sbjct: 274 TQPRE-----EEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANP 328

Query: 335 EIITK 339
           +++++
Sbjct: 329 DLVSR 333


>3gx9A [x.x.x] MORPHINONE REDUCTASE
          Length = 364

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 85/355 (23%), Positives = 139/355 (39%), Gaps = 63/355 (17%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LFTP+++G + LPNR++  P    +    +PD                         SA 
Sbjct: 4   LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASAG 49

Query: 72  LENHLVPGFEPTGVGAAARGVFRLPYFHDRIRK-----LTDTLHEAGAYVTAQLIMQGGM 126
           L        E T +   ARG    P      ++     + + +H  G  +  QL   G +
Sbjct: 50  LIIS-----EATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRV 104

Query: 127 PH------GPSPTVTAYVANQ-------------------VSHALDRDEIAWFINEYAES 161
            H      G  P   + +  +                      AL+ DEI   + +Y ++
Sbjct: 105 SHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQA 164

Query: 162 ARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVG 221
           A+R K AG D VE+HA    L   FL+  +N R D+YGG +  R RF LE++DA+    G
Sbjct: 165 AQRAKRAGFDMVEVHAAAACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFG 224

Query: 222 PDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQ 281
           P+  +G+R+  +  L G     +    A A    G++D   +    ++  P    P  ++
Sbjct: 225 PE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGLAY-LHFNEPDITYPEGFR 279

Query: 282 PAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEI 336
                    Q+ +     +IY G   D   A+  +    AD V   R  I +P++
Sbjct: 280 --------EQMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL 325


>1gwjA [c.1.4] MORPHINONE REDUCTASE
          Length = 374

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 85/355 (23%), Positives = 141/355 (39%), Gaps = 58/355 (16%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISAA 71
           LFTP+++G + LPNR++  P    +    +PD                         SA 
Sbjct: 8   LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASAG 53

Query: 72  LENHLVPGFEPTGVGAAARGVFRLPYFHDRIRK-----LTDTLHEAGAYVTAQLIMQGGM 126
           L        E T +   ARG    P      ++     + + +H  G  +  QL   G +
Sbjct: 54  LIIS-----EATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRV 108

Query: 127 PH------GPSPTVTAYVANQ-------------------VSHALDRDEIAWFINEYAES 161
            H      G  P   + +  +                      AL+ D I   + +Y ++
Sbjct: 109 SHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVEDYRQA 168

Query: 162 ARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVG 221
           A+R K AG D VE+HA +  L   FL+  +N R D+YGG +  R RF LE++DA+    G
Sbjct: 169 AQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFG 228

Query: 222 PDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQ 281
           P+  +G+R+  +  L G     +    A A    G++D   +    ++  P +I      
Sbjct: 229 PE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGLAY-LHFNEPDWIGGDITY 283

Query: 282 PAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEI 336
           P  + +   Q+ +     +IY G   D   A+  +    AD V   R  I +P++
Sbjct: 284 PEGFRE---QMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL 334


>3gkaB [x.x.x] N-ETHYLMALEIMIDE REDUCTASE
          Length = 351

 Score = 82.0 bits (201), Expect = 4e-18
 Identities = 66/223 (29%), Positives = 92/223 (41%), Gaps = 33/223 (14%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATP-IGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA 70
           LF P+ +G + L NRI+  P      G+  +P+   A                     SA
Sbjct: 5   LFDPLTIGDLTLANRIIMAPLTRARAGDTRTPNALMA--------------RYYAERASA 50

Query: 71  ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQL---------- 120
            L         P GVG A+      P   D  R +TD +H AG  +  QL          
Sbjct: 51  GLIISEATSVTPQGVGYASTPGIWSPEQVDGWRLVTDAVHAAGGRIFLQLWHVGRVSDPV 110

Query: 121 IMQGGMPHGPSPTVTAYVANQVS--------HALDRDEIAWFINEYAESARRGKAAGLDG 172
            + G +P  PS        + V          AL+ DEI   +  +   A   +AAG DG
Sbjct: 111 FLDGALPVAPSAIAPGGHVSLVRPQRPYVTPRALELDEIPGVVAAFRRGAENARAAGFDG 170

Query: 173 VELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDA 215
           VE+H  +  LL+ FL  ++N R D YGG +  R R LLE++DA
Sbjct: 171 VEVHGANGYLLDQFLQDSANRRTDAYGGSIENRARLLLEVVDA 213


>3gkaA [x.x.x] N-ETHYLMALEIMIDE REDUCTASE
          Length = 350

 Score = 82.0 bits (201), Expect = 4e-18
 Identities = 66/223 (29%), Positives = 92/223 (41%), Gaps = 33/223 (14%)

Query: 12  LFTPIRVGRMDLPNRIMATPHATP-IGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA 70
           LF P+ +G + L NRI+  P      G+  +P+   A                     SA
Sbjct: 4   LFDPLTIGDLTLANRIIMAPLTRARAGDTRTPNALMA--------------RYYAERASA 49

Query: 71  ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQL---------- 120
            L         P GVG A+      P   D  R +TD +H AG  +  QL          
Sbjct: 50  GLIISEATSVTPQGVGYASTPGIWSPEQVDGWRLVTDAVHAAGGRIFLQLWHVGRVSDPV 109

Query: 121 IMQGGMPHGPSPTVTAYVANQVS--------HALDRDEIAWFINEYAESARRGKAAGLDG 172
            + G +P  PS        + V          AL+ DEI   +  +   A   +AAG DG
Sbjct: 110 FLDGALPVAPSAIAPGGHVSLVRPQRPYVTPRALELDEIPGVVAAFRRGAENARAAGFDG 169

Query: 173 VELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDA 215
           VE+H  +  LL+ FL  ++N R D YGG +  R R LLE++DA
Sbjct: 170 VEVHGANGYLLDQFLQDSANRRTDAYGGSIENRARLLLEVVDA 212


>1vjiA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE (OPR1)
          Length = 351

 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 88/359 (24%), Positives = 145/359 (40%), Gaps = 79/359 (22%)

Query: 12  LFTPIRVGRMDLPNRIMATP--HATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXIS 69
           L TP ++GR +L +R++  P       GN+  P  A                        
Sbjct: 4   LLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAA------------------------ 39

Query: 70  AALENHLVPG----FEPTGVGAAARGVFRLPYFHDRI-----RKLTDTLHEAGAYVTAQL 120
                   PG     E TGV   A+G    P    +      + + D +H  G     Q+
Sbjct: 40  IYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQI 99

Query: 121 ------IMQGGMPHGPSPT-------VTAYVANQVSHALDR-------DEIAWFINEYAE 160
                    G  P+G +P        +    +N +  AL         +EI   +N++  
Sbjct: 100 WHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRL 159

Query: 161 SARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAIRAEV 220
           +AR    AG DGVE+H  +  L++ F+    N R DEYGG L  R +F LEI+DA+  E+
Sbjct: 160 AARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEI 219

Query: 221 GPDFTLGVRMNLY-EALDGG--YDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQP 277
           GPD  +G+R++ + + ++ G     A G+ +A++L   G I Y  V+           + 
Sbjct: 220 GPD-RVGIRLSPFADYMESGDTNPGALGLYMAESLNKYG-ILYCHVIEA---------RM 268

Query: 278 HYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEI 336
           H   P         + +A     I  G  T      + +++G+ DLV   R  + +P++
Sbjct: 269 HTLMP---------MRKAFKGTFISAGGFT-REDGNEAVSKGRTDLVAYGRWFLANPDL 317


>1icsA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 353

 Score = 77.8 bits (190), Expect = 8e-17
 Identities = 54/191 (28%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 148 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 207

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D      
Sbjct: 208 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC-- 264

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                       H  +P    +    + +A     I  G   D     + + + +ADLV 
Sbjct: 265 ------------HVVEPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVA 309

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 310 YGRLFISNPDL 320


>1icqA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 353

 Score = 77.8 bits (190), Expect = 8e-17
 Identities = 54/191 (28%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 147 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 206

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D      
Sbjct: 207 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC-- 263

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                       H  +P    +    + +A     I  G   D     + + + +ADLV 
Sbjct: 264 ------------HVVEPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVA 308

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 309 YGRLFISNPDL 319


>1icpB [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 358

 Score = 77.8 bits (190), Expect = 8e-17
 Identities = 52/191 (27%), Positives = 82/191 (42%), Gaps = 15/191 (7%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 148 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 207

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D      
Sbjct: 208 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC-- 264

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                       H  +P      +    R             D     + + + +ADLV 
Sbjct: 265 ------------HVVEPRMKTTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVA 312

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 313 YGRLFISNPDL 323


>3hgrB [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 354

 Score = 77.8 bits (190), Expect = 8e-17
 Identities = 54/191 (28%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 148 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 207

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D      
Sbjct: 208 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC-- 264

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                       H  +P    +    + +A     I  G   D     + + + +ADLV 
Sbjct: 265 ------------HVVEPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVA 309

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 310 YGRLFISNPDL 320


>1icqB [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 351

 Score = 77.4 bits (189), Expect = 1e-16
 Identities = 53/191 (27%), Positives = 85/191 (44%), Gaps = 19/191 (9%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 147 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 206

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D      
Sbjct: 207 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLA---- 261

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                        Y    +  +    + +A     I  G   D     + + + +ADLV 
Sbjct: 262 -------------YCHVVEPRESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVA 307

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 308 YGRLFISNPDL 318


>1icpA [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
          Length = 358

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 54/191 (28%), Positives = 88/191 (46%), Gaps = 14/191 (7%)

Query: 146 LDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGR 205
           L  DEI   +NE+  +AR    AG DGVE+H  H  L++ F+    N R D+YGG L  R
Sbjct: 148 LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENR 207

Query: 206 MRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVV 265
            RF LEI++A+  E+G D  +G+R++ +   +   D          +E+  K D     V
Sbjct: 208 CRFALEIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHV 266

Query: 266 GDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVG 325
                    ++P   +     +    + +A     I  G   D     + + + +ADLV 
Sbjct: 267 ---------VEP---RMKTCTESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVA 313

Query: 326 MARAIITDPEI 336
             R  I++P++
Sbjct: 314 YGRLFISNPDL 324


>2h8zA [x.x.x] XENOBIOTIC REDUCTASE A
          Length = 359

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 61/208 (29%), Positives = 90/208 (43%), Gaps = 10/208 (4%)

Query: 131 SPTVTAYVAN--QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLS 188
           +P+  A+ A+  +V   +  D+IA    ++          G + +ELH  H  L + F S
Sbjct: 130 APSAIAFGAHLPKVPREMTLDDIARVKQDFVXXXXXXXXXGFEWIELHFAHGYLGQSFFS 189

Query: 189 PASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAA--EGV 246
             SN R D YGG    R RFLLE + A+R     +  L  R  + E  DG  +    E +
Sbjct: 190 EHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLE-YDGRDEQTLEESI 248

Query: 247 DIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRV 306
           ++A+  +A G +D LSV VG  +  P    P  + PA    +A +V R   LPV      
Sbjct: 249 ELARRFKA-GGLDLLSVSVG--FTIPDTNIP--WGPAFMGPIAERVRREAKLPVTSAWGF 303

Query: 307 TDPHTAEKVIAQGQADLVGMARAIITDP 334
             P              V + RA + DP
Sbjct: 304 GTPXXXXXXXXXXXXXXVSVGRAHLADP 331


>2h8xA [x.x.x] XENOBIOTIC REDUCTASE A
          Length = 358

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 61/208 (29%), Positives = 90/208 (43%), Gaps = 10/208 (4%)

Query: 131 SPTVTAYVAN--QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLS 188
           +P+  A+ A+  +V   +  D+IA    ++          G + +ELH  H  L + F S
Sbjct: 129 APSAIAFGAHLPKVPREMTLDDIARVKQDFVXXXXXXXXXGFEWIELHFAHGYLGQSFFS 188

Query: 189 PASNHRDDEYGGDLAGRMRFLLEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAA--EGV 246
             SN R D YGG    R RFLLE + A+R     +  L  R  + E  DG  +    E +
Sbjct: 189 EHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLE-YDGRDEQTLEESI 247

Query: 247 DIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRV 306
           ++A+  +A G +D LSV VG  +  P    P  + PA    +A +V R   LPV      
Sbjct: 248 ELARRFKA-GGLDLLSVSVG--FTIPDTNIP--WGPAFMGPIAERVRREAKLPVTSAWGF 302

Query: 307 TDPHTAEKVIAQGQADLVGMARAIITDP 334
             P              V + RA + DP
Sbjct: 303 GTPXXXXXXXXXXXXXXVSVGRAHLADP 330


>2iidA [c.3.1 - d.16.1 (1f8rA)] L-AMINO-ACID OXIDASE
          Length = 483

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 384 LPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMR 430
           L     P+ V++VG G AG+  A +LA  GH+VT+ E  E+ GG++R
Sbjct: 24  LKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVR 70


>1f8sA [c.3.1 - d.16.1] L-AMINO ACID OXIDASE
          Length = 482

 Score = 43.1 bits (100), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 384 LPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMR 430
           L     P+ V++VG G AG+  A +LA  GH+VT+ E  E+ GG++R
Sbjct: 23  LKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVR 69


>1reoA [c.3.1 - d.16.1] AHPLAAO
          Length = 484

 Score = 42.0 bits (97), Expect = 5e-06
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 384 LPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMR 430
           L     P+ V+VVG G +G+  A +L+  GH+VT+ E  E+ GG++R
Sbjct: 25  LKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVR 71


>2rabB [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 452

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 381 DGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           DG     + P+RV ++G G  G+ELAGLL   G EVT+   E++L
Sbjct: 154 DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRL 198


>2rabA [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 451

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 381 DGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           DG     + P+RV ++G G  G+ELAGLL   G EVT+   E++L
Sbjct: 154 DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRL 198


>2r9zB [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 453

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 381 DGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           DG     + P+RV ++G G  G+ELAGLL   G EVT+   E++L
Sbjct: 155 DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRL 199


>2r9zA [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 451

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 381 DGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           DG     + P+RV ++G G  G+ELAGLL   G EVT+   E++L
Sbjct: 153 DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRL 197


>3e1tA [x.x.x] HALOGENASE
          Length = 437

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 393 VLVVGGGPAGMELAGLLAERGHEVTLWERE 422
           ++V+GGGP G  LA  +A RGH V L ERE
Sbjct: 6   LIVIGGGPGGSTLASFVAMRGHRVLLLERE 35


>1wamA [x.x.x] UDP-GALACTOPYRANOSE MUTASE
          Length = 377

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 2   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 38


>1usjA [c.4.1 - d.16.1] UDP-GALACTOPYRANOSE MUTASE
          Length = 376

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 2   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 38


>3intB [x.x.x] PROBABLE UDP-GALACTOPYRANOSE MUTASE
          Length = 374

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 3   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 39


>3inrB [x.x.x] UDP-GALACTOPYRANOSE MUTASE
          Length = 378

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 3   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 39


>3gf4A [x.x.x] UDP-GALACTOPYRANOSE MUTASE
          Length = 383

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 3   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 39


>2eq6A [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
          Length = 460

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 390 PRRVLVVGGGPAGMELAGLLAERGHEVTLWE 420
           P+R+LV+GGG  G+EL  +    G EVTL E
Sbjct: 166 PKRLLVIGGGAVGLELGQVYRRLGAEVTLIE 196


>2bi7A [x.x.x] UDP-GALACTOPYRANOSE MUTASE
          Length = 383

 Score = 35.0 bits (79), Expect = 6e-04
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 391 RRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGG 427
           +++L+VG G +G  +   LAE+GH+V + ++ + +GG
Sbjct: 3   KKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGG 39


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.316    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 874,135,163
Number of extensions: 34165897
Number of successful extensions: 80340
Number of sequences better than 1.0e-03: 2731
Number of HSP's gapped: 77597
Number of HSP's successfully gapped: 3344
Length of query: 594
Length of database: 100,000
Length adjustment: 1
Effective length of query: 593
Effective length of database: 33,550
Effective search space: 19895150
Effective search space used: 19895150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)