BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ56286.1 tfus0 AAZ56286.1 GIB00263CH01 "aminotransferase"
         (430 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bkgA [c.67.1] ASPARTATE AMINOTRANSFERASE                             140   5e-36
1b5oA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                   139   2e-35
1b5pA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                   137   8e-35
1bjwA [c.67.1] ASPARTATE AMINOTRANSFERASE                             134   4e-34
1gc3A [c.67.1] ASPARTATE AMINOTRANSFERASE                             133   8e-34
5bj3A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                   127   5e-32
5bj4A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                   125   3e-31
1j32A [c.67.1] ASPARTATE AMINOTRANSFERASE                             116   1e-28
1djuB [c.67.1] AROMATIC AMINOTRANSFERASE                              112   3e-27
1djuA [c.67.1] AROMATIC AMINOTRANSFERASE                              111   4e-27
1gd9A [c.67.1] ASPARTATE AMINOTRANSFERASE                             110   6e-27
1o4sB [c.67.1] ASPARTATE AMINOTRANSFERASE                              89   2e-20
1o4sA [c.67.1] ASPARTATE AMINOTRANSFERASE                              89   2e-20
1xi9C [c.67.1] PUTATIVE TRANSAMINASE                                   79   3e-17
1xi9A [c.67.1] PUTATIVE TRANSAMINASE                                   78   4e-17
1xi9B [c.67.1] PUTATIVE TRANSAMINASE                                   78   5e-17
1v2eB [c.67.1] GLUTAMINE AMINOTRANSFERASE                              76   2e-16
1v2eA [c.67.1] GLUTAMINE AMINOTRANSFERASE                              76   2e-16
1v2dA [c.67.1] GLUTAMINE AMINOTRANSFERASE                              75   5e-16
1bw0B [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)                     68   6e-14
1bw0A [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)                     68   6e-14
1w7nA [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I                 67   7e-14
1w7lA [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I                 66   2e-13
1u08B [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL                      65   4e-13
1u08A [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL                      65   4e-13
2z1zA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      65   5e-13
3ei7B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      65   5e-13
3ei7A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      65   5e-13
3ei6B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      65   5e-13
3ei6A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      65   5e-13
3dydB [x.x.x] TYROSINE AMINOTRANSFERASE                                64   8e-13
3dydA [x.x.x] TYROSINE AMINOTRANSFERASE                                64   8e-13
3b46B [x.x.x] AMINOTRANSFERASE BNA3                                    64   1e-12
3b46A [x.x.x] AMINOTRANSFERASE BNA3                                    64   1e-12
3eiaB [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      63   1e-12
3eiaA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      63   1e-12
3fvsA [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1                  63   2e-12
3ei9B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      63   2e-12
3ei9A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      63   2e-12
3ei8A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      63   2e-12
3jtxB [x.x.x] AMINOTRANSFERASE                                         62   3e-12
2gb3F [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2gb3E [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2gb3D [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2gb3C [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2gb3B [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2gb3A [x.x.x] ASPARTATE AMINOTRANSFERASE                               62   3e-12
2o0rB [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE                       62   4e-12
2o0rA [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE                       62   4e-12
3jtxA [x.x.x] AMINOTRANSFERASE                                         62   4e-12
2z61A [x.x.x] PROBABLE ASPARTATE AMINOTRANSFERASE 2                    61   5e-12
1yiyA [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE                    59   3e-11
2r5cB [x.x.x] KYNURENINE AMINOTRANSFERASE                              59   3e-11
3e2yA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3                   58   4e-11
2z20B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      58   6e-11
2z20A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      58   6e-11
1yizA [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE                    57   8e-11
2r5cA [x.x.x] KYNURENINE AMINOTRANSFERASE                              57   8e-11
3e2fA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3                   57   1e-10
3cq5B [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    56   2e-10
3cq5A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    56   2e-10
3cq4B [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    56   2e-10
3cq4A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    56   2e-10
3h14A [x.x.x] AMINOTRANSFERASE, CLASSES I AND II                       55   4e-10
2zc0A [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE                          54   6e-10
3ihjA [x.x.x] ALANINE AMINOTRANSFERASE 2                               54   1e-09
1iayA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2            52   4e-09
1iaxA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2            52   4e-09
3eleC [x.x.x] AMINO TRANSFERASE                                        50   9e-09
3eleA [x.x.x] AMINO TRANSFERASE                                        50   9e-09
2douB [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE                       50   2e-08
2douA [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE                       50   2e-08
3cq6A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    50   2e-08
1ynuA [x.x.x] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE               47   1e-07
1m7yA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE              45   3e-07
1m4nA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE              45   3e-07
1b8gB [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE              45   3e-07
1b8gA [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE              45   3e-07
2zyjA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2zg5A [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2z1yB [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2z1yA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2egyD [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2egyC [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
2egyB [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
3cbfA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       44   7e-07
1vp4B [c.67.1] AMINOTRANSFERASE, PUTATIVE                              42   3e-06
1vp4A [c.67.1] AMINOTRANSFERASE, PUTATIVE                              42   3e-06
2zy2A [x.x.x] L-ASPARTATE 4-CARBOXYLYASE                               41   7e-06
1c7nA [c.67.1] CYSTALYSIN                                              40   1e-05
2zy5F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy5E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy5D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy5B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy5A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4C [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy4A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3C [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
2zy3A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE                           39   3e-05
1lkcA [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE                 37   1e-04
1lc8A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE                 37   1e-04
1lc7A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE                 37   1e-04
1lc5A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE                 37   1e-04
3dzzB [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S            34   7e-04
3dzzA [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S            34   7e-04
3fddA [x.x.x] L-ASPARTATE-BETA-DECARBOXYLASE                           34   0.001
1d2fB [c.67.1] MALY PROTEIN                                            34   0.001
1d2fA [c.67.1] MALY PROTEIN                                            34   0.001

>1bkgA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 382

 Score =  140 bits (354), Expect = 5e-36
 Identities = 126/382 (32%), Positives = 179/382 (46%), Gaps = 38/382 (9%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIR 61
           SAT+AVN      R QG+ ++ L  GE        V    R AL+ G  +  Y P AGI 
Sbjct: 14  SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIP 71

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQ 117
           ELREA A  + R  GL   P+  +   G K  L+ L  AI   G +V + +P WVSY   
Sbjct: 72  ELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEM 131

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
              +GG  + V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  
Sbjct: 132 VRFAGGVVVEVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEV 185

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
           +  L  +A E D  ++SDEIY  L+++      SP   APE T+   G +K  A+ GWRI
Sbjct: 186 LEALARLAVEHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAKAFAMTGWRI 243

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A  P     + +  A+  ++S+  +SP    Q A   A          V  +R  +  
Sbjct: 244 GYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRR 298

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGM 355
                           + P  AFY+  D                 P+  R    L   G+
Sbjct: 299 RRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGV 346

Query: 356 GVLPAVEFGESTHALRVRVATS 377
            V+P  +F    H +R+  ATS
Sbjct: 347 AVVPGTDFAAFGH-VRLSYATS 367


>1b5oA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 382

 Score =  139 bits (349), Expect = 2e-35
 Identities = 125/382 (32%), Positives = 178/382 (46%), Gaps = 38/382 (9%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIR 61
           SAT+AVN      R QG+ ++ L  GE        V    R AL+ G  +  Y P AGI 
Sbjct: 14  SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIP 71

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQ 117
           ELREA A  + R  GL   P+  +   G    L+ L  AI   G +V + +P WVSY   
Sbjct: 72  ELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEM 131

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
              +GG  + V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  
Sbjct: 132 VRFAGGVVVEVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEV 185

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
           +  L  +A E D  ++SDEIY  L+++      SP   APE T+   G +K  A+ GWRI
Sbjct: 186 LEALARLAVEHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAKAFAMTGWRI 243

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A  P     + +  A+  ++S+  +SP    Q A   A          V  +R  +  
Sbjct: 244 GYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRR 298

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGM 355
                           + P  AFY+  D                 P+  R    L   G+
Sbjct: 299 RRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGV 346

Query: 356 GVLPAVEFGESTHALRVRVATS 377
            V+P  +F    H +R+  ATS
Sbjct: 347 AVVPGTDFAAFGH-VRLSYATS 367


>1b5pA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 382

 Score =  137 bits (344), Expect = 8e-35
 Identities = 124/382 (32%), Positives = 177/382 (46%), Gaps = 38/382 (9%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIR 61
           SAT+AVN      R QG+ ++ L  GE        V    R AL+ G  +  Y P AGI 
Sbjct: 14  SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIP 71

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQ 117
           ELREA A  + R  GL   P+  +   G    L+ L  AI   G +V + +P WVSY   
Sbjct: 72  ELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEM 131

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
              +GG  + V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  
Sbjct: 132 VRFAGGVVVEVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEV 185

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
           +  L  +A E D  ++SDEIY  L+++      SP   APE T+   G +K  A+ GWRI
Sbjct: 186 LEALARLAVEHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAKAFAMTGWRI 243

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A  P     + +  A+  ++ +  +SP    Q A   A          V  +R  +  
Sbjct: 244 GYACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRR 298

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGM 355
                           + P  AFY+  D                 P+  R    L   G+
Sbjct: 299 RRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGV 346

Query: 356 GVLPAVEFGESTHALRVRVATS 377
            V+P  +F    H +R+  ATS
Sbjct: 347 AVVPGTDFAAFGH-VRLSYATS 367


>1bjwA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 381

 Score =  134 bits (338), Expect = 4e-34
 Identities = 125/382 (32%), Positives = 178/382 (46%), Gaps = 39/382 (10%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIR 61
           SAT+AVN      R QG+ ++ L  GE        V    R AL+ G  +  Y P AGI 
Sbjct: 14  SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIP 71

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQ 117
           ELREA A  + R  GL   P+  +   G K  L+ L  AI   G +V + +P WVSY   
Sbjct: 72  ELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEM 131

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
              +GG  + V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  
Sbjct: 132 VRFAGGVVVEVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEV 185

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
           +  L  +A E D  ++SDEIY  L+++      SP   APE T+   G +   A+ GWRI
Sbjct: 186 LEALARLAVEHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAA-FAMTGWRI 242

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A  P     + +  A+  ++S+  +SP    Q A   A          V  +R  +  
Sbjct: 243 GYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRR 297

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGM 355
                           + P  AFY+  D                 P+  R    L   G+
Sbjct: 298 RRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGV 345

Query: 356 GVLPAVEFGESTHALRVRVATS 377
            V+P  +F    H +R+  ATS
Sbjct: 346 AVVPGTDFAAFGH-VRLSYATS 366


>1gc3A [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 382

 Score =  133 bits (335), Expect = 8e-34
 Identities = 122/381 (32%), Positives = 175/381 (45%), Gaps = 38/381 (9%)

Query: 7   ATLAVNEALARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIRE 62
           A +AVN      R QG+ ++ L  GE        V    R AL+ G  +  Y P AGI E
Sbjct: 15  AVVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIPE 72

Query: 63  LREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQS 118
           LREA A  + R  GL   P+  +   G    L+ L  AI   G +V + +P WVSY    
Sbjct: 73  LREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV 132

Query: 119 HLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTV 178
             +GG  + V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  +
Sbjct: 133 RFAGGVVVEVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEVL 186

Query: 179 RRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
             L  +A E D  ++SDEIY  L+++      SP   APE T+   G +K  A+ GWRIG
Sbjct: 187 EALARLAVEHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAKAFAMTGWRIG 244

Query: 239 VARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLX 298
            A  P     + +  A+  ++ +  +SP    Q A   A          V  +R  +   
Sbjct: 245 YACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR 299

Query: 299 XXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGMG 356
                          + P  AFY+  D                 P+  R    L   G+ 
Sbjct: 300 RDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGVA 347

Query: 357 VLPAVEFGESTHALRVRVATS 377
           V+P  +F    H +R+  ATS
Sbjct: 348 VVPGTDFAAFGH-VRLSYATS 367


>5bj3A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 363

 Score =  127 bits (320), Expect = 5e-32
 Identities = 119/373 (31%), Positives = 171/373 (45%), Gaps = 38/373 (10%)

Query: 15  LARRRSQGLPVLPLGFGEAGLP----VHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY 70
           L+RR     P++ L  GE        V    R AL+ G  +  Y P AGI ELREA A  
Sbjct: 4   LSRRVQAMKPLVALTAGEPDFDTPEHVKEAARRALAQG--KTKYAPPAGIPELREALAEK 61

Query: 71  WERR-GLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPL 126
           + R  GL   P+  +   G    L+ L  AI   G +V + +P WVSY      +GG  +
Sbjct: 62  FRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV 121

Query: 127 FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQ 186
            V T P +G VP+P+ + +A+T         +A++   P+NPTG V  +  +  L  +A 
Sbjct: 122 EVETLPEEGFVPDPERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAV 175

Query: 187 ELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSD 246
           E D  ++SDEIY  L+++      SP   APE T+   G +K  A+ GWRIG A  P   
Sbjct: 176 EHDFYLVSDEIYEHLLYEGEH--FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP--- 230

Query: 247 TGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXX 306
             + +  A+  ++ +  +SP    Q A   A          V  +R  +           
Sbjct: 231 --KEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDXXXXXX 288

Query: 307 XXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRML--LDRYGMGVLPAVEFG 364
                  + P  AFY+  D                 P+  R    L   G+ V+P  +F 
Sbjct: 289 XXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAERLLEAGVAVVPGTDFA 336

Query: 365 ESTHALRVRVATS 377
              H +R+  ATS
Sbjct: 337 AFGH-VRLSYATS 348


>5bj4A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 366

 Score =  125 bits (313), Expect = 3e-31
 Identities = 112/347 (32%), Positives = 161/347 (46%), Gaps = 34/347 (9%)

Query: 37  VHPVMRDALSTGGDQNGYGPVAGIRELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYA 95
           V    R AL+ G  +  Y P AGI ELREA A  + R  GL   P+  +   G    L+ 
Sbjct: 33  VKEAARRALAQG--KTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFN 90

Query: 96  LLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARA 152
           L  AI   G +V + +P WVSY      +GG  + V T P +G VP+P+ + +A+T    
Sbjct: 91  LFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPR-- 148

Query: 153 AGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSP 212
                +A++   P+NPTG V  +  +  L  +A E D  ++SDEIY  L+++      SP
Sbjct: 149 ----TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--FSP 202

Query: 213 AEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQR 272
              APE T+   G +K  A+ GWRIG A  P     + +  A+  ++ +  +SP    Q 
Sbjct: 203 GRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSRQSTTSPDTIAQW 257

Query: 273 AAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREW 332
           A   A          V  +R  +                  + P  AFY+  D       
Sbjct: 258 ATLEALTNQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS----- 312

Query: 333 LGEAHGVTTGPELTRML--LDRYGMGVLPAVEFGESTHALRVRVATS 377
                     P+  R    L   G+ V+P  +F    H +R+  ATS
Sbjct: 313 -------PIAPDEVRAAERLLEAGVAVVPGTDFAAFGH-VRLSYATS 351


>1j32A [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 388

 Score =  116 bits (290), Expect = 1e-28
 Identities = 106/391 (27%), Positives = 169/391 (43%), Gaps = 43/391 (10%)

Query: 2   SVAVSATLAVNEALARRRSQGLPVLPLGFGEAGL--PVHPVMRDALSTGGDQNGYGPVAG 59
           SV+ S TL ++      +++G+ V     GE     P H V     +    +  YGP AG
Sbjct: 9   SVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYGPAAG 68

Query: 60  IRELREAAAGYWER-RGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYA 115
              LREA A   +R  GL    D ++   G K  ++ L+LA+   G +V I AP WVSY 
Sbjct: 69  EPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYP 128

Query: 116 AQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASR 175
               L+ G P+ +PT         P+ + QA+T         + ++   P NPTG V + 
Sbjct: 129 EMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKT------KLLVFNTPSNPTGMVYTP 182

Query: 176 GTVRRLTEVAQELDLVIISDEIYRDLVHDPT--TVVHSPAEFAPERTVITTGLSKNLALG 233
             VR + +VA E  L ++SDEIY  +++D      + + +  A ER+V+ +G +K  A+ 
Sbjct: 183 DEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEAYERSVVCSGFAKTYAMT 242

Query: 234 GWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPV----QRAAAYAFQEPAEIVD--L 287
           GWR+G    P           L+  A++I    +  V    Q  A  A++   + V   L
Sbjct: 243 GWRVGFLAGP---------VPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEML 293

Query: 288 VARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTR 347
            A + R   +                  P  AFY++P           A    +  +   
Sbjct: 294 AAFAERRRYMLDALNAMPGLECP----KPDGAFYMFPSI---------AKTGRSSLDFCS 340

Query: 348 MLLDRYGMGVLPAVEFGESTHALRVRVATSL 378
            LLD++ +  +P   FG +   +R+  AT L
Sbjct: 341 ELLDQHQVATVPGAAFG-ADDCIRLSYATDL 370


>1djuB [c.67.1] AROMATIC AMINOTRANSFERASE
          Length = 373

 Score =  112 bits (279), Expect = 3e-27
 Identities = 109/397 (27%), Positives = 172/397 (43%), Gaps = 44/397 (11%)

Query: 14  ALARRRSQGLPVLPLGFGEAGL--PVH--PVMRDALSTGGDQNGYGPVAGIRELREAAAG 69
           AL+ R      V+ LG GE     P H     ++AL  G     YGP  G+ ELREA A 
Sbjct: 1   ALSDRLELVSDVISLGIGEPDFDTPQHIKEYAKEALDKG--LTHYGPNIGLLELREAIAE 58

Query: 70  YWERR-GLPTDPD---LVVAGPGSKPLL-YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQ 124
             +++ G+  DP    +V+ G     L+  +  L  G +V I  P++VSYA    L+GG+
Sbjct: 59  KLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGK 118

Query: 125 PLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEV 184
           P+ VPT          D L + VT+        RA+I   P NPTG V ++  +  + + 
Sbjct: 119 PVEVPTYEEDEFRLNVDELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADF 172

Query: 185 AQELDLVIISDEIYRDLVHDPT---TVVHSPAEFAPERTVITTGLSKNLALGGWRIGVAR 241
             E DL++ISDE+Y   ++D     ++      F  ERT+   G SK  A+ GWR+G   
Sbjct: 173 VVEHDLIVISDEVYEHFIYDDARHYSIASLDGMF--ERTITVNGFSKTFAMTGWRLGFVA 230

Query: 242 LPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXX 301
            P     R +   +        + P   +Q AAA A ++       V   R+ +      
Sbjct: 231 APSWIIERMVKFQMYNA-----TCPVTFIQYAAAKALKDERS-WKAVEEMRKEYDRRRKL 284

Query: 302 XXXXXXXXXXPVIAPQAAFYLYP---DFGVWREWLGEAHGVTTGPELTRMLLDRYGMGVL 358
                     P + P+ AFY++P   D G+            T  + + ++L    + V+
Sbjct: 285 VWKRLNEMGLPTVKPKGAFYIFPRIRDTGL------------TSKKFSELMLKEARVAVV 332

Query: 359 PAVEFGESTHA-LRVRVATSLLYGESEAQRYSALAAE 394
           P   FG++    +R+  AT+    E   +R   +  E
Sbjct: 333 PGSAFGKAGEGYVRISYATAYEKLEEAMERMERVLKE 369


>1djuA [c.67.1] AROMATIC AMINOTRANSFERASE
          Length = 375

 Score =  111 bits (277), Expect = 4e-27
 Identities = 106/386 (27%), Positives = 168/386 (43%), Gaps = 44/386 (11%)

Query: 25  VLPLGFGEAGL--PVH--PVMRDALSTGGDQNGYGPVAGIRELREAAAGYWERR-GLPTD 79
           V+ LG GE     P H     ++AL  G     YGP  G+ ELREA A   +++ G+  D
Sbjct: 14  VISLGIGEPDFDTPQHIKEYAKEALDKG--LTHYGPNIGLLELREAIAEKLKKQNGIEAD 71

Query: 80  PD---LVVAGPGSKPLL-YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQG 135
           P    +V+ G     L+  +  L  G +V I  P++VSYA    L+GG+P+ VPT     
Sbjct: 72  PKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDE 131

Query: 136 GVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISD 195
                D L + VT+        RA+I   P NPTG V ++  +  + +   E DL++ISD
Sbjct: 132 FRLNVDELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISD 185

Query: 196 EIYRDLVHDPT---TVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIH 252
           E+Y   ++D     ++      F  ERT+   G SK  A+ GWR+G    P     R + 
Sbjct: 186 EVYEHFIYDDARHYSIASLDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVK 243

Query: 253 AALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXP 312
             +        + P   +Q AAA A ++       V   R+ +                P
Sbjct: 244 FQMYNA-----TCPVTFIQYAAAKALKDERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLP 297

Query: 313 VIAPQAAFYLYP---DFGVWREWLGEAHGVTTGPELTRMLLDRYGMGVLPAVEFGESTHA 369
            + P+ AFY++P   D G+            T  + + ++L    + V+P   FG++   
Sbjct: 298 TVKPKGAFYIFPRIRDTGL------------TSKKFSELMLKEARVAVVPGSAFGKAGEG 345

Query: 370 -LRVRVATSLLYGESEAQRYSALAAE 394
            +R+  AT+    E   +R   +  E
Sbjct: 346 YVRISYATAYEKLEEAMERMERVLKE 371


>1gd9A [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 388

 Score =  110 bits (276), Expect = 6e-27
 Identities = 104/375 (27%), Positives = 165/375 (44%), Gaps = 44/375 (11%)

Query: 25  VLPLGFGEAGL--PVH--PVMRDALSTGGDQNGYGPVAGIRELREAAAGYWERR-GLPTD 79
           V+ LG GE     P H     ++AL  G     YGP  G+ ELREA A   +++ G+  D
Sbjct: 27  VISLGIGEPDFDTPQHIKEYAKEALDKG--LTHYGPNIGLLELREAIAEKLKKQNGIEAD 84

Query: 80  PD---LVVAGPGSKPLL-YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQG 135
           P    +V+ G     L+  +  L  G +V I  P++VSYA    L+GG+P+ VPT     
Sbjct: 85  PKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDE 144

Query: 136 GVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISD 195
                D L + VT+        RA+I   P NPTG V ++  +  + +   E DL++ISD
Sbjct: 145 FRLNVDELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISD 198

Query: 196 EIYRDLVHDPT---TVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIH 252
           E+Y   ++D     ++      F  ERT+   G SK  A+ GWR+G    P     R + 
Sbjct: 199 EVYEHFIYDDARHYSIASLDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVK 256

Query: 253 AALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXP 312
             +        + P   +Q AAA A ++       V   R+ +                P
Sbjct: 257 FQMYNA-----TCPVTFIQYAAAKALKDERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLP 310

Query: 313 VIAPQAAFYLYP---DFGVWREWLGEAHGVTTGPELTRMLLDRYGMGVLPAVEFGESTHA 369
            + P+ AFY++P   D G+            T  + + ++L    + V+P   FG++   
Sbjct: 311 TVKPKGAFYIFPRIRDTGL------------TSKKFSELMLKEARVAVVPGSAFGKAGEG 358

Query: 370 LRVRVATSLLYGESE 384
             VR++ +  Y + E
Sbjct: 359 Y-VRISYATAYEKLE 372


>1o4sB [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 384

 Score = 89.4 bits (220), Expect = 2e-20
 Identities = 76/243 (31%), Positives = 117/243 (48%), Gaps = 14/243 (5%)

Query: 3   VAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPV-HPVMRDALS-TGGDQNGYGPVAGI 60
           + +S T+ ++        +G  V+ L  GE   P   PV+ +A+      +  Y    GI
Sbjct: 17  IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGI 76

Query: 61  RELREAAAG-YWERRGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAA 116
            ELRE  A    ER      PD VV   G+K  L+   +A+   G +V + +P WVSY  
Sbjct: 77  YELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIP 136

Query: 117 QSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRG 176
           Q  L+GG    V T  ++   P  + +     E    G+  +AV+   P+NPTG V  R 
Sbjct: 137 QIILAGGTVNVVETFMSKNFQPSLEEV-----EGLLVGKT-KAVLINSPNNPTGVVYRRE 190

Query: 177 TVRRLTEVAQELDLVIISDEIYRDLVH-DPTTVVHSPAEFAPERTVITTGLSKNLALGGW 235
            +  L  +A++ +  IISDE+Y  LV+ D  T +   +E   +R V   G SK+ ++ GW
Sbjct: 191 FLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSE-GFDRIVYINGFSKSHSMTGW 249

Query: 236 RIG 238
           R+G
Sbjct: 250 RVG 252


>1o4sA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 375

 Score = 89.4 bits (220), Expect = 2e-20
 Identities = 76/243 (31%), Positives = 117/243 (48%), Gaps = 14/243 (5%)

Query: 3   VAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPV-HPVMRDALS-TGGDQNGYGPVAGI 60
           + +S T+ ++        +G  V+ L  GE   P   PV+ +A+      +  Y    GI
Sbjct: 8   IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGI 67

Query: 61  RELREAAAG-YWERRGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAA 116
            ELRE  A    ER      PD VV   G+K  L+   +A+   G +V + +P WVSY  
Sbjct: 68  YELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIP 127

Query: 117 QSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRG 176
           Q  L+GG    V T  ++   P  + +     E    G+  +AV+   P+NPTG V  R 
Sbjct: 128 QIILAGGTVNVVETFMSKNFQPSLEEV-----EGLLVGKT-KAVLINSPNNPTGVVYRRE 181

Query: 177 TVRRLTEVAQELDLVIISDEIYRDLVH-DPTTVVHSPAEFAPERTVITTGLSKNLALGGW 235
            +  L  +A++ +  IISDE+Y  LV+ D  T +   +E   +R V   G SK+ ++ GW
Sbjct: 182 FLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSE-GFDRIVYINGFSKSHSMTGW 240

Query: 236 RIG 238
           R+G
Sbjct: 241 RVG 243


>1xi9C [c.67.1] PUTATIVE TRANSAMINASE
          Length = 393

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 80/342 (23%), Positives = 131/342 (38%), Gaps = 25/342 (7%)

Query: 4   AVSATLAVNEALARRRS---QGLPVLPLGFGEAGL-----PVHPVMRDALSTGGDQNGYG 55
           A+S   A+ + +   R    +G+ V+ L  G+        P H       +     N YG
Sbjct: 6   ALSVEYAIRDVVLPARELEKKGIKVIRLNIGDPVKFDFQPPEHMKEAYCKAIKEGHNYYG 65

Query: 56  PVAGIRELREAAAGYWERRG----LPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSW 111
              G+ ELR+A     +R+      P D  +  A   +  L++  LL  G ++ +  PS+
Sbjct: 66  DSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSY 125

Query: 112 VSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGT 171
             Y       GG+P+   T      + E D                 A+    P+NPTG 
Sbjct: 126 PPYTGLVKFYGGKPVEYRT------IEEEDWQPXXXXXXXXXXXXXXAIAVINPNNPTGA 179

Query: 172 VASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVIT-TGLSKNL 230
           +  + T+  +  +A E ++ +ISDEIY  + ++   +  SP     +  VI   GLSK  
Sbjct: 180 LYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--SPGSLTKDVPVIVMNGLSKVY 237

Query: 231 ALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVAR 290
              GWR+G     D +         +   + I   P+ P Q AA      P +   L   
Sbjct: 238 FATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDY--LKEY 295

Query: 291 SRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYP--DFGVWR 330
            ++L                     PQ AFY++P  + G W+
Sbjct: 296 MKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWK 337


>1xi9A [c.67.1] PUTATIVE TRANSAMINASE
          Length = 388

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 79/339 (23%), Positives = 127/339 (37%), Gaps = 22/339 (6%)

Query: 4   AVSATLAVNEALARRRSQGLPVLPLGFGEAGL-----PVHPVMRDALSTGGDQNGYGPVA 58
           A    L+V         +G+ V+ L  G+        P H       +     N YG   
Sbjct: 4   ASKRALSVEYPARELEKKGIKVIRLNIGDPVKFDFQPPEHMKEAYCKAIKEGHNYYGDSE 63

Query: 59  GIRELREAAAGYWERRG----LPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSY 114
           G+ ELR+A     +R+      P D  +  A   +  L++  LL  G ++ +  PS+  Y
Sbjct: 64  GLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPY 123

Query: 115 AAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVAS 174
                  GG+P+   T      + E D                 A+    P+NPTG +  
Sbjct: 124 TGLVKFYGGKPVEYRT------IEEEDWQPXXXXXXXXXXXXXXAIAVINPNNPTGALYD 177

Query: 175 RGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVIT-TGLSKNLALG 233
           + T+  +  +A E ++ +ISDEIY  + ++   +  SP     +  VI   GLSK     
Sbjct: 178 KKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--SPGSLTKDVPVIVMNGLSKVYFAT 235

Query: 234 GWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRR 293
           GWR+G     D +         +   + I   P+ P Q AA      P +   L    ++
Sbjct: 236 GWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDY--LKEYMKK 293

Query: 294 LHGLXXXXXXXXXXXXXXPVIAPQAAFYLYP--DFGVWR 330
           L                     PQ AFY++P  + G W+
Sbjct: 294 LKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWK 332


>1xi9B [c.67.1] PUTATIVE TRANSAMINASE
          Length = 386

 Score = 77.8 bits (190), Expect = 5e-17
 Identities = 70/286 (24%), Positives = 112/286 (39%), Gaps = 17/286 (5%)

Query: 52  NGYGPVAGIRELREAAAGYWERRG----LPTDPDLVVAGPGSKPLLYALLLAIGGDVAIA 107
           N YG   G+ ELR+A     +R+      P D  +  A   +  L++  LL  G ++ + 
Sbjct: 55  NYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVP 114

Query: 108 APSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDN 167
            PS+  Y       GG+P+   T      + E D                 A+    P+N
Sbjct: 115 GPSYPPYTGLVKFYGGKPVEYRT------IEEEDWQPXXXXXXXXXXXXXXAIAVINPNN 168

Query: 168 PTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVIT-TGL 226
           PTG +  + T+  +  +A E ++ +ISDEIY  + ++   +  SP     +  VI   GL
Sbjct: 169 PTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--SPGSLTKDVPVIVMNGL 226

Query: 227 SKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVD 286
           SK     GWR+G     D +         +   + I   P+ P Q AA      P +   
Sbjct: 227 SKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDY-- 284

Query: 287 LVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYP--DFGVWR 330
           L    ++L                     PQ AFY++P  + G W+
Sbjct: 285 LKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWK 330


>1v2eB [c.67.1] GLUTAMINE AMINOTRANSFERASE
          Length = 367

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 72/239 (30%), Positives = 103/239 (43%), Gaps = 21/239 (8%)

Query: 8   TLAVNEALARRRS---QGLPVLPLGFGEAGLPVHPVMRDALSTG-GDQNGYGPVAGIREL 63
           T A  E++  R S   Q L  + LG G    P  P + +A+    G Q+ Y P AG+  L
Sbjct: 7   TEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPAL 66

Query: 64  REAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHL 120
           REA A          +P+ VV   G+   LY LL ++   G +V +  P +  Y   + L
Sbjct: 67  REALA-----EEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFL 121

Query: 121 SGGQPLFVPT-APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           +G +   V      +G   +  AL +A+T         RA++   P NPTG V       
Sbjct: 122 AGAKARLVRLDLTPEGFRLDLSALEKALTPRT------RALLLNTPMNPTGLVFGXXXXX 175

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
                    DL +ISDE+Y +L +          EFAPERT       K L   G+R+G
Sbjct: 176 XXXXXXXXHDLFLISDEVYDELYYGERP--RRLREFAPERTFTVGSAGKRLEATGYRVG 232


>1v2eA [c.67.1] GLUTAMINE AMINOTRANSFERASE
          Length = 368

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 72/239 (30%), Positives = 103/239 (43%), Gaps = 21/239 (8%)

Query: 8   TLAVNEALARRRS---QGLPVLPLGFGEAGLPVHPVMRDALSTG-GDQNGYGPVAGIREL 63
           T A  E++  R S   Q L  + LG G    P  P + +A+    G Q+ Y P AG+  L
Sbjct: 7   TEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPAL 66

Query: 64  REAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHL 120
           REA A          +P+ VV   G+   LY LL ++   G +V +  P +  Y   + L
Sbjct: 67  REALA-----EEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFL 121

Query: 121 SGGQPLFVPT-APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           +G +   V      +G   +  AL +A+T         RA++   P NPTG V       
Sbjct: 122 AGAKARLVRLDLTPEGFRLDLSALEKALTPRT------RALLLNTPMNPTGLVFGXXXXX 175

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
                    DL +ISDE+Y +L +          EFAPERT       K L   G+R+G
Sbjct: 176 XXXXXXXXHDLFLISDEVYDELYYGERP--RRLREFAPERTFTVGSAGKRLEATGYRVG 232


>1v2dA [c.67.1] GLUTAMINE AMINOTRANSFERASE
          Length = 365

 Score = 74.7 bits (182), Expect = 5e-16
 Identities = 67/224 (29%), Positives = 97/224 (43%), Gaps = 18/224 (8%)

Query: 20  SQGLPVLPLGFGEAGLPVHPVMRDALSTG-GDQNGYGPVAGIRELREAAAGYWERRGLPT 78
           +Q L  + LG G    P  P + +A+    G Q+ Y P AG+  LREA A          
Sbjct: 19  AQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALA-----EEFAV 73

Query: 79  DPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPLFVPT-APAQ 134
           +P+ VV   G+   LY LL ++   G +V +  P +  Y   + L+G +   V      +
Sbjct: 74  EPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPE 133

Query: 135 GGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIIS 194
           G   +  AL +A+T         RA++   P NPTG V                DL +IS
Sbjct: 134 GFRLDLSALEKALTPRT------RALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLIS 187

Query: 195 DEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           DE+Y +L +          EFAPERT       K L   G+R+G
Sbjct: 188 DEVYDELYYGERP--RRLREFAPERTFTVGSAGKRLEATGYRVG 229


>1bw0B [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
          Length = 412

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 58/200 (29%), Positives = 83/200 (41%), Gaps = 19/200 (9%)

Query: 52  NGYGPVAGIRELREAAAGYW--------ERRGLPTDPDLVVAGPGSKPLLYALL-LAIGG 102
           NGY P  G  E REA A +W        E +      ++V+   GS  +L A+  +   G
Sbjct: 66  NGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAG 125

Query: 103 DVAIAA-PSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVI 161
           D A+   P +  Y       G    F    P      + D +       R      + +I
Sbjct: 126 DYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIR------RLKDDKTKLLI 179

Query: 162 TTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPE 218
            T P NP G+  SR  V  +  +A+EL L + SDEIY  +V    DP     S A+F   
Sbjct: 180 VTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETT 239

Query: 219 RTVITTGLSKNLALGGWRIG 238
              +  G + NL + GWR+G
Sbjct: 240 VPRVILGGTANLVVPGWRLG 259


>1bw0A [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
          Length = 411

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 58/200 (29%), Positives = 83/200 (41%), Gaps = 19/200 (9%)

Query: 52  NGYGPVAGIRELREAAAGYW--------ERRGLPTDPDLVVAGPGSKPLLYALL-LAIGG 102
           NGY P  G  E REA A +W        E +      ++V+   GS  +L A+  +   G
Sbjct: 66  NGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAG 125

Query: 103 DVAIAA-PSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVI 161
           D A+   P +  Y       G    F    P      + D +       R      + +I
Sbjct: 126 DYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIR------RLKDDKTKLLI 179

Query: 162 TTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPE 218
            T P NP G+  SR  V  +  +A+EL L + SDEIY  +V    DP     S A+F   
Sbjct: 180 VTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETT 239

Query: 219 RTVITTGLSKNLALGGWRIG 238
              +  G + NL + GWR+G
Sbjct: 240 VPRVILGGTANLVVPGWRLG 259


>1w7nA [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
          Length = 415

 Score = 67.4 bits (163), Expect = 7e-14
 Identities = 56/206 (27%), Positives = 92/206 (44%), Gaps = 27/206 (13%)

Query: 53  GYGPVAGIRELREAAAGYWERRGLPTDPD----LVVAGPGSKPLLYALLLAIGGDVAIAA 108
           GY P+  I      A+ + E  G   DP     + V G G+    +  L+  G +V I  
Sbjct: 65  GYPPLTKI-----LASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIE 119

Query: 109 PSWVSYAAQSHLSGGQPLFVPTAPAQGGVP-------EPDALAQAVTEARAAGRDIRAVI 161
           P +  Y   + ++GG+P+FV   P  G +        +P  LA   T         +A++
Sbjct: 120 PFFDCYEPMTMMAGGRPVFVSLKPGPGELGSSSNWQLDPMELAGKFTSRT------KALV 173

Query: 162 TTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPE 218
              P+NP G V SR  +  +  + Q+ D+V I+DE+Y+ +V   H   ++   P  +  E
Sbjct: 174 LNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMW--E 231

Query: 219 RTVITTGLSKNLALGGWRIGVARLPD 244
           RT+      K  +  GW++G    PD
Sbjct: 232 RTLTIGSAGKTFSATGWKVGWVLGPD 257


>1w7lA [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
          Length = 414

 Score = 65.9 bits (159), Expect = 2e-13
 Identities = 57/206 (27%), Positives = 94/206 (45%), Gaps = 28/206 (13%)

Query: 53  GYGPVAGIRELREAAAGYWERRGLPTDPD----LVVAGPGSKPLLYALLLAIGGDVAIAA 108
           GY P+  I      A+ + E  G   DP     + V G G+    +  L+  G +V I  
Sbjct: 65  GYPPLTKI-----LASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIE 119

Query: 109 PSWVSYAAQSHLSGGQPLFVPTAPAQGGVP-------EPDALAQAVTEARAAGRDIRAVI 161
           P +  Y   + ++GG+P+FV   P  G +        +P  LA   T         +A++
Sbjct: 120 PFFDCYEPMTMMAGGRPVFVSLKPGPGELGSSSNWQLDPMELAGKFTSRT------KALV 173

Query: 162 TTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPE 218
              P+NP G V SR  +  +  + Q+ D+V I+DE+Y+ +V   H   ++   P  +  E
Sbjct: 174 LNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMW--E 231

Query: 219 RTVITTGLSKNLALGGWRIGVARLPD 244
           RT +T G +   +  GW++G    PD
Sbjct: 232 RT-LTIGSAGTFSATGWKVGWVLGPD 256


>1u08B [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
          Length = 378

 Score = 65.1 bits (157), Expect = 4e-13
 Identities = 69/240 (28%), Positives = 97/240 (40%), Gaps = 19/240 (7%)

Query: 26  LPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGYWERR-GLPTDPDL-V 83
           L  GF +   P +   R A       N Y P+ G++ LREA A   ER  G   D D  +
Sbjct: 27  LSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDI 86

Query: 84  VAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP 140
               G+   LYA + A+   G +V    PS+ SYA    LSGG    +   P    V   
Sbjct: 87  TVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQ 146

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           +  A             R VI   P NP+ TV  +     L +     ++ +ISDE+Y  
Sbjct: 147 EFAA-------LLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEH 199

Query: 201 L---VHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG--VARLPDSDTGRHIHAAL 255
           +        +V+  P     ER V  +   K   + GW++G  VA  P S   R +H  L
Sbjct: 200 INFSQQGHASVLAHPQ--LRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYL 257


>1u08A [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
          Length = 382

 Score = 65.1 bits (157), Expect = 4e-13
 Identities = 69/240 (28%), Positives = 97/240 (40%), Gaps = 19/240 (7%)

Query: 26  LPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGYWERR-GLPTDPDL-V 83
           L  GF +   P +   R A       N Y P+ G++ LREA A   ER  G   D D  +
Sbjct: 31  LSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDI 90

Query: 84  VAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP 140
               G+   LYA + A+   G +V    PS+ SYA    LSGG    +   P    V   
Sbjct: 91  TVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQ 150

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           +  A             R VI   P NP+ TV  +     L +     ++ +ISDE+Y  
Sbjct: 151 EFAA-------LLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEH 203

Query: 201 L---VHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG--VARLPDSDTGRHIHAAL 255
           +        +V+  P     ER V  +   K   + GW++G  VA  P S   R +H  L
Sbjct: 204 INFSQQGHASVLAHPQ--LRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYL 261


>2z1zA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 408

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 73/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   SK   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSKYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei7B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 409

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 73/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   SK   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSKYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei7A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 412

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 73/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   SK   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSKYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei6B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 411

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 73/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   SK   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSKYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei6A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 410

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 73/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   SK   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSKYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3dydB [x.x.x] TYROSINE AMINOTRANSFERASE
          Length = 387

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 66/252 (26%), Positives = 102/252 (40%), Gaps = 32/252 (12%)

Query: 27  PLGFGEAGLPVHP----VMRDALSTGGDQNGYGPVAGIRELREAAAGYWERRGLPTDPDL 82
           P  FG   LP  P     M+DAL +G   NGY P  G    RE  A Y+     P +   
Sbjct: 24  PTVFGN--LPTDPEVTQAMKDALDSG-KYNGYAPSIGFLSSREEIASYYHCPEAPLEAKD 80

Query: 83  VVAGPGSKP---LLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPE 139
           V+   G      L  A+L   G ++ +  P +  Y   +   G +       P +    +
Sbjct: 81  VILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEID 140

Query: 140 PDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYR 199
              L   + E  A       +I   P NP G+V S+  ++++  VA    + I++DEIY 
Sbjct: 141 LKQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYG 194

Query: 200 DLVHDPTTVVHSPAEFAPERTVITT-------GLSKNLALGGWRIGVARLPDSDT--GRH 250
           D+       V S  ++ P  T+ T        GL+K   + GWR+G   + D     G  
Sbjct: 195 DM-------VFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNE 247

Query: 251 IHAALLGIASEI 262
           I   L+ ++  I
Sbjct: 248 IRDGLVKLSQRI 259


>3dydA [x.x.x] TYROSINE AMINOTRANSFERASE
          Length = 388

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 66/252 (26%), Positives = 102/252 (40%), Gaps = 32/252 (12%)

Query: 27  PLGFGEAGLPVHP----VMRDALSTGGDQNGYGPVAGIRELREAAAGYWERRGLPTDPDL 82
           P  FG   LP  P     M+DAL +G   NGY P  G    RE  A Y+     P +   
Sbjct: 25  PTVFGN--LPTDPEVTQAMKDALDSG-KYNGYAPSIGFLSSREEIASYYHCPEAPLEAKD 81

Query: 83  VVAGPGSKP---LLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPE 139
           V+   G      L  A+L   G ++ +  P +  Y   +   G +       P +    +
Sbjct: 82  VILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEID 141

Query: 140 PDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYR 199
              L   + E  A       +I   P NP G+V S+  ++++  VA    + I++DEIY 
Sbjct: 142 LKQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYG 195

Query: 200 DLVHDPTTVVHSPAEFAPERTVITT-------GLSKNLALGGWRIGVARLPDSDT--GRH 250
           D+       V S  ++ P  T+ T        GL+K   + GWR+G   + D     G  
Sbjct: 196 DM-------VFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNE 248

Query: 251 IHAALLGIASEI 262
           I   L+ ++  I
Sbjct: 249 IRDGLVKLSQRI 260


>3b46B [x.x.x] AMINOTRANSFERASE BNA3
          Length = 424

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 79/324 (24%), Positives = 129/324 (39%), Gaps = 48/324 (14%)

Query: 97  LLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEA------ 150
           LL  G +V +  P +  Y     L GG+ ++VP  P       P  L Q  T        
Sbjct: 116 LLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-------PKELDQRNTRGEEWTID 168

Query: 151 -----RAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDP 205
                +A     +AVI   P NP G V +R  +  L  +  + ++VIISDE+Y  L    
Sbjct: 169 FEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF-- 226

Query: 206 TTVVHSPAEFAPE--RTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASE-- 261
           T      A  +PE  +  +T G + + A  GWRIG            ++A LL  A++  
Sbjct: 227 TDSFTRIATLSPEIGQLTLTVGSAGSFAATGWRIGWV--------LSLNAELLSYAAKAH 278

Query: 262 ---IWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQA 318
               ++SPS P+Q A A +  +  +I     + R+ +                P  AP+ 
Sbjct: 279 TRICFASPS-PLQEACANSINDALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEG 336

Query: 319 AFYLYPDFG---VWREWLGEAHGVTTGPE--LTRMLLDRYGMGVLPAVEFGESTH----- 368
            +++  DF    +  ++      +  G +  ++  L++  G+  +P  EF    H     
Sbjct: 337 TYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAE 396

Query: 369 -ALRVRVATSLLYGESEAQRYSAL 391
             LR  V     Y E+  +R   L
Sbjct: 397 NLLRFAVCKDDAYLENAVERLKLL 420


>3b46A [x.x.x] AMINOTRANSFERASE BNA3
          Length = 423

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 79/324 (24%), Positives = 129/324 (39%), Gaps = 48/324 (14%)

Query: 97  LLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEA------ 150
           LL  G +V +  P +  Y     L GG+ ++VP  P       P  L Q  T        
Sbjct: 115 LLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-------PKELDQRNTRGEEWTID 167

Query: 151 -----RAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDP 205
                +A     +AVI   P NP G V +R  +  L  +  + ++VIISDE+Y  L    
Sbjct: 168 FEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF-- 225

Query: 206 TTVVHSPAEFAPE--RTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASE-- 261
           T      A  +PE  +  +T G + + A  GWRIG            ++A LL  A++  
Sbjct: 226 TDSFTRIATLSPEIGQLTLTVGSAGSFAATGWRIGWV--------LSLNAELLSYAAKAH 277

Query: 262 ---IWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQA 318
               ++SPS P+Q A A +  +  +I     + R+ +                P  AP+ 
Sbjct: 278 TRICFASPS-PLQEACANSINDALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEG 335

Query: 319 AFYLYPDFG---VWREWLGEAHGVTTGPE--LTRMLLDRYGMGVLPAVEFGESTH----- 368
            +++  DF    +  ++      +  G +  ++  L++  G+  +P  EF    H     
Sbjct: 336 TYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAE 395

Query: 369 -ALRVRVATSLLYGESEAQRYSAL 391
             LR  V     Y E+  +R   L
Sbjct: 396 NLLRFAVCKDDAYLENAVERLKLL 419


>3eiaB [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 409

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 72/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   S+   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSQYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3eiaA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 412

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 72/252 (28%), Positives = 104/252 (41%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   S+   
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSQYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3fvsA [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1
          Length = 418

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 81/340 (23%), Positives = 138/340 (40%), Gaps = 43/340 (12%)

Query: 53  GYGPVAGIRELREAAAGYWERRGLPTDPD----LVVAGPGSKPLLYALLLAIGGDVAIAA 108
           GY P+  I      A+ + E  G   DP     + V G G+    +  L+  G +V I  
Sbjct: 65  GYPPLTKI-----LASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIE 119

Query: 109 PSWVSYAAQSHLSGGQPLFVPTAPA--QGGVPEPDALAQAVTEARAAGR---DIRAVITT 163
           P +  Y   + ++GG+P+FV   P   Q G     +  Q +     AG+     +A++  
Sbjct: 120 PFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQ-LDPMELAGKFTSRTKALVLN 178

Query: 164 CPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPERT 220
            P+NP G V SR  +  +  + Q+ D+V I+DE+Y+ +V   H   ++   P  +  ERT
Sbjct: 179 TPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMW--ERT 236

Query: 221 VITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYA--- 277
            +T G +   +  GW++G    PD     HI   L  +     S    P Q  AA A   
Sbjct: 237 -LTIGSAGTFSATGWKVGWVLGPD-----HIMKHLRTVHQN--SVFHCPTQSQAAVAESF 288

Query: 278 ------FQEPAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWRE 331
                 F++P+     V   + +                 P+I PQ +++L  D   ++ 
Sbjct: 289 EREQLLFRQPSSY--FVQFPQAMQRCRDHMIRSLQSVGLKPII-PQGSYFLITDISDFKR 345

Query: 332 WLGEAHGVTTGP---ELTRMLLDRYGMGVLPAVEFGESTH 368
            + +  G    P      + ++   G+  +P   F    H
Sbjct: 346 KMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPH 385


>3ei9B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 410

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 72/252 (28%), Positives = 103/252 (40%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   S    
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSNYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei9A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 412

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 72/252 (28%), Positives = 103/252 (40%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   S    
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSNYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3ei8A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 411

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 72/252 (28%), Positives = 103/252 (40%), Gaps = 31/252 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA-------LSTGGDQNGYGPVAGIR 61
           +ARRRS  L       V+ LG G+   P+  V+  A       LST    +GYG   G +
Sbjct: 24  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAK 83

Query: 62  ELREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSH 119
            LR A A  +   GL    D V    G+K  +  L +  G +V IA   PS+ +Y   S 
Sbjct: 84  PLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSV 142

Query: 120 LSGGQPLFVPTAPAQGGV------PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVA 173
           + G    F       G +      PE        T  R    DI  +    P+NPTG  A
Sbjct: 143 IMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAA 197

Query: 174 SRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PTTVVHSPAEFAPERTVITTGLSKNLA 231
           +R  + +L E A++   +I+ D  Y   + D  P ++   P   A E  + T   S    
Sbjct: 198 TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPG--AEEVAMETASFSNYAG 255

Query: 232 LGGWRIGVARLP 243
             G R+G   +P
Sbjct: 256 FTGVRLGWTVIP 267


>3jtxB [x.x.x] AMINOTRANSFERASE
          Length = 387

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 75/287 (26%), Positives = 130/287 (45%), Gaps = 38/287 (13%)

Query: 26  LPLGFGEAGLPVHPVMRDALSTG-GDQNGYGPVAGIRELREAAAGYWERR--GLPTDPDL 82
           +PL  GE   P   V+ DAL+    +   Y   AG+ ELR+A A + +RR  GL  D D 
Sbjct: 29  VPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADN 88

Query: 83  -VVAGPGSKPLLYA----LLLAIGGDVAIAAPS--WVSYAAQSHLSGGQPLFVPTAPAQG 135
            ++   GS+  L++    +L  +G   AI +P+  +  Y   + L GG+  F    PA  
Sbjct: 89  EILPVLGSREALFSFVQTVLNPVGIKPAIVSPNPFYQIYEGATLLGGGEIHFA-NCPAPS 147

Query: 136 GVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISD 195
             P+  ++++ V +        + V    P+NP+G+V      + + ++  +   +I SD
Sbjct: 148 FNPDWRSISEEVWKRT------KLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASD 201

Query: 196 EIYRDLVHD---PTTVVHSPAEFAPER-TVITTGLSKNLALG---GWRIGVARLPDSDTG 248
           E Y ++  D   P   + + A+    R  ++ T LS++   G   G+  G A L  +   
Sbjct: 202 ECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLFTSLSRSNVPGLRSGFVAGDAELLKN--- 258

Query: 249 RHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLH 295
                    +      S S PVQRA+  A+ +   ++D    +RRL+
Sbjct: 259 -------FLLYRTYHGSASIPVQRASIAAWDDEQHVID----NRRLY 294


>2gb3F [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 379

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 21  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 80

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 81  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 138

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 139 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 191

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 192 FLIVDEVYSEIV 203


>2gb3E [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 382

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 24  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 83

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 84  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 141

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 142 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 194

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 195 FLIVDEVYSEIV 206


>2gb3D [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 379

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 22  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 81

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 82  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 139

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 140 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 192

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 193 FLIVDEVYSEIV 204


>2gb3C [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 381

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 22  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 81

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 82  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 139

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 140 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 192

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 193 FLIVDEVYSEIV 204


>2gb3B [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 383

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 24  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 83

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 84  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 141

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 142 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 194

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 195 FLIVDEVYSEIV 206


>2gb3A [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 379

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 14/192 (7%)

Query: 16  ARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGY-GPVAGIRELREAAAGYWERR 74
           A  + +G+ +  L  G+  L    V  + +     +  Y    AGI ELREA A Y++RR
Sbjct: 20  AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRR 79

Query: 75  -GLPTDPD-LVVAGPGSKPLL--YALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPT 130
             +   P+ ++V   GS+ +L  +A++   G ++ +  P + +Y A + ++G +   +P 
Sbjct: 80  QRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPV 137

Query: 131 APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDL 190
              + G   P  L   + E        + ++ + P NPTG V  +   R L E+A+   L
Sbjct: 138 TRREEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGL 190

Query: 191 VIISDEIYRDLV 202
            +I DE+Y ++V
Sbjct: 191 FLIVDEVYSEIV 202


>2o0rB [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
          Length = 383

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 70/243 (28%), Positives = 96/243 (39%), Gaps = 18/243 (7%)

Query: 7   ATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREA 66
           AT    E  A     G   L  GF +   P   +     +  G  N Y P  G   LR A
Sbjct: 10  ATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRA 69

Query: 67  AAGYWERR-GLPTDPDL-VVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLS 121
            A    R  G+  DP+  V+   G+   + A +L +   G +V +  P + SY+    ++
Sbjct: 70  IAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMA 129

Query: 122 GGQPLFVPTAP-AQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRR 180
           G   + VP  P  +G   + DAL +AVT         RA+I   P NPTG V S      
Sbjct: 130 GAHRVTVPLVPDGRGFALDADALRRAVTPRT------RALIINSPHNPTGAVLSXXXXXX 183

Query: 181 LTEVAQELDLVIISDEIYRDLVHDPTTVVHSPA---EFAPERTVITTGLSKNLALGGWRI 237
                        +DE+Y  LV D     H P    +   ERT IT   +      GW+I
Sbjct: 184 XXXXXXXXXXXXXTDEVYEHLVFDHAR--HLPLAGFDGMAERT-ITISSAAMFNCTGWKI 240

Query: 238 GVA 240
           G A
Sbjct: 241 GWA 243


>2o0rA [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
          Length = 384

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 70/243 (28%), Positives = 96/243 (39%), Gaps = 18/243 (7%)

Query: 7   ATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREA 66
           AT    E  A     G   L  GF +   P   +     +  G  N Y P  G   LR A
Sbjct: 10  ATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRA 69

Query: 67  AAGYWERR-GLPTDPDL-VVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLS 121
            A    R  G+  DP+  V+   G+   + A +L +   G +V +  P + SY+    ++
Sbjct: 70  IAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMA 129

Query: 122 GGQPLFVPTAP-AQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRR 180
           G   + VP  P  +G   + DAL +AVT         RA+I   P NPTG V S      
Sbjct: 130 GAHRVTVPLVPDGRGFALDADALRRAVTPRT------RALIINSPHNPTGAVLSXXXXXX 183

Query: 181 LTEVAQELDLVIISDEIYRDLVHDPTTVVHSPA---EFAPERTVITTGLSKNLALGGWRI 237
                        +DE+Y  LV D     H P    +   ERT IT   +      GW+I
Sbjct: 184 XXXXXXXXXXXXXTDEVYEHLVFDHAR--HLPLAGFDGMAERT-ITISSAAMFNCTGWKI 240

Query: 238 GVA 240
           G A
Sbjct: 241 GWA 243


>3jtxA [x.x.x] AMINOTRANSFERASE
          Length = 387

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 74/286 (25%), Positives = 129/286 (45%), Gaps = 37/286 (12%)

Query: 26  LPLGFGEAGLPVHPVMRDALSTG-GDQNGYGPVAGIRELREAAAGYWERR--GLPTDPDL 82
           +PL  GE   P   V+ DAL+    +   Y   AG+ ELR+A A + +RR  GL  D D 
Sbjct: 30  VPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADN 89

Query: 83  -VVAGPGSKPLLYALLLAI---GGDVAIAAPS--WVSYAAQSHLSGGQPLFVPTAPAQGG 136
            ++   GS+  L++ +  +   G   AI +P+  +  Y   + L GG+  F    PA   
Sbjct: 90  EILPVLGSREALFSFVQTVLNPGIKPAIVSPNPFYQIYEGATLLGGGEIHFA-NCPAPSF 148

Query: 137 VPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDE 196
            P+  ++++ V +        + V    P+NP+G+V      + + ++  +   +I SDE
Sbjct: 149 NPDWRSISEEVWKRT------KLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDE 202

Query: 197 IYRDLVHD---PTTVVHSPAEFAPER-TVITTGLSKNLALG---GWRIGVARLPDSDTGR 249
            Y ++  D   P   + + A+    R  ++ T LS++   G   G+  G A L  +    
Sbjct: 203 CYSEIYFDGNKPLGCLQAAAQLGRSRQKLLFTSLSRSNVPGLRSGFVAGDAELLKN---- 258

Query: 250 HIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLH 295
                   +      S S PVQRA+  A+ +   ++D    +RRL+
Sbjct: 259 ------FLLYRTYHGSASIPVQRASIAAWDDEQHVID----NRRLY 294


>2z61A [x.x.x] PROBABLE ASPARTATE AMINOTRANSFERASE 2
          Length = 368

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 95/376 (25%), Positives = 147/376 (39%), Gaps = 54/376 (14%)

Query: 14  ALARR-RSQGLPVLPLGFGEAGLPV-HPVMRDAL-STGGDQNGYGPVAGIRELREAAAG- 69
           ALA++  S+G  V+ L  GE       P++ + + S    +  Y    GI ELRE  +  
Sbjct: 19  ALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISEL 78

Query: 70  YWERRGLPTDPDLVVAGPGSKPLLYALLLAI---GGDVAIAAPSWVSYAAQSHLSGGQPL 126
           Y ++      PD ++               I   G +V I  P +  Y       G +P+
Sbjct: 79  YKDKYKADIIPDNIIITXXXXXXXXXXXXXIIDDGDEVLIQNPCYPCYKNFIRFLGAKPV 138

Query: 127 FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQ 186
           F             D   +++ EA +     +A+I   P NP G V  R     + E A 
Sbjct: 139 FC------------DFTVESLEEALSD--KTKAIIINSPSNPLGEVIDR----EIYEFAY 180

Query: 187 ELDLVIISDEIYRDLVHDPTTVVHSPAEFAP--ERTVITTGLSKNLALGGWRIGVARLPD 244
           E    IISDEIY  LV++     +S  EF    E+T++  G S   A+ GWRIG     D
Sbjct: 181 ENIPYIISDEIYNGLVYEGK--CYSAIEFDENLEKTILINGFSL-YAMTGWRIGYVISND 237

Query: 245 SDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPA--EIVDLVARSRRLHGLXXXXX 302
                 I  A+L +   ++ S     Q AA  AF++    EI  ++    R   L     
Sbjct: 238 -----EIIEAILKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYV 292

Query: 303 XXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLLDRYGMGVLPAVE 362
                    P+     A+Y++P+ G              G E    LL    + + P + 
Sbjct: 293 KDFGWEVNNPI----GAYYVFPNIG------------EDGREFAYKLLKEKFVALTPGIG 336

Query: 363 FG-ESTHALRVRVATS 377
           FG +  + +R+  A S
Sbjct: 337 FGSKGKNYIRISYANS 352


>1yiyA [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
          Length = 418

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 83  VVAGPGSKPLLYALL---LAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGG--V 137
           V+   G+   LYA +   +  G +V I  P +  Y      +GG P F+P  P + G  +
Sbjct: 93  VLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTI 152

Query: 138 PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEI 197
              D +              + +I   P NP G V  R  +  +  + ++ +++ +SDE+
Sbjct: 153 SSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEV 212

Query: 198 YRDLVHDP---TTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDS 245
           Y  +V +P     +   P  +  ERT+      K  +L GW+IG A  P++
Sbjct: 213 YEHMVFEPFEHIRICTLPGMW--ERTITIGSAGKTFSLTGWKIGWAYGPEA 261


>2r5cB [x.x.x] KYNURENINE AMINOTRANSFERASE
          Length = 419

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 83  VVAGPGSKPLLYALL---LAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGG--V 137
           V+   G+   LYA +   +  G +V I  P +  Y      +GG P F+P  P + G  +
Sbjct: 94  VLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTI 153

Query: 138 PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEI 197
              D +              + +I   P NP G V  R  +  +  + ++ +++ +SDE+
Sbjct: 154 SSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEV 213

Query: 198 YRDLVHDP---TTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDS 245
           Y  +V +P     +   P  +  ERT+      K  +L GW+IG A  P++
Sbjct: 214 YEHMVFEPFEHIRICTLPGMW--ERTITIGSAGKTFSLTGWKIGWAYGPEA 262


>3e2yA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-11
 Identities = 58/234 (24%), Positives = 102/234 (43%), Gaps = 16/234 (6%)

Query: 53  GYGPVAGIRELREAAAGYWERRGLPTDPDLVVAGP-GSKPLLYALLLAIGGDVAIAAPSW 111
           G+G  A ++ L       ++R+  P +  LV  G  GS       L+  G +V I  P +
Sbjct: 60  GFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFY 119

Query: 112 VSYAAQSHLSGGQPLFVP--TAPAQG--GVPEPDALAQAVTEARAAGRDIRAVITTCPDN 167
             Y     ++G  P+F+P  + P  G               E++ + +  +A+I   P N
Sbjct: 120 DCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKT-KAIILNTPHN 178

Query: 168 PTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV---HDPTTVVHSPAEFAPERTVITT 224
           P G V +R  ++ + ++  + D + ISDE+Y  LV   H    +   P  +  ERT+   
Sbjct: 179 PLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMW--ERTITIG 236

Query: 225 GLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAF 278
              K  ++ GW++G +  P      H+   L  +    + + + P+Q A A AF
Sbjct: 237 SAGKTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAF 285


>2z20B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 400

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 71/248 (28%), Positives = 101/248 (40%), Gaps = 30/248 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA------LSTGGDQNGYGPVAGIRE 62
           +ARRRS  L       V+ LG G+   P+  V+  A      LST    +GYG   G + 
Sbjct: 23  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAAKKAHELSTIEGYSGYGAEQGAKP 82

Query: 63  LREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSHL 120
           LR A A  +   GL    D V    G+K  + + L   G +V IA   PS+ +Y   S +
Sbjct: 83  LRAAIAKTFYG-GLGIGDDDVFVSDGAKCDI-SRLQVFGSNVTIAVQDPSYPAYV-DSSV 139

Query: 121 SGGQPLFVPTAPAQGGV-----PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASR 175
            G    F       G +     PE        T  R    DI  +    P+NPTG  A+R
Sbjct: 140 IGQTGQFNTDVQKYGNIEYRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAATR 194

Query: 176 GTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGW 235
             + +L E A++   +I+ D  Y     +P ++   P     E    T   SK     G 
Sbjct: 195 EQLTQLVEFAKKNGSIIVYDSAYAYSDDNPRSIFEIP---GAEEVAETASFSKYAGFTGV 251

Query: 236 RIGVARLP 243
           R+G   +P
Sbjct: 252 RLGWTVIP 259


>2z20A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 403

 Score = 57.8 bits (138), Expect = 6e-11
 Identities = 71/248 (28%), Positives = 101/248 (40%), Gaps = 30/248 (12%)

Query: 15  LARRRSQGL------PVLPLGFGEAGLPVHPVMRDA------LSTGGDQNGYGPVAGIRE 62
           +ARRRS  L       V+ LG G+   P+  V+  A      LST    +GYG   G + 
Sbjct: 23  IARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAAKKAHELSTIEGYSGYGAEQGAKP 82

Query: 63  LREAAAGYWERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAA--PSWVSYAAQSHL 120
           LR A A  +   GL    D V    G+K  + + L   G +V IA   PS+ +Y   S +
Sbjct: 83  LRAAIAKTFYG-GLGIGDDDVFVSDGAKCDI-SRLQVFGSNVTIAVQDPSYPAYV-DSSV 139

Query: 121 SGGQPLFVPTAPAQGGV-----PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASR 175
            G    F       G +     PE        T  R    DI  +    P+NPTG  A+R
Sbjct: 140 IGQTGQFNTDVQKYGNIEYRCTPENGFFPDLSTVGRT---DI--IFFCSPNNPTGAAATR 194

Query: 176 GTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGW 235
             + +L E A++   +I+ D  Y     +P ++   P     E    T   SK     G 
Sbjct: 195 EQLTQLVEFAKKNGSIIVYDSAYAYSDDNPRSIFEIP---GAEEVAETASFSKYAGFTGV 251

Query: 236 RIGVARLP 243
           R+G   +P
Sbjct: 252 RLGWTVIP 259


>1yizA [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
          Length = 417

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 83  VVAGPGSKPLLYALL---LAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGG--V 137
           V+   G+   LYA +   +  G +V I  P +  Y      +GG P F+P  P + G  +
Sbjct: 93  VLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTI 152

Query: 138 PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEI 197
              D +              + +I   P NP G V  R  +  +  + ++ +++ +SDE+
Sbjct: 153 SSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEV 212

Query: 198 YRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDS 245
           Y  +V +P   +            IT G +   +L GW+IG A  P++
Sbjct: 213 YEHMVFEPFEHIRICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEA 260


>2r5cA [x.x.x] KYNURENINE AMINOTRANSFERASE
          Length = 418

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 83  VVAGPGSKPLLYALL---LAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGG--V 137
           V+   G+   LYA +   +  G +V I  P +  Y      +GG P F+P  P + G  +
Sbjct: 94  VLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTI 153

Query: 138 PEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEI 197
              D +              + +I   P NP G V  R  +  +  + ++ +++ +SDE+
Sbjct: 154 SSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEV 213

Query: 198 YRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDS 245
           Y  +V +P   +            IT G +   +L GW+IG A  P++
Sbjct: 214 YEHMVFEPFEHIRICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEA 261


>3e2fA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
          Length = 409

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 57/231 (24%), Positives = 100/231 (43%), Gaps = 11/231 (4%)

Query: 53  GYGPVAGIRELREAAAGYWERRGLPTDPDLVVAGP-GSKPLLYALLLAIGGDVAIAAPSW 111
           G+G  A ++ L       ++R+  P +  LV  G  GS       L+  G +V I  P +
Sbjct: 60  GFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFY 119

Query: 112 VSYAAQSHLSGGQPLFVP--TAPAQG--GVPEPDALAQAVTEARAAGRDIRAVITTCPDN 167
             Y     ++G  P+F+P  + P  G               E++ + +  +A+I   P N
Sbjct: 120 DCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKT-KAIILNTPHN 178

Query: 168 PTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLS 227
           P G V +R  ++ + ++  + D + ISDE+Y  LV+   T V            IT G +
Sbjct: 179 PLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSA 238

Query: 228 KNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAF 278
              ++ GW++G +  P      H+   L  +    + + + P+Q A A AF
Sbjct: 239 GTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAF 284


>3cq5B [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 366

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 55/179 (30%), Positives = 79/179 (44%), Gaps = 12/179 (6%)

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL 120
           ELR+  A Y  ++ G+    D + A  GS  +L  LL A GG    A     SY+    L
Sbjct: 70  ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPIL 129

Query: 121 SGGQPL-FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           + G    F+  +       + D    A+ E RA   DI  V  T P+NPTG V S   V 
Sbjct: 130 AKGTHTEFIAVSRGADFRIDMDV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVE 184

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           R+  VA     ++I DE Y +    P+    +  E  P + V++  +SK     G R+G
Sbjct: 185 RIINVAPG---IVIVDEAYAEFSPSPSAT--TLLEKYPTKLVVSRTMSKAFDFAGGRLG 238


>3cq5A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 364

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 55/179 (30%), Positives = 79/179 (44%), Gaps = 12/179 (6%)

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL 120
           ELR+  A Y  ++ G+    D + A  GS  +L  LL A GG    A     SY+    L
Sbjct: 68  ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPIL 127

Query: 121 SGGQPL-FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           + G    F+  +       + D    A+ E RA   DI  V  T P+NPTG V S   V 
Sbjct: 128 AKGTHTEFIAVSRGADFRIDMDV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVE 182

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           R+  VA     ++I DE Y +    P+    +  E  P + V++  +SK     G R+G
Sbjct: 183 RIINVAPG---IVIVDEAYAEFSPSPSAT--TLLEKYPTKLVVSRTMSKAFDFAGGRLG 236


>3cq4B [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 347

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 55/179 (30%), Positives = 79/179 (44%), Gaps = 12/179 (6%)

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL 120
           ELR+  A Y  ++ G+    D + A  GS  +L  LL A GG    A     SY+    L
Sbjct: 51  ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPIL 110

Query: 121 SGGQPL-FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           + G    F+  +       + D    A+ E RA   DI  V  T P+NPTG V S   V 
Sbjct: 111 AKGTHTEFIAVSRGADFRIDMDV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVE 165

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           R+  VA     ++I DE Y +    P+    +  E  P + V++  +SK     G R+G
Sbjct: 166 RIINVAPG---IVIVDEAYAEFSPSPSAT--TLLEKYPTKLVVSRTMSKAFDFAGGRLG 219


>3cq4A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 357

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 55/179 (30%), Positives = 79/179 (44%), Gaps = 12/179 (6%)

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL 120
           ELR+  A Y  ++ G+    D + A  GS  +L  LL A GG    A     SY+    L
Sbjct: 52  ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPIL 111

Query: 121 SGGQPL-FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           + G    F+  +       + D    A+ E RA   DI  V  T P+NPTG V S   V 
Sbjct: 112 AKGTHTEFIAVSRGADFRIDMDV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVE 166

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           R+  VA     ++I DE Y +    P+    +  E  P + V++  +SK     G R+G
Sbjct: 167 RIINVAPG---IVIVDEAYAEFSPSPSAT--TLLEKYPTKLVVSRTMSKAFDFAGGRLG 220


>3h14A [x.x.x] AMINOTRANSFERASE, CLASSES I AND II
          Length = 359

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 58/184 (31%), Positives = 77/184 (41%), Gaps = 20/184 (10%)

Query: 59  GIRELREAAAG-YWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPSWVSY 114
           G+  LR+  A  Y E  G+  DP  VV  PGS     L +  L   G  V I AP + SY
Sbjct: 54  GLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSY 113

Query: 115 AAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVAS 174
                  G  P+ +PTAP     P P         A  AG D+  ++ + P NPTGT+  
Sbjct: 114 RQILRALGLVPVDLPTAPENRLQPVP---------ADFAGLDLAGLVAS-PANPTGTLDH 163

Query: 175 RGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGG 234
                             ISDEIY  + ++   V  +  E   E  VI +  SK  +  G
Sbjct: 164 XXXXXXXXXXXXXXS--FISDEIYHGIEYEAKAV--TALELTDECYVINS-FSKYFST-G 217

Query: 235 WRIG 238
           WR+G
Sbjct: 218 WRVG 221


>2zc0A [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE
          Length = 405

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 58/246 (23%), Positives = 98/246 (39%), Gaps = 17/246 (6%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLPVHP------VMRDALSTGGDQNGYGPVAG 59
           SA   V +  +  + +G+ ++ L  G+    + P      + ++ L        Y P  G
Sbjct: 17  SALADVMKKASELQKKGVKLISLAAGDPDPELIPRAVLGEIAKEVLEKEPKSVMYTPANG 76

Query: 60  IRELREAAAGYWERRG-LPTDPD---LVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYA 115
           I ELRE  A + ++   L   P+   + + G G+  LL  +L+  G  V    PS+++  
Sbjct: 77  IPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTL 136

Query: 116 AQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITT-CPDNPTGTVAS 174
                 G +   +   P        D          A G+ ++ + T     NP G   S
Sbjct: 137 LAFEQLGAK---IEGVPVDNDGMRVDXXXXXXXXXXAKGQKVKLIYTIPTGQNPMGVTMS 193

Query: 175 RGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALG- 233
               + L E+A + DL+II D  Y  + ++   +V   A     R ++   LSK L  G 
Sbjct: 194 MERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNEGRVIVAGTLSKVLGTGF 253

Query: 234 --GWRI 237
             GW I
Sbjct: 254 RIGWII 259


>3ihjA [x.x.x] ALANINE AMINOTRANSFERASE 2
          Length = 461

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 51/169 (30%), Positives = 74/169 (43%), Gaps = 24/169 (14%)

Query: 59  GIRELREAAAGYWERR--GLPTDPDLVVAGPGSKPLLYALL--LAIGGD-----VAIAAP 109
           G+  +RE  A Y  RR  G+P DPD +    G+   +  +L  L  GG      V I  P
Sbjct: 94  GVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIP 153

Query: 110 SWVSYAAQ-SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGR------DIRAVIT 162
            +  Y+A  S L   Q  +         + E +  A  V E R A +      D + +  
Sbjct: 154 QYPLYSAVISELDAIQVNYY--------LDEENCWALNVNELRRAVQEAKDHCDPKVLCI 205

Query: 163 TCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHS 211
             P NPTG V SR  +  +   A E  L +++DE+Y+D V+ P    HS
Sbjct: 206 INPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHS 254


>1iayA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
          Length = 419

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 19/198 (9%)

Query: 59  GIRELREAAAGYWER-RG--LPTDPDLVVAGPGSKPLLYALL--LAIGGDVAIAAPSWVS 113
           G+ E R+A A + E+ RG  +  DP+ VV   G+      ++  LA  GD A   PS   
Sbjct: 75  GLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGD-AFLVPSPYY 133

Query: 114 YAAQSHL---SGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
            A    L   +G Q + +    +        A+ +A   A+ +   ++ +I T P NP G
Sbjct: 134 PAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLG 193

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTV--------- 221
           T   + T++ +     + ++ ++ DEIY   V D    V S AE   E+ +         
Sbjct: 194 TTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV-SIAEILDEQEMTYCNKDLVH 252

Query: 222 ITTGLSKNLALGGWRIGV 239
           I   LSK++ L G+R+G+
Sbjct: 253 IVYSLSKDMGLPGFRVGI 270


>1iaxA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
          Length = 417

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 19/198 (9%)

Query: 59  GIRELREAAAGYWER-RG--LPTDPDLVVAGPGSKPLLYALL--LAIGGDVAIAAPSWVS 113
           G+ E R+A A + E+ RG  +  DP+ VV   G+      ++  LA  GD A   PS   
Sbjct: 73  GLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGD-AFLVPSPYY 131

Query: 114 YAAQSHL---SGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
            A    L   +G Q + +    +        A+ +A   A+ +   ++ +I T P NP G
Sbjct: 132 PAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLG 191

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTV--------- 221
           T   + T++ +     + ++ ++ DEIY   V D    V S AE   E+ +         
Sbjct: 192 TTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV-SIAEILDEQEMTYCNKDLVH 250

Query: 222 ITTGLSKNLALGGWRIGV 239
           I   LSK++ L G+R+G+
Sbjct: 251 IVYSLSKDMGLPGFRVGI 268


>3eleC [x.x.x] AMINO TRANSFERASE
          Length = 389

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 64/249 (25%), Positives = 103/249 (41%), Gaps = 25/249 (10%)

Query: 25  VLPLGFGEAGLPVHPVMRDALS---TGGDQ---NGYGPVAGIRELREAAAGYWER-RGLP 77
           V     G   +P   ++ D +    T  D    +GY    G  E R A A +     G  
Sbjct: 34  VYDFSIGNPSIPAPQIVNDTIKELVTDYDSVALHGYTSAQGDVETRAAIAEFLNNTHGTH 93

Query: 78  TDPDLVVAGPG-SKPLLYALLLAIGGDVAIA-APSWVSYAAQSHLSGGQPLFVPTAPAQG 135
            + D +  G   S  + +  L +   D  I  AP +  Y    + +G + + VP A  + 
Sbjct: 94  FNADNLYTGAAASLSICFRALTSDAYDEFITIAPYFPEYKVFVNAAGARLVEVP-ADTEH 152

Query: 136 GVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQEL------D 189
              + DAL + +          R VI   P+NP+GTV S  T+                 
Sbjct: 153 FQIDFDALEERINA------HTRGVIINSPNNPSGTVYSEETIXXXXXXXXXXXXXIGRP 206

Query: 190 LVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGR 249
           + II+DE YR++V+D   V      +  + T++    SK+L+L G RIG   +PD    +
Sbjct: 207 IFIIADEPYREIVYDGIKVPFVTKYY--DNTLVCYSYSKSLSLPGERIGYVLVPDEVYDK 264

Query: 250 -HIHAALLG 257
             ++AA+ G
Sbjct: 265 AELYAAVCG 273


>3eleA [x.x.x] AMINO TRANSFERASE
          Length = 390

 Score = 50.4 bits (119), Expect = 9e-09
 Identities = 64/249 (25%), Positives = 103/249 (41%), Gaps = 25/249 (10%)

Query: 25  VLPLGFGEAGLPVHPVMRDALS---TGGDQ---NGYGPVAGIRELREAAAGYWER-RGLP 77
           V     G   +P   ++ D +    T  D    +GY    G  E R A A +     G  
Sbjct: 35  VYDFSIGNPSIPAPQIVNDTIKELVTDYDSVALHGYTSAQGDVETRAAIAEFLNNTHGTH 94

Query: 78  TDPDLVVAGPG-SKPLLYALLLAIGGDVAIA-APSWVSYAAQSHLSGGQPLFVPTAPAQG 135
            + D +  G   S  + +  L +   D  I  AP +  Y    + +G + + VP A  + 
Sbjct: 95  FNADNLYTGAAASLSICFRALTSDAYDEFITIAPYFPEYKVFVNAAGARLVEVP-ADTEH 153

Query: 136 GVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQEL------D 189
              + DAL + +          R VI   P+NP+GTV S  T+                 
Sbjct: 154 FQIDFDALEERINA------HTRGVIINSPNNPSGTVYSEETIXXXXXXXXXXXXXIGRP 207

Query: 190 LVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGR 249
           + II+DE YR++V+D   V      +  + T++    SK+L+L G RIG   +PD    +
Sbjct: 208 IFIIADEPYREIVYDGIKVPFVTKYY--DNTLVCYSYSKSLSLPGERIGYVLVPDEVYDK 265

Query: 250 -HIHAALLG 257
             ++AA+ G
Sbjct: 266 AELYAAVCG 274


>2douB [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
          Length = 368

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 77/326 (23%), Positives = 115/326 (35%), Gaps = 25/326 (7%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTG-GDQNGYG---PVAGIR 61
           S  L V+EA  + R +G+ ++ L  G                   D   YG       + 
Sbjct: 1   SVFLVVDEAKRKARERGVGLIDLSIGSTDXXXXXXXXXXXXXXXNDPTTYGYCLKSCTLP 60

Query: 62  ELREAAAGYWERRGLPTDPDL-VVAGPGSKPLLYALLLAIGGDVAIAAPSWV---SYAAQ 117
            L EAA  Y  R G+  DP    +A  GS+  L                  V   SY   
Sbjct: 61  FLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHXXXXXXXXXXXXXXXXVAYPSYFGA 120

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
           + ++  +   +P           D LA          R+ + ++   P+NPTG VA  G 
Sbjct: 121 ARVASLRTFLIPL--------REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGY 172

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
                 +A++  L +I D  Y D V++           A ER V    LSK+  L G+R+
Sbjct: 173 FEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRL 232

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A   +    R     L  +   I  +    V R    A + P E+V   AR  R   L
Sbjct: 233 GFALGSEEALAR-----LERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERAL 287

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLY 323
                          ++ P+A  YL+
Sbjct: 288 ----GMAEALKGVLSLLPPRATMYLW 309


>2douA [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
          Length = 372

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 77/326 (23%), Positives = 115/326 (35%), Gaps = 25/326 (7%)

Query: 6   SATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTG-GDQNGYG---PVAGIR 61
           S  L V+EA  + R +G+ ++ L  G                   D   YG       + 
Sbjct: 5   SVFLVVDEAKRKARERGVGLIDLSIGSTDXXXXXXXXXXXXXXXNDPTTYGYCLKSCTLP 64

Query: 62  ELREAAAGYWERRGLPTDPDL-VVAGPGSKPLLYALLLAIGGDVAIAAPSWV---SYAAQ 117
            L EAA  Y  R G+  DP    +A  GS+  L                  V   SY   
Sbjct: 65  FLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHXXXXXXXXXXXXXXXXVAYPSYFGA 124

Query: 118 SHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
           + ++  +   +P           D LA          R+ + ++   P+NPTG VA  G 
Sbjct: 125 ARVASLRTFLIPL--------REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGY 176

Query: 178 VRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRI 237
                 +A++  L +I D  Y D V++           A ER V    LSK+  L G+R+
Sbjct: 177 FEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRL 236

Query: 238 GVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQEPAEIVDLVARSRRLHGL 297
           G A   +    R     L  +   I  +    V R    A + P E+V   AR  R   L
Sbjct: 237 GFALGSEEALAR-----LERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERAL 291

Query: 298 XXXXXXXXXXXXXXPVIAPQAAFYLY 323
                          ++ P+A  YL+
Sbjct: 292 ----GMAEALKGVLSLLPPRATMYLW 313


>3cq6A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 363

 Score = 49.7 bits (117), Expect = 2e-08
 Identities = 54/179 (30%), Positives = 78/179 (43%), Gaps = 13/179 (7%)

Query: 62  ELREAAAGYWERR-GLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHL 120
           ELR+  A Y  ++ G+    D + A  GS  +L  LL A GG    A     SY+    L
Sbjct: 68  ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPIL 127

Query: 121 SGGQPL-FVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVR 179
           + G    F+  +       + D    A+ E RA   DI  V  T P+NPTG V S   V 
Sbjct: 128 AKGTHTEFIAVSRGADFRIDMDV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVE 182

Query: 180 RLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
           R+  VA     ++I DE Y +    P+    +  E  P + V++  +S      G R+G
Sbjct: 183 RIINVAPG---IVIVDEAYAEFSPSPSAT--TLLEKYPTKLVVSRTMSA-FDFAGGRLG 235


>1ynuA [x.x.x] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
          Length = 417

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 142 ALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
           AL +A  EA      ++ V+ T P NP GT  +R  +  L    ++  + +ISDEIY   
Sbjct: 167 ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT 226

Query: 202 VHDPTTVVHSPAEFAP-----ERTVITTGLSKNLALGGWRIG 238
                + + S  E        +R  +   LSK+L L G+R+G
Sbjct: 227 AFSSPSFI-SVMEVLKDSEVWQRVHVVYSLSKDLGLPGFRVG 267


>1m7yA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
          Length = 424

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 142 ALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
           AL +A  EA      ++ V+ T P NP GT  +R  +  L    ++  + +ISDEIY   
Sbjct: 168 ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT 227

Query: 202 VHDPTTVVHSPAEFAPERTV-----------ITTGLSKNLALGGWRIG 238
                + + S  E   +R             +   LSK+L L G+R+G
Sbjct: 228 AFSSPSFI-SVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVG 274


>1m4nA [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
          Length = 421

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 142 ALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
           AL +A  EA      ++ V+ T P NP GT  +R  +  L    ++  + +ISDEIY   
Sbjct: 165 ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT 224

Query: 202 VHDPTTVVHSPAEFAPERTV-----------ITTGLSKNLALGGWRIG 238
                + + S  E   +R             +   LSK+L L G+R+G
Sbjct: 225 AFSSPSFI-SVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVG 271


>1b8gB [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
          Length = 425

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 142 ALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
           AL +A  EA      ++ V+ T P NP GT  +R  +  L    ++  + +ISDEIY   
Sbjct: 171 ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT 230

Query: 202 VHDPTTVVHSPAEFAPERTV-----------ITTGLSKNLALGGWRIG 238
                + + S  E   +R             +   LSK+L L G+R+G
Sbjct: 231 AFSSPSFI-SVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVG 277


>1b8gA [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
          Length = 421

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 142 ALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
           AL +A  EA      ++ V+ T P NP GT  +R  +  L    ++  + +ISDEIY   
Sbjct: 168 ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT 227

Query: 202 VHDPTTVVHSPAEFAPERTV-----------ITTGLSKNLALGGWRIG 238
                + + S  E   +R             +   LSK+L L G+R+G
Sbjct: 228 AFSSPSFI-SVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVG 274


>2zyjA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 397

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 70  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 124

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 125 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 177

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 178 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 208


>2zg5A [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 390

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 66  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 120

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 121 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 173

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 174 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 204


>2z1yB [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 394

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 67  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 121

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 122 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 174

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 175 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 205


>2z1yA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 389

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 62  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 116

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 117 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 169

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 170 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 200


>2egyD [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 391

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 66  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 120

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 121 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 173

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 174 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 204


>2egyC [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 396

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 69  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 123

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 124 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 176

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 177 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 207


>2egyB [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 394

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 69  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 123

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 124 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 176

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 177 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 207


>3cbfA [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 392

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 15/151 (9%)

Query: 54  YGPVAGIRELREAAAGYWERRGLPTDPDLVVAGPGSKP---LLYALLLAIGGDVAIAAPS 110
           Y P  G   LR   A +     +   P+ V+   GS+    L+  + L  G  V + APS
Sbjct: 66  YSPTEGYAPLRAFVAEW-----IGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS 120

Query: 111 WVSYAAQSHLSGGQPLFVPTAPAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTG 170
           ++       L G  P F+ T PA    P+ DAL + +   R         +     NPTG
Sbjct: 121 YMGAIQAFRLQG--PRFL-TVPAGEEGPDLDALEEVLKRERPRF----LYLIPSFQNPTG 173

Query: 171 TVASRGTVRRLTEVAQELDLVIISDEIYRDL 201
            +      +RL ++  E  LV++ D+ YR+L
Sbjct: 174 GLTPLPARKRLLQMVMERGLVVVEDDAYREL 204


>1vp4B [c.67.1] AMINOTRANSFERASE, PUTATIVE
          Length = 408

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 167 NPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGL 226
           NP G   S    + L E+A++ DL I+ D+ Y  L ++  TV        PER V+    
Sbjct: 186 NPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGGPERVVLLNTF 245

Query: 227 SKNLALGGWRIGVA 240
           SK LA  G RIGVA
Sbjct: 246 SKVLA-PGLRIGVA 258


>1vp4A [c.67.1] AMINOTRANSFERASE, PUTATIVE
          Length = 412

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 167 NPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGL 226
           NP G   S    + L E+A++ DL I+ D+ Y  L ++  TV        PER V+    
Sbjct: 190 NPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGGPERVVLLNTF 249

Query: 227 SKNLALGGWRIGVA 240
           SK LA  G RIGVA
Sbjct: 250 SKVLA-PGLRIGVA 262


>2zy2A [x.x.x] L-ASPARTATE 4-CARBOXYLYASE
          Length = 521

 Score = 40.8 bits (94), Expect = 7e-06
 Identities = 41/173 (23%), Positives = 63/173 (36%), Gaps = 19/173 (10%)

Query: 77  PTDPDLVVAGPGSKPLLYAL-------LLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVP 129
           P   DL     G+  + Y         LL  G  VAI  P +  Y     L+      VP
Sbjct: 151 PESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVP 210

Query: 130 T-APAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQEL 188
             A    G    DA    + +      D++      P NP      + ++ R+  +  E 
Sbjct: 211 IHADPDNGWQYSDAELDKLKDP-----DVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQ 265

Query: 189 --DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIGV 239
             DL+I++D++Y     +      S     P  T++    SK     GWR+GV
Sbjct: 266 RPDLLILTDDVYGTFADE----FQSLFSVCPRNTLLVYSFSKYFGATGWRLGV 314


>1c7nA [c.67.1] CYSTALYSIN
          Length = 394

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 149 EARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHD--PT 206
           E  +  ++ +A++   P NP G V  +  ++++ ++  + DL++ SDEI+ DL+      
Sbjct: 157 EKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEH 216

Query: 207 TVVHSPAEFAPERTVITTGLSKNLALGG 234
           TV  S  E   ++T+  T  SK   + G
Sbjct: 217 TVFQSIDEQLADKTITFTAPSKTFNIAG 244


>2zy5F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 521

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 243 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 298

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 299 VYSFSKYFGATGWRLGV 315


>2zy5E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 511

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 238 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 293

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 294 VYSFSKYFGATGWRLGV 310


>2zy5D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 511

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 233 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 288

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 289 VYSFSKYFGATGWRLGV 305


>2zy5B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 515

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 240 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 295

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 296 VYSFSKYFGATGWRLGV 312


>2zy5A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 510

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 236 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 291

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 292 VYSFSKYFGATGWRLGV 308


>2zy4F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 535

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 249 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 304

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 305 VYSFSKYFGATGWRLGV 321


>2zy4E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 509

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 236 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 291

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 292 VYSFSKYFGATGWRLGV 308


>2zy4D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 515

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 229 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 284

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 285 VYSFSKYFGATGWRLGV 301


>2zy4C [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 511

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 237 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 292

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 293 VYSFSKYFGATGWRLGV 309


>2zy4B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 512

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 239 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 294

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 295 VYSFSKYFGATGWRLGV 311


>2zy4A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 524

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 251 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 306

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 307 VYSFSKYFGATGWRLGV 323


>2zy3F [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 523

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 244 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 299

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 300 VYSFSKYFGATGWRLGV 316


>2zy3E [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 512

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 238 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 293

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 294 VYSFSKYFGATGWRLGV 310


>2zy3D [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 514

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 233 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 288

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 289 VYSFSKYFGATGWRLGV 305


>2zy3C [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 516

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 241 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 296

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 297 VYSFSKYFGATGWRLGV 313


>2zy3B [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 515

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 240 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 295

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 296 VYSFSKYFGATGWRLGV 312


>2zy3A [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
          Length = 510

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP      + ++ R+  +  E   DL+I++D++Y     D      S     PE T++
Sbjct: 236 PSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADD----FQSLFAICPENTLL 291

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 292 VYSFSKYFGATGWRLGV 308


>1lkcA [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
          Length = 355

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           DA+ +A+T       D+  +    P+NPTG +  R  ++ + +  + L++ +I DE + D
Sbjct: 130 DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFID 183

Query: 201 LVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
            +   T  +  PA        +   L+K  A+ G R+G
Sbjct: 184 FIPHETGFI--PALKDNPHIWVLRSLTKFYAIPGLRLG 219


>1lc8A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
          Length = 356

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           DA+ +A+T       D+  +    P+NPTG +  R  ++ + +  + L++ +I DE + D
Sbjct: 131 DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFID 184

Query: 201 LVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
            +   T  +  PA        +   L+K  A+ G R+G
Sbjct: 185 FIPHETGFI--PALKDNPHIWVLRSLTKFYAIPGLRLG 220


>1lc7A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
          Length = 358

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           DA+ +A+T       D+  +    P+NPTG +  R  ++ + +  + L++ +I DE + D
Sbjct: 134 DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFID 187

Query: 201 LVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
            +   T  +  PA        +   L+K  A+ G R+G
Sbjct: 188 FIPHETGFI--PALKDNPHIWVLRSLTKFYAIPGLRLG 223


>1lc5A [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
          Length = 355

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 141 DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRD 200
           DA+ +A+T       D+  +    P+NPTG +  R  ++ + +  + L++ +I DE + D
Sbjct: 135 DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFID 188

Query: 201 LVHDPTTVVHSPAEFAPERTVITTGLSKNLALGGWRIG 238
            +   T  +  PA        +   L+K  A+ G R+G
Sbjct: 189 FIPHETGFI--PALKDNPHIWVLRSLTKFYAIPGLRLG 224


>3dzzB [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
          Length = 374

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV 202
           P NP G   S   V+R+ E+  +  +++ISDEI+ DLV
Sbjct: 157 PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLV 194


>3dzzA [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
          Length = 375

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLV 202
           P NP G   S   V+R+ E+  +  +++ISDEI+ DLV
Sbjct: 157 PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLV 194


>3fddA [x.x.x] L-ASPARTATE-BETA-DECARBOXYLASE
          Length = 502

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 165 PDNPTGTVASRGTVRRLTEVAQEL--DLVIISDEIYRDLVHDPTTVVHSPAEFAPERTVI 222
           P NP        ++ R+ ++  E   DL+I++D++Y            S     P  T++
Sbjct: 228 PSNPPSVKMDERSLERVRKIVAEHRPDLMILTDDVYGTFADG----FQSLFAICPANTLL 283

Query: 223 TTGLSKNLALGGWRIGV 239
               SK     GWR+GV
Sbjct: 284 VYSFSKYFGATGWRLGV 300


>1d2fB [c.67.1] MALY PROTEIN
          Length = 368

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 15/145 (10%)

Query: 66  AAAGYW--ERRGLPTDPDLVVAGPGSKPLLYALLLA---IGGDVAIAAPSWVSYAAQSHL 120
           AA  +W   +     D   VV GP    ++  L+      G  V I  P++ ++     +
Sbjct: 49  AAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAF--YKAI 106

Query: 121 SGGQPLFVPTA---PAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
            G Q   +P A    A G   +   L     EA  A  + + ++   P NPTG V +   
Sbjct: 107 EGNQRTVMPVALEKQADGWFCDMGKL-----EAVLAKPECKIMLLCSPQNPTGKVWTCDE 161

Query: 178 VRRLTEVAQELDLVIISDEIYRDLV 202
           +  + ++ +   + +ISDEI+ D+V
Sbjct: 162 LEIMADLCERHGVRVISDEIHMDMV 186


>1d2fA [c.67.1] MALY PROTEIN
          Length = 361

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 15/145 (10%)

Query: 66  AAAGYW--ERRGLPTDPDLVVAGPGSKPLLYALLLA---IGGDVAIAAPSWVSYAAQSHL 120
           AA  +W   +     D   VV GP    ++  L+      G  V I  P++ ++     +
Sbjct: 42  AAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAF--YKAI 99

Query: 121 SGGQPLFVPTA---PAQGGVPEPDALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGT 177
            G Q   +P A    A G   +   L     EA  A  + + ++   P NPTG V +   
Sbjct: 100 EGNQRTVMPVALEKQADGWFCDMGKL-----EAVLAKPECKIMLLCSPQNPTGKVWTCDE 154

Query: 178 VRRLTEVAQELDLVIISDEIYRDLV 202
           +  + ++ +   + +ISDEI+ D+V
Sbjct: 155 LEIMADLCERHGVRVISDEIHMDMV 179


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 932,898,246
Number of extensions: 36068260
Number of successful extensions: 86642
Number of sequences better than 1.0e-03: 2824
Number of HSP's gapped: 84692
Number of HSP's successfully gapped: 3155
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)