BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ55822.1 tfus0 AAZ55822.1 GIB00263CH01 "transcriptional
regulator, GntR family"
         (239 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2di3B [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY               45   2e-07
2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY               45   2e-07
2hs5A [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR                  37   6e-05

>2di3B [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
          Length = 230

 Score = 45.4 bits (106), Expect = 2e-07
 Identities = 50/190 (26%), Positives = 76/190 (40%), Gaps = 23/190 (12%)

Query: 41  VSRLTVREAVKVLRTKNIVRVKRGRG-----TYVNAPEHWTDLELILRMAQRRSXXXXXX 95
           VSR ++REA++VL     +    G G         AP     L + L++   +       
Sbjct: 39  VSRSSLREALRVLEALGTISTATGSGPRSGTIITAAPGQALSLSVTLQLVTNQ----VGH 94

Query: 96  XXXXEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADDASTFARAETAFHETI 155
               E R++LE  AA   +  R D D+A       + D ++  +D   F R +  FH  I
Sbjct: 95  HDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMD-DPSLPLED---FLRFDAEFHVVI 150

Query: 156 VRSCGNVFIPAICAPVDRLLL----HLHARTATIAHIR---VRAQSHHRRILSGIAAGSP 208
            +   N   P I   ++ L L    H  AR   +   R    R Q  HR IL+ + AG  
Sbjct: 151 SKGAEN---PLISTLMEALRLSVADHTVARARALPDWRATSARLQKEHRAILAALRAGES 207

Query: 209 AAARDAMRAH 218
             A   ++ H
Sbjct: 208 TVAATLIKEH 217


>2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
          Length = 231

 Score = 45.4 bits (106), Expect = 2e-07
 Identities = 50/190 (26%), Positives = 76/190 (40%), Gaps = 23/190 (12%)

Query: 41  VSRLTVREAVKVLRTKNIVRVKRGRG-----TYVNAPEHWTDLELILRMAQRRSXXXXXX 95
           VSR ++REA++VL     +    G G         AP     L + L++   +       
Sbjct: 39  VSRSSLREALRVLEALGTISTATGSGPRSGTIITAAPGQALSLSVTLQLVTNQ----VGH 94

Query: 96  XXXXEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADDASTFARAETAFHETI 155
               E R++LE  AA   +  R D D+A       + D ++  +D   F R +  FH  I
Sbjct: 95  HDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMD-DPSLPLED---FLRFDAEFHVVI 150

Query: 156 VRSCGNVFIPAICAPVDRLLL----HLHARTATIAHIR---VRAQSHHRRILSGIAAGSP 208
            +   N   P I   ++ L L    H  AR   +   R    R Q  HR IL+ + AG  
Sbjct: 151 SKGAEN---PLISTLMEALRLSVADHTVARARALPDWRATSARLQKEHRAILAALRAGES 207

Query: 209 AAARDAMRAH 218
             A   ++ H
Sbjct: 208 TVAATLIKEH 217


>2hs5A [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR
          Length = 205

 Score = 37.0 bits (84), Expect = 6e-05
 Identities = 42/188 (22%), Positives = 73/188 (38%), Gaps = 22/188 (11%)

Query: 40  DVSRLTVREAVKVLRTKNIVRVKRGRGTYVNAPEHWTDLELILRMAQRRSXXXXXXXXXX 99
           DVSR TVREA ++L    +V  +  RG +V  P      EL +                 
Sbjct: 36  DVSRNTVREAFQILIEDRLVAHELNRGVFVRVPTAEDITELYI----------------- 78

Query: 100 EVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADDASTFARAETAFHETIVRSC 159
             RR++E   A +     +  DL+ +   +   D+  A +D +    A+  FH  +    
Sbjct: 79  -CRRVVE--CAGVNGFDPATGDLSRVAEALDLADERYAVEDWTGVGTADIHFHSALASLN 135

Query: 160 GNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAAARDAMRAHF 219
            +  I  + +  +   L  H   A   H     ++H   I   +AAG+  AA   ++ + 
Sbjct: 136 NSNRIDELRSVWNEARLVFHVDDAHRFHGPYLTRNH--EIYDALAAGNTEAAGQLLKTYL 193

Query: 220 DQLAEDLL 227
           +     +L
Sbjct: 194 EDAEAQIL 201


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,009,843,316
Number of extensions: 39351001
Number of successful extensions: 100755
Number of sequences better than 1.0e-03: 3228
Number of HSP's gapped: 96468
Number of HSP's successfully gapped: 5207
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)