BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ56592.1 tfus0 AAZ56592.1 GIB00263CH01 "dihydrolipoamide
dehydrogenase"
         (460 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1xdiA [c.3.1 - d.87.1] RV3303C-LPDA                                   484   e-139
1ebdA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE         231   2e-63
1zy8A [x.x.x] DIHYDROLIPOYL DEHYDROGENASE, MITOCHONDRIAL              208   2e-56
2yquA [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT               208   2e-56
2eq7A [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT               208   2e-56
1zmdE [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             206   1e-55
1zmcD [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             206   1e-55
1zmcB [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             206   1e-55
1zmcA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             206   1e-55
3ladA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE         206   1e-55
2f5zI [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             205   2e-55
2eq6A [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE        201   5e-54
1lpfA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE         199   1e-53
1dxlA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE         191   4e-51
1jehA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE         190   6e-51
1lvlA [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE                          190   8e-51
1zx9A [x.x.x] MERCURIC REDUCTASE                                      172   2e-45
1zk7A [x.x.x] MERCURIC REDUCTASE                                      172   2e-45
2a8xA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             163   1e-42
2r9zB [x.x.x] GLUTATHIONE AMIDE REDUCTASE                             162   2e-42
2r9zA [x.x.x] GLUTATHIONE AMIDE REDUCTASE                             160   7e-42
2rabB [x.x.x] GLUTATHIONE AMIDE REDUCTASE                             159   2e-41
2rabA [x.x.x] GLUTATHIONE AMIDE REDUCTASE                             159   2e-41
1ojtA [x.x.x] SURFACE PROTEIN                                         158   3e-41
1bhyA [x.x.x] P64K                                                    157   4e-41
2qaeA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE                             155   3e-40
2grtA [x.x.x] GLUTATHIONE REDUCTASE                                   152   2e-39
1grtA [x.x.x] GLUTATHIONE REDUCTASE                                   152   2e-39
2w0hB [x.x.x] TRYPANOTHIONE REDUCTASE                                 147   6e-38
2w0hA [x.x.x] TRYPANOTHIONE REDUCTASE                                 147   6e-38
2jk6A [x.x.x] TRYPANOTHIONE REDUCTASE                                 147   6e-38
2ve2B [x.x.x] TRYPANOTHIONE REDUCTASE                                 145   2e-37
2ve2A [x.x.x] TRYPANOTHIONE REDUCTASE                                 145   2e-37
1grbA [c.3.1 - c.3.1 - d.87.1 (1bwcA)] GLUTATHIONE REDUCTASE          143   9e-37
3dk9A [x.x.x] GLUTATHIONE REDUCTASE                                   143   9e-37
1gesB [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE                  141   3e-36
1gesA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE                  141   3e-36
1grgA [x.x.x] GLUTATHIONE REDUCTASE                                   141   4e-36
2tprA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                140   1e-35
1gxfA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED...   138   4e-35
1fecB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1fecA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1feaB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1feaA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1bzlA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED...   138   4e-35
1aogB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1aogA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                138   4e-35
1ndaA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE OXIDOREDUCTASE           137   5e-35
1tytB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED...   137   8e-35
1tytA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED...   137   8e-35
1typB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                137   8e-35
1typA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE                137   8e-35
1gerB [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE                  135   2e-34
1gerA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE                  135   2e-34
1dncA [x.x.x] GLUTATHIONE REDUCTASE                                   135   2e-34
1gsnA [x.x.x] GLUTATHIONE REDUCTASE                                   129   2e-32
1zkqA [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL                  120   8e-30
1zdlA [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL                  120   8e-30
2nvkX [x.x.x] THIOREDOXIN REDUCTASE                                   119   2e-29
3dh9A [x.x.x] THIOREDOXIN REDUCTASE 1                                 119   2e-29
3dghA [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL                  119   2e-29
3dghB [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL                  118   3e-29
2v6oA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE                       115   3e-28
3h4kA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE                       115   3e-28
2hqmA [x.x.x] GLUTATHIONE REDUCTASE                                   113   1e-27
1onfA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE                  105   3e-25
3eanF [x.x.x] THIOREDOXIN REDUCTASE 1                                  97   1e-22
3eanD [x.x.x] THIOREDOXIN REDUCTASE 1                                  97   1e-22
3eanC [x.x.x] THIOREDOXIN REDUCTASE 1                                  97   1e-22
3eanA [x.x.x] THIOREDOXIN REDUCTASE 1                                  97   1e-22
1h6vE [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE                   96   2e-22
1h6vC [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE                   96   2e-22
1h6vB [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE                   96   2e-22
1h6vA [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE                   96   2e-22
2zzcA [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC                     96   2e-22
2zzbC [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC                     96   2e-22
2zz0B [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC                     96   2e-22
2j3nF [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
2j3nD [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
2j3nC [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
2j3nB [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
2j3nA [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
2cfyA [x.x.x] THIOREDOXIN REDUCTASE 1                                  96   2e-22
3ic9C [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE                           92   3e-21
3ic9A [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE                           92   3e-21
3cgcA [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,            89   3e-20
2cduB [x.x.x] NADPH OXIDASE                                            82   2e-18
2cduA [x.x.x] NADPH OXIDASE                                            82   2e-18
1joaA [x.x.x] NADH PEROXIDASE                                          70   9e-15
1f8wA [c.3.1 - c.3.1 - d.87.1] NADH PEROXIDASE                         70   9e-15
2v3aA [x.x.x] RUBREDOXIN REDUCTASE                                     69   4e-14
1nhsA [x.x.x] NADH PEROXIDASE                                          69   4e-14
3iwaA [x.x.x] FAD-DEPENDENT PYRIDINE NUCLEOTIDE-DISULPHIDE             68   5e-14
1nhqA [x.x.x] NADH PEROXIDASE                                          68   6e-14
1nhrA [x.x.x] NADH PEROXIDASE                                          67   1e-13
1nhpA [x.x.x] NADH PEROXIDASE                                          67   1e-13
1mo9A [c.3.1 - c.3.1 - d.87.1] ORF3                                    67   1e-13
2bc1A [x.x.x] NADH OXIDASE                                             64   9e-13
2bc0A [x.x.x] NADH OXIDASE                                             64   9e-13
3ctyB [x.x.x] THIOREDOXIN REDUCTASE                                    59   3e-11
3ctyA [x.x.x] THIOREDOXIN REDUCTASE                                    59   3e-11
1m6iA [c.3.1 - c.3.1 - d.87.1] PROGRAMMED CELL DEATH PROTEIN 8         54   7e-10
3cgbA [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,            54   7e-10
1gv4A [c.3.1 - c.3.1 - d.87.1] PROGRAMED CELL DEATH PROTEIN 8          52   5e-09
3gd4B [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3gd4A [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3gd3D [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3gd3C [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3gd3B [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3gd3A [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL               52   5e-09
3f8pD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           52   5e-09
3ef6A [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--              51   6e-09
1xhcA [c.3.1 - c.3.1 - d.87.1] NADH OXIDASE /NITRITE REDUCTASE         50   1e-08
1yqzA [x.x.x] COENZYME A DISULFIDE REDUCTASE                           49   3e-08
1q1wB [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE                 49   4e-08
1q1wA [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE                 49   4e-08
1q1rA [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE                 49   4e-08
3f8rD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   5e-08
3f8dD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   5e-08
3f8rB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8rA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8pC [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8pB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8pA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8dC [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8dB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
3f8dA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)                           48   7e-08
1hyuA [c.47.1 - c.47.1 - c.3.1 - c.3.1] ALKYL HYDROPEROXIDE REDU...    47   1e-07
1cl0A [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE                            47   1e-07
1tdfA [x.x.x] THIOREDOXIN REDUCTASE                                    47   1e-07
1f6mA [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE                            47   1e-07
1fl2A [c.3.1 - c.3.1] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F          46   2e-07
2q7vB [x.x.x] THIOREDOXIN REDUCTASE                                    43   2e-06
2q7vA [x.x.x] THIOREDOXIN REDUCTASE                                    43   2e-06
2yvjA [x.x.x] FERREDOXIN REDUCTASE                                     42   3e-06
2gr3A [x.x.x] FERREDOXIN REDUCTASE                                     42   3e-06
2gqwA [x.x.x] FERREDOXIN REDUCTASE                                     42   3e-06
1d7yA [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE                    42   3e-06
1vdcA [x.x.x] NADPH DEPENDENT THIOREDOXIN REDUCTASE                    40   1e-05
3fg2P [x.x.x] PUTATIVE RUBREDOXIN REDUCTASE                            40   1e-05
2i0zA [x.x.x] NAD(FAD)-UTILIZING DEHYDROGENASES                        34   7e-04
2vhyB [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhyA [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhxD [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhxC [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhxB [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhxA [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhwE [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhwB [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhwA [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
2vhvA [x.x.x] ALANINE DEHYDROGENASE                                    34   0.001
3d8xA [x.x.x] THIOREDOXIN REDUCTASE 1                                  34   0.001

>1xdiA [c.3.1 - d.87.1] RV3303C-LPDA
          Length = 459

 Score =  484 bits (1245), Expect = e-139
 Identities = 265/470 (56%), Positives = 331/470 (70%), Gaps = 27/470 (5%)

Query: 1   MTKVVIIGGGPGGYEAALVAAQLGAD---VTVIERDGIGGASVLTDCVPSKTLIATSVRT 57
           +T++VI+GGGP GYEAALVAA    +   VTVI+ DGIGGA+VL DCVPSKT IA++   
Sbjct: 1   VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLR 60

Query: 58  SYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGE 117
           + ++ A  LG +           ++ L  ++ARVK LA AQS D   +L + GV++I G 
Sbjct: 61  TELRRAPHLGFH-----------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGR 109

Query: 118 ARLVDPHIVAVGDERIRA------------DVVLIATGAHPRELPTARPDGERILTWRQL 165
             L+D     +   RI+A            DVVL+ATGA PR LP+A+PDGERILTWRQL
Sbjct: 110 GELIDS-TPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQL 168

Query: 166 YDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFAR 225
           YDL+ LP+ LIVVGSGVTGAEF +AY  LG  VT+V+S+D V+P +DADAA VLE+ FA 
Sbjct: 169 YDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAE 228

Query: 226 RGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDE 285
           RG+ +  N+RA SVTRT AGVLV +TDGR +EGSH LMT+G VPNT+ LGLE  GI+L  
Sbjct: 229 RGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGR 288

Query: 286 RGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVAST 345
             ++ VDRVSRT   G+YAAGDCTG+  LASVAAMQGRIAM+HALG  VSP+RL TVA+T
Sbjct: 289 GNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAAT 348

Query: 346 VFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLG 405
           VFT PE+AAVG  +  + +G V  R + LPL TN RAKM   R GFVK+ CR+ T     
Sbjct: 349 VFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTXXXXX 408

Query: 406 GVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLM 455
                P ASELIL +++AVQ R+TV+++A T AVYPSLSGS+TEAAR LM
Sbjct: 409 XXXXAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLM 458


>1ebdA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 455

 Score =  231 bits (590), Expect = 2e-63
 Identities = 143/439 (32%), Positives = 226/439 (51%), Gaps = 16/439 (3%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDL 79
           AAQLG  VT++E+  +GG  +   C+PSK LI+ S R    K +  +GI   N       
Sbjct: 22  AAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAEN------- 74

Query: 80  VRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV--GD--ERIRA 135
           V ++   V      + +  +      L+   VEI+ GEA  VD + V V  GD  +    
Sbjct: 75  VTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTF 134

Query: 136 DVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALG 195
              +IATG+ P ELP  +    RIL      +L E+P+ L+V+G G  G E   AY   G
Sbjct: 135 KNAIIATGSRPIELPNFK-FSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFG 193

Query: 196 SDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLT---D 252
           + VT++     ++   +   A +++    ++G+ V+ N+ A+     + GV V      +
Sbjct: 194 TKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGE 253

Query: 253 GRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVN 312
            + I+  + L+TVG  PNT  LGLE+ GI++  RG ++VD+  RTS P ++A GD     
Sbjct: 254 TKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGP 313

Query: 313 MLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIV 372
            LA  A+ +G++A   A+    S +    + + VF+ PE A+VG  E       +D    
Sbjct: 314 ALAHKASYEGKVAA-EAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAA 372

Query: 373 KLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDD 432
           K P A N RA   N  DGF+KL+ R+  G+++G  I+GP AS++I  + LA++  +T +D
Sbjct: 373 KFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAED 432

Query: 433 VAHTFAVYPSLSGSVTEAA 451
           +A T   +P+L     EAA
Sbjct: 433 IALTIHAHPTLGEIAMEAA 451


>1zy8A [x.x.x] DIHYDROLIPOYL DEHYDROGENASE, MITOCHONDRIAL
          Length = 474

 Score =  208 bits (530), Expect = 2e-56
 Identities = 145/462 (31%), Positives = 232/462 (50%), Gaps = 23/462 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 9   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 68

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
           K+ A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 69  KDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 121

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 122 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 181

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 182 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 241

Query: 235 RAESVTRTDAG---VLVRLTDGRVIEGSHC---LMTVGMVPNTANLGLEEAGIRLDERGF 288
           +    T+   G   V +    G   E   C   L+ +G  P T NLGLEE GI LD RG 
Sbjct: 242 KVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGR 301

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFT 348
           + V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++T
Sbjct: 302 IPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYT 360

Query: 349 HPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
           HPE+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I
Sbjct: 361 HPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHI 420

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           +GP A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 421 LGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 462


>2yquA [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
          Length = 455

 Score =  208 bits (530), Expect = 2e-56
 Identities = 139/454 (30%), Positives = 217/454 (47%), Gaps = 12/454 (2%)

Query: 1   MTKVVIIGGGPGGYEAALVAAQLGADVTVIERD-GIGGASVLTDCVPSKTLIATSVRTSY 59
           M  +++IG GPGGY AA+ AAQLG  V V+E++  +GG  +   C+PSK L+ T+ R  Y
Sbjct: 1   MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEKALGGTCLRVGCIPSKALLETTERI-Y 59

Query: 60  VKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEAR 119
                           D       L  + A   ++ QA +       +  G+    G AR
Sbjct: 60  XXXXXXXXXXXXXXXXD-------LPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTAR 112

Query: 120 LVDPHIVAVGD--ERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIV 177
            +    V V +  E + A  +LIATG+ P   P A+ D ER++T  +     E+P++   
Sbjct: 113 FLSERKVLVEETGEELEARYILIATGSAPLIPPWAQVDYERVVTSTEALSFPEVPKRXXX 172

Query: 178 VGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAE 237
                        +  LG++V ++   DR++PT D + +R  E VF ++G+T+    R  
Sbjct: 173 XXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQGLTIRTGVRVT 232

Query: 238 SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRT 297
           +V     G  V L  G V+E    L+ VG  P T  L LE AG+  DERG + VD   RT
Sbjct: 233 AVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLRT 292

Query: 298 STPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGA 357
             P +YA GD     MLA  A+ +G  A+ H +      +    + S V+THPE+AAVG 
Sbjct: 293 RVPHIYAIGDVVRGPMLAHKASEEGIAAVEHMV-RGFGHVDYQAIPSVVYTHPEIAAVGY 351

Query: 358 TEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELI 417
           TE+++ +  +  ++ K P + + RA+     +GF+K++    T  +LG   +G R  ++ 
Sbjct: 352 TEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGVHGIGARVGDVX 411

Query: 418 LAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
                         D+      +PSLS  + EAA
Sbjct: 412 XXXXXXXXXXXXXXDLGRAPHAHPSLSEILKEAA 445


>2eq7A [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
          Length = 452

 Score =  208 bits (530), Expect = 2e-56
 Identities = 139/454 (30%), Positives = 217/454 (47%), Gaps = 12/454 (2%)

Query: 1   MTKVVIIGGGPGGYEAALVAAQLGADVTVIERD-GIGGASVLTDCVPSKTLIATSVRTSY 59
           M  +++IG GPGGY AA+ AAQLG  V V+E++  +GG  +   C+PSK L+ T+ R  Y
Sbjct: 1   MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEKALGGTCLRVGCIPSKALLETTERI-Y 59

Query: 60  VKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEAR 119
                           D       L  + A   ++ QA +       +  G+    G AR
Sbjct: 60  XXXXXXXXXXXXXXXXD-------LPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTAR 112

Query: 120 LVDPHIVAVGD--ERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIV 177
            +    V V +  E + A  +LIATG+ P   P A+ D ER++T  +     E+P++   
Sbjct: 113 FLSERKVLVEETGEELEARYILIATGSAPLIPPWAQVDYERVVTSTEALSFPEVPKRXXX 172

Query: 178 VGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAE 237
                        +  LG++V ++   DR++PT D + +R  E VF ++G+T+    R  
Sbjct: 173 XXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQGLTIRTGVRVT 232

Query: 238 SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRT 297
           +V     G  V L  G V+E    L+ VG  P T  L LE AG+  DERG + VD   RT
Sbjct: 233 AVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLRT 292

Query: 298 STPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGA 357
             P +YA GD     MLA  A+ +G  A+ H +      +    + S V+THPE+AAVG 
Sbjct: 293 RVPHIYAIGDVVRGPMLAHKASEEGIAAVEHMV-RGFGHVDYQAIPSVVYTHPEIAAVGY 351

Query: 358 TEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELI 417
           TE+++ +  +  ++ K P + + RA+     +GF+K++    T  +LG   +G R  ++ 
Sbjct: 352 TEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGVHGIGARVGDVX 411

Query: 418 LAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
                         D+      +PSLS  + EAA
Sbjct: 412 XXXXXXXXXXXXXXDLGRAPHAHPSLSEILKEAA 445


>1zmdE [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 473

 Score =  206 bits (524), Expect = 1e-55
 Identities = 144/462 (31%), Positives = 231/462 (50%), Gaps = 23/462 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 8   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 67

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
            + A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 68  TDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 120

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 121 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 180

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 181 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 240

Query: 235 RAESVTRTDAG---VLVRLTDGRVIEGSHC---LMTVGMVPNTANLGLEEAGIRLDERGF 288
           +    T+   G   V +    G   E   C   L+ +G  P T NLGLEE GI LD RG 
Sbjct: 241 KVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGR 300

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFT 348
           + V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++T
Sbjct: 301 IPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYT 359

Query: 349 HPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
           HPE+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I
Sbjct: 360 HPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHI 419

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           +GP A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 420 LGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 461


>1zmcD [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 474

 Score =  206 bits (524), Expect = 1e-55
 Identities = 144/462 (31%), Positives = 231/462 (50%), Gaps = 23/462 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 9   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 68

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
            + A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 69  TDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 121

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 122 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 181

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 182 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 241

Query: 235 RAESVTRTDAG---VLVRLTDGRVIEGSHC---LMTVGMVPNTANLGLEEAGIRLDERGF 288
           +    T+   G   V +    G   E   C   L+ +G  P T NLGLEE GI LD RG 
Sbjct: 242 KVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGR 301

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFT 348
           + V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++T
Sbjct: 302 IPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYT 360

Query: 349 HPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
           HPE+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I
Sbjct: 361 HPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHI 420

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           +GP A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 421 LGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 462


>1zmcB [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 471

 Score =  206 bits (524), Expect = 1e-55
 Identities = 144/462 (31%), Positives = 231/462 (50%), Gaps = 23/462 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 6   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 65

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
            + A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 66  TDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 118

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 119 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 178

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 179 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 238

Query: 235 RAESVTRTDAG---VLVRLTDGRVIEGSHC---LMTVGMVPNTANLGLEEAGIRLDERGF 288
           +    T+   G   V +    G   E   C   L+ +G  P T NLGLEE GI LD RG 
Sbjct: 239 KVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGR 298

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFT 348
           + V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++T
Sbjct: 299 IPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYT 357

Query: 349 HPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
           HPE+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I
Sbjct: 358 HPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHI 417

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           +GP A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 418 LGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 459


>1zmcA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 472

 Score =  206 bits (524), Expect = 1e-55
 Identities = 144/462 (31%), Positives = 231/462 (50%), Gaps = 23/462 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 7   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 66

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
            + A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 67  TDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 119

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 120 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 179

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 180 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 239

Query: 235 RAESVTRTDAG---VLVRLTDGRVIEGSHC---LMTVGMVPNTANLGLEEAGIRLDERGF 288
           +    T+   G   V +    G   E   C   L+ +G  P T NLGLEE GI LD RG 
Sbjct: 240 KVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGR 299

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFT 348
           + V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++T
Sbjct: 300 IPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYT 358

Query: 349 HPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
           HPE+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I
Sbjct: 359 HPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHI 418

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           +GP A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 419 LGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 460


>3ladA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 472

 Score =  206 bits (523), Expect = 1e-55
 Identities = 132/446 (29%), Positives = 228/446 (51%), Gaps = 24/446 (5%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-------DGIGGASVLTDCVPSKTLIATSVR 56
           V++IG GPGGY AA+ +AQLG    +IE+         +GG  +   C+PSK L+ +S +
Sbjct: 6   VIVIGAGPGGYVAAIKSAQLGLKTALIEKYKGKEGKTALGGTCLNVGCIPSKALLDSSYK 65

Query: 57  TSYVKEAATL-GINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIII 115
                E+  L GI+ G        V +++ T+ AR  ++ +  +   A+ ++  GV +  
Sbjct: 66  FHEAHESFKLHGISTGE-------VAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFE 118

Query: 116 GEARLVDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNE 170
           G  +L+    V V       + +  + V++A+G+ P E+P A  D + I+      D   
Sbjct: 119 GHGKLLAGKKVEVTAADGSSQVLDTENVILASGSKPVEIPPAPVDQDVIVDSTGALDFQN 178

Query: 171 LPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTV 230
           +P KL V+G+GV G E  + +  LG++VT++ + D+ +P  D   A+  + +  ++G+ +
Sbjct: 179 VPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGLKI 238

Query: 231 LGNSRAESVTRTDAGVLVRLTDGRVIEG---SHCLMTVGMVPNTANLGLEEAGIRLDERG 287
           L  +R       +  V V+  D    +       ++ VG  P T +L   ++G+ LDERG
Sbjct: 239 LLGARVTGTEVKNKQVTVKFVDAEGEKSQAFDKLIVAVGRRPVTTDLLAADSGVTLDERG 298

Query: 288 FVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVF 347
           F+ VD    TS PGVYA GD     MLA  A+ +G + +   +    + +    + + ++
Sbjct: 299 FIYVDDYCATSVPGVYAIGDVVRGAMLAHKASEEG-VVVAERIAGHKAQMNYDLIPAVIY 357

Query: 348 THPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGV 407
           THPE+A VG TE  + +  V   +   P A + RA   N   GFVK+I    T  VLG  
Sbjct: 358 THPEIAGVGKTEQALKAEGVAINVGVFPFAASGRAMAANDTAGFVKVIADAKTDRVLGVH 417

Query: 408 IVGPRASELILAVSLAVQQRLTVDDV 433
           ++GP A+EL+   ++A++   + +D+
Sbjct: 418 VIGPSAAELVQQGAIAMEFGTSAEDL 443


>2f5zI [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 470

 Score =  205 bits (521), Expect = 2e-55
 Identities = 142/460 (30%), Positives = 230/460 (50%), Gaps = 21/460 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATS--VRTSYV 60
           V +IG GPGGY AA+ AAQLG     IE+ + +GG  +   C+PSK L+  S     ++ 
Sbjct: 7   VTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHG 66

Query: 61  KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL 120
            + A+ GI +         VR+ L  +  +     +A +   A+  +   V  + G  ++
Sbjct: 67  TDFASRGIEMSE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI 119

Query: 121 VDPHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL 175
              + V       G + I    +LIATG+     P    D + I++      L ++PEK+
Sbjct: 120 TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKM 179

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNS 234
           +V+G+GV G E  + +Q LG+DVT V     V     D + ++  + +  ++G     N+
Sbjct: 180 VVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNT 239

Query: 235 RAESVTRTDAGVL----VRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQ 290
           +    T+   G +       +   VI     L+ +G  P T NLGLEE GI LD RG + 
Sbjct: 240 KVTGATKKSDGKIDVSIEAASKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIP 299

Query: 291 VDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP 350
           V+   +T  P +YA GD     MLA  A  +G I +    G AV  +  + V S ++THP
Sbjct: 300 VNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP 358

Query: 351 ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVG 410
           E+A VG +E+ +    ++ ++ K P A N RAK +   DG VK++ ++ T  VLG  I+G
Sbjct: 359 EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILG 418

Query: 411 PRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
           P A E++   +LA++   + +D+A     +P+LS +  EA
Sbjct: 419 PGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREA 458


>2eq6A [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
          Length = 460

 Score =  201 bits (510), Expect = 5e-54
 Identities = 144/456 (31%), Positives = 213/456 (46%), Gaps = 17/456 (3%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEA 63
           +++IG GPGGY AA+ AAQLG  V            +   C+P+K            K A
Sbjct: 6   LIVIGTGPGGYHAAIRAAQLGLKVLXXXXXXXXXXCLNVGCIPTKXXXXXXXXXXXXKVA 65

Query: 64  ATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDP 123
              G+    +PE      ++LK +     +                GVE++ G ARLV P
Sbjct: 66  EGFGLKA--KPE------LDLKKLGGWRDQXXXXXXXXXXXXXXXNGVELLRGFARLVGP 117

Query: 124 HIVAVGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNE-LPEKLIVVGSGV 182
             V VG ER  A  +++ATG+ P EL    P GE +    +   + E LP++L+V+G G 
Sbjct: 118 KEVEVGGERYGAKSLILATGSEPLELK-GFPFGEDVWDSTRALKVEEGLPKRLLVIGGGA 176

Query: 183 TGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRT 242
            G E    Y+ LG++VTL+     ++P  D + A +L     + G+ V   ++A    + 
Sbjct: 177 VGLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTKTKAVGYEKK 236

Query: 243 DAGVLVRLTDGRVIEGSHCLMTVGMV-----PNTANLGLEEAGIRLDERGFVQVDRVSRT 297
             G+ VRL                       P T  LGLE+AG+++DERGF++V+    T
Sbjct: 237 KDGLHVRLEPAXXXXXXXXXXXXXXXXXXRKPRTEGLGLEKAGVKVDERGFIRVNARMET 296

Query: 298 STPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGA 357
           S PGVYA GD     +LA  A  +G IA  +A G          V S V+T PE A VG 
Sbjct: 297 SVPGVYAIGDAARPPLLAHKAMREGLIAAENAAGK--DSAFDYQVPSVVYTSPEWAGVGL 354

Query: 358 TEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELI 417
           TE++        ++ K PLA + RA      +G VK++  + T ++LG  IVGP+     
Sbjct: 355 TEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQXXXXX 414

Query: 418 LAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARS 453
                      T+ D+A T   +P+LS S+ EAA +
Sbjct: 415 XXXXXXXXXXXTLTDLALTVHPHPTLSESLMEAAEA 450


>1lpfA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 472

 Score =  199 bits (506), Expect = 1e-53
 Identities = 138/464 (29%), Positives = 230/464 (49%), Gaps = 24/464 (5%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERD-------GIGGASVLTDCVPSKTLIATSVR 56
           VV+IG GPGGY AA+ AAQLG     IE+         +GG  +   C+PSK L+ +S +
Sbjct: 6   VVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYK 65

Query: 57  TSYVKEAATL-GINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIII 115
               KEA  + GI           V +++  + AR   + +  +   A   +  GV    
Sbjct: 66  YHEAKEAFKVHGIEAKG-------VTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFE 118

Query: 116 GEARLVDPHIVAVGD-----ERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNE 170
           G  +L+    V V       + + A+ V+IA+G+ P E+P A    + I+      +   
Sbjct: 119 GHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQA 178

Query: 171 LPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTV 230
           +P+KL V+G+GV G E  + +  LG++VT++ + D+ +P  D   A+    V  ++G+ +
Sbjct: 179 VPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNI 238

Query: 231 LGNSRAESVTRTDAGVLVRLTDGRVIEGS---HCLMTVGMVPNTANLGLEEAGIRLDERG 287
              +R  +       V V  TD    +       ++ VG  P T +L   ++G+ LDERG
Sbjct: 239 RLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERG 298

Query: 288 FVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVF 347
           F+ VD   +TS PGV+A GD     MLA  A+ +G + +   +    + +    + S ++
Sbjct: 299 FIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEG-VMVAERIAGHKAQMNYDLIPSVIY 357

Query: 348 THPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGV 407
           THPE+A VG TE  + +  V+  +   P A + RA   N   G VK+I    T  VLG  
Sbjct: 358 THPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVH 417

Query: 408 IVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
           ++GP A+EL+   ++ ++   + +D+      +P+LS ++ EAA
Sbjct: 418 VIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAA 461


>1dxlA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 467

 Score =  191 bits (485), Expect = 4e-51
 Identities = 129/444 (29%), Positives = 220/444 (49%), Gaps = 20/444 (4%)

Query: 20  AAQLGADVTVIERDG-IGGASVLTDCVPSKTLIATSVRTSYVKEA-ATLGINVGNEPEDK 77
           AAQLG   T IE+ G +GG  +   C+PSK L+ +S      K + A  G+ V N     
Sbjct: 22  AAQLGFKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGVKVSN----- 76

Query: 78  DLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVG-----DER 132
             V ++L  +  +  +     +       +   V  + G  + V P  ++V      +  
Sbjct: 77  --VEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDTIEGENTV 134

Query: 133 IRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQ 192
           ++   ++IATG+  + LP    D ++I++      L+E+P+KL+V+G+G  G E  + + 
Sbjct: 135 VKGKHIIIATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWG 194

Query: 193 ALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLT- 251
            +GS+VT+V     ++PT DA+  +  +    ++GM     ++   V  +  GV + +  
Sbjct: 195 RIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEP 254

Query: 252 ----DGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGD 307
               +  +IE    L++ G  P T+ L L++ G+  D+ G + V+    T+  GVYA GD
Sbjct: 255 SAGGEQTIIEADVVLVSAGRTPFTSGLNLDKIGVETDKLGRILVNERFSTNVSGVYAIGD 314

Query: 308 CTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRV 367
                MLA  A   G +A    L   V  +    V   V+T+PE+A+VG TE+ V    V
Sbjct: 315 VIPGPMLAHKAEEDG-VACVEYLAGKVGHVDYDKVPGVVYTNPEVASVGKTEEQVKETGV 373

Query: 368 DGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQR 427
           + R+ K P   N RAK  +  +G VK+I  + T  +LG  I+ P A ELI   ++A+Q  
Sbjct: 374 EYRVGKFPFMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAPNAGELIHEAAIALQYD 433

Query: 428 LTVDDVAHTFAVYPSLSGSVTEAA 451
            + +D+A     +P++S ++ EAA
Sbjct: 434 ASSEDIARVCHAHPTMSEAIKEAA 457


>1jehA [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 478

 Score =  190 bits (483), Expect = 6e-51
 Identities = 139/470 (29%), Positives = 225/470 (47%), Gaps = 33/470 (7%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERDG-IGGASVLTDCVPSKTLIATS-----VRT 57
           VVIIGGGP GY AA+ AAQLG +   +E+ G +GG  +   C+PSK L+  S     + T
Sbjct: 8   VVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHT 67

Query: 58  SYVKEAATLG----INVGNEPEDKDLV------RVELKTVNARVKRLAQAQSVDTANRLR 107
              K    +     INV N  + KD         +EL     +V       S +   ++R
Sbjct: 68  EAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIR 127

Query: 108 TEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYD 167
              V+ + G  +  + HI+ V +       +++ATG+     P    D E+I++      
Sbjct: 128 VTPVDGLEGTVK--EDHILDVKN-------IIVATGSEVTPFPGIEIDEEKIVSSTGALS 178

Query: 168 LNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRG 227
           L E+P++L          E  + Y  LGS VT+V  + ++  + D + A+  +    ++G
Sbjct: 179 LKEIPKRLTXXXXXXXXLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQG 238

Query: 228 MTVLGNSRAESVTRTDAGVLVRLT--DGRV-----IEGSHCLMTVGMVPNTANLGLEEAG 280
           +    +++  S  R D   +V +   D +      +E    L+ VG  P  A LG E+ G
Sbjct: 239 LDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIG 298

Query: 281 IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLS 340
           + +D+RG + +D    +  P +   GD T   MLA  A  +G IA    L      +  +
Sbjct: 299 LEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEG-IAAVEMLKTGHGHVNYN 357

Query: 341 TVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHT 400
            + S +++HPE+A VG TE+ +    +D +I K P A N RAK +   +GFVK++    T
Sbjct: 358 NIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKT 417

Query: 401 GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEA 450
             +LG  I+GP A E+I    LA++   + +DVA     +P+LS +  EA
Sbjct: 418 ERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEA 467


>1lvlA [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 458

 Score =  190 bits (482), Expect = 8e-51
 Identities = 136/449 (30%), Positives = 226/449 (50%), Gaps = 23/449 (5%)

Query: 11  PGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVR---TSYVKEAATLG 67
           PGGY AA+ A QLG    ++E   +GG  +   C+PSK LI  + +    S   E + LG
Sbjct: 15  PGGYVAAIRAGQLGIPTVLVEGQALGGTCLNIGCIPSKALIHVAEQFHQASRFTEPSPLG 74

Query: 68  INVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVA 127
           I+V +        R+++    A    +    +   A  L+  GV+++ G A+++D   V 
Sbjct: 75  ISVASP-------RLDIGQSVAWKDGIVDRLTTGVAALLKKHGVKVVHGWAKVLDGKQVE 127

Query: 128 VGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEF 187
           V  +RI+ + +L+ATG+   ELP   P G  +++  +      LP+ L+VVG G  G E 
Sbjct: 128 VDGQRIQCEHLLLATGSSSVELPML-PLGGPVISSTEALAPKALPQHLVVVGGGYIGLEL 186

Query: 188 ANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTV-LGNSRAESVTRTDAGV 246
             AY+ LG+ V++V +R+R++PT D++    + +   + G+ + LG+S    V   + G 
Sbjct: 187 GIAYRKLGAQVSVVEARERILPTYDSELTAPVAESLKKLGIALHLGHS----VEGYENGC 242

Query: 247 LVRLTDGRV----IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGV 302
           L+   DG+     +E    L+ VG  P T    LE   ++++    + +D   +TS   V
Sbjct: 243 LLA-NDGKGGQLRLEADRVLVAVGRRPRTKGFNLECLDLKMNGAA-IAIDERCQTSMHNV 300

Query: 303 YAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDV 362
           +A GD  G  MLA  A  QG +      G A      + +A+  FT PE+  VG T +  
Sbjct: 301 WAIGDVAGEPMLAHRAMAQGEMVAEIIAGKA-RRFEPAAIAAVCFTDPEVVVVGKTPEQA 359

Query: 363 VSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSL 422
               +D  + + P A N RA    ++ GFV+++ R+   ++LG   VG   SEL  A + 
Sbjct: 360 SQQGLDCIVAQFPFAANGRAMSLESKSGFVRVVARRDNHLILGWQAVGVAVSELSTAFAQ 419

Query: 423 AVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
           +++    ++DVA T   +P+L  +V EAA
Sbjct: 420 SLEMGACLEDVAGTIHAHPTLGEAVQEAA 448


>1zx9A [x.x.x] MERCURIC REDUCTASE
          Length = 453

 Score =  172 bits (436), Expect = 2e-45
 Identities = 132/443 (29%), Positives = 208/443 (46%), Gaps = 28/443 (6%)

Query: 24  GADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVE 83
           GA VT+IER  IGG  V   CVPSK +I  +      +E+   G      P         
Sbjct: 24  GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIAATVP--------- 74

Query: 84  LKTVNARVKRLAQAQS-VDTANRLRTEGV-------EIIIGEARLVDPHIVAV-----GD 130
             T++ R K LAQ Q+ VD     + EG+        ++ GEAR  D   + V     G+
Sbjct: 75  --TID-RSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVRLNEGGE 131

Query: 131 ERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANA 190
             +  D  L+ATGA P   P          T  +    + +PE+L V+GS V   E A A
Sbjct: 132 RVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQA 191

Query: 191 YQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL 250
           +  LGS VT+++ R+ +   +D      +   F   G+ VL +++A  V   D   ++  
Sbjct: 192 FARLGSKVTVLA-RNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTT 250

Query: 251 TDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTG 310
           T G  +     L+  G  PNT +L L+ AG+ ++ +G + +D+  RTS P +YAAGDCT 
Sbjct: 251 THGE-LRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAGDCTD 309

Query: 311 VNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGR 370
                 V          +  G   + L L+ + + VFT P++A VG +E +     ++  
Sbjct: 310 QPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETD 368

Query: 371 IVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTV 430
              L L   PRA  +    GF+KL+  + +  ++G   V P A ELI   +LA++ R+TV
Sbjct: 369 SRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTV 428

Query: 431 DDVAHTFAVYPSLSGSVTEAARS 453
            ++A     Y ++   +  AA++
Sbjct: 429 QELADQLFPYLTMVEGLKLAAQT 451


>1zk7A [x.x.x] MERCURIC REDUCTASE
          Length = 467

 Score =  172 bits (436), Expect = 2e-45
 Identities = 132/443 (29%), Positives = 208/443 (46%), Gaps = 28/443 (6%)

Query: 24  GADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVE 83
           GA VT+IER  IGG  V   CVPSK +I  +      +E+   G      P         
Sbjct: 27  GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIAATVP--------- 77

Query: 84  LKTVNARVKRLAQAQS-VDTANRLRTEGV-------EIIIGEARLVDPHIVAV-----GD 130
             T++ R K LAQ Q+ VD     + EG+        ++ GEAR  D   + V     G+
Sbjct: 78  --TID-RSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVRLNEGGE 134

Query: 131 ERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANA 190
             +  D  L+ATGA P   P          T  +    + +PE+L V+GS V   E A A
Sbjct: 135 RVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQA 194

Query: 191 YQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL 250
           +  LGS VT+++ R+ +   +D      +   F   G+ VL +++A  V   D   ++  
Sbjct: 195 FARLGSKVTVLA-RNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTT 253

Query: 251 TDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTG 310
           T G  +     L+  G  PNT +L L+ AG+ ++ +G + +D+  RTS P +YAAGDCT 
Sbjct: 254 THGE-LRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAGDCTD 312

Query: 311 VNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGR 370
                 V          +  G   + L L+ + + VFT P++A VG +E +     ++  
Sbjct: 313 QPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETD 371

Query: 371 IVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTV 430
              L L   PRA  +    GF+KL+  + +  ++G   V P A ELI   +LA++ R+TV
Sbjct: 372 SRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTV 431

Query: 431 DDVAHTFAVYPSLSGSVTEAARS 453
            ++A     Y ++   +  AA++
Sbjct: 432 QELADQLFPYLTMVEGLKLAAQT 454


>2a8xA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 457

 Score =  163 bits (412), Expect = 1e-42
 Identities = 126/448 (28%), Positives = 200/448 (44%), Gaps = 21/448 (4%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTS-YVKE 62
           VV++G GPGGY AA+ AAQLG    ++E    GG  +   C+PSK L+  +     + K+
Sbjct: 5   VVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTKD 64

Query: 63  AATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVD 122
           A   GI+          V  +      R +++A+ + V   + L+   +  I G     D
Sbjct: 65  AKAFGIS--------GEVTFDYGIAYDRSRKVAEGR-VAGVHFLKKNKITEIHGYGTFAD 115

Query: 123 PHIVAV-----GDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIV 177
            + + V     G E +  D  +IATG+  R +P        ++T+ +     ELP K   
Sbjct: 116 ANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSAN-VVTYEEQILSRELP-KSXX 173

Query: 178 VGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAE 237
                   EF    +  G DVT+V    R +P +DAD ++ +E  F + G+T+L  ++ E
Sbjct: 174 XXXXXXXXEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVE 233

Query: 238 SVTRTDAGVLVRLTDGRV---IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRV 294
           S+    + V V +T   V   ++    L  +G  PN    GL++AG+ L +R  + VD  
Sbjct: 234 SIADGGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDY 293

Query: 295 SRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAA 354
            RT+   +YA GD  G+  LA VA  QG +A     GA    L    +    F  P +A+
Sbjct: 294 -RTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRLPRATFCQPNVAS 352

Query: 355 VGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRAS 414
            G TE    +   D  + K P   N +A       GFVKL+                  +
Sbjct: 353 FGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKXXXXXXXXXXXXDVA 412

Query: 415 ELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           EL+  ++LA +  LT  ++A     +P+
Sbjct: 413 ELLPELTLAQRWDLTASELARNVHTHPT 440


>2r9zB [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 453

 Score =  162 bits (409), Expect = 2e-42
 Identities = 125/426 (29%), Positives = 193/426 (45%), Gaps = 15/426 (3%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDL 79
           AA  G  V +IE   +GG  V   CVP K +   S     V++A   G+      +   L
Sbjct: 22  AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQASGTLDWPRL 81

Query: 80  VRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVL 139
           V        A   R   A +      +   G+  + G AR VD H + V  +R+ AD ++
Sbjct: 82  V--------AGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIV 133

Query: 140 IATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVT 199
           IATG  P  +    P  E  +T    + L + P+++ ++G+G  G E A   ++ GS+VT
Sbjct: 134 IATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVT 191

Query: 200 LVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEG- 258
           +V+  DR++   D   +  L +    +G+         ++ R   G  +   DG  +EG 
Sbjct: 192 VVALEDRLLFQFDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLEGF 251

Query: 259 SHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVA 318
              +  VG  PNT +LGLE AGI +   G V  D    T+ PGVYA GD TG + L  VA
Sbjct: 252 DSVIWAVGRAPNTRDLGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVA 311

Query: 319 AMQG-RIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
              G R+A     G +   L    + + VF HP L+ VG +E +      D   V     
Sbjct: 312 IAAGRRLAERLFDGQSERKLDYDNIPTVVFAHPPLSKVGLSEPEARERLGDVLTVYETSF 371

Query: 378 TNPRAKM--HNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAH 435
           T  R  +  H  +   +KL+C      V+G  ++G  A E++   ++AV+   T  D  +
Sbjct: 372 TPMRYALNEHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGFAVAVKMGATKADFDN 430

Query: 436 TFAVYP 441
           T A++P
Sbjct: 431 TVAIHP 436


>2r9zA [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 451

 Score =  160 bits (405), Expect = 7e-42
 Identities = 123/426 (28%), Positives = 193/426 (45%), Gaps = 17/426 (3%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDL 79
           AA  G  V +IE   +GG  V   CVP K +   S     V++A   G+           
Sbjct: 22  AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQAS-------- 73

Query: 80  VRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVL 139
             ++   + A   R   A +      +   G+  + G AR VD H + V  +R+ AD ++
Sbjct: 74  --LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIV 131

Query: 140 IATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVT 199
           IATG  P  +    P  E  +T    + L + P+++ ++G+G  G E A   ++ GS+VT
Sbjct: 132 IATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVT 189

Query: 200 LVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEG- 258
           +V+  DR++   D   +  L +    +G+         ++ R   G  +   DG  +EG 
Sbjct: 190 VVALEDRLLFQFDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLEGF 249

Query: 259 SHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVA 318
              +  VG  PNT +LGLE AGI +   G V  D    T+ PGVYA GD TG + L  VA
Sbjct: 250 DSVIWAVGRAPNTRDLGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVA 309

Query: 319 AMQG-RIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
              G R+A     G +   L    + + VF HP L+ VG +E +      D   V     
Sbjct: 310 IAAGRRLAERLFDGQSERKLDYDNIPTVVFAHPPLSKVGLSEPEARERLGDVLTVYETSF 369

Query: 378 TNPRAKM--HNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAH 435
           T  R  +  H  +   +KL+C      V+G  ++G  A E++   ++AV+   T  D  +
Sbjct: 370 TPMRYALNEHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGFAVAVKMGATKADFDN 428

Query: 436 TFAVYP 441
           T A++P
Sbjct: 429 TVAIHP 434


>2rabB [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 452

 Score =  159 bits (402), Expect = 2e-41
 Identities = 121/425 (28%), Positives = 191/425 (44%), Gaps = 15/425 (3%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDL 79
           AA  G  V +IE   +GG  V   CVP K +   S     V++A   G+           
Sbjct: 22  AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQAST------- 74

Query: 80  VRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVL 139
             ++   + A   R   A +      +   G+  + G AR VD H + V  +R+ AD ++
Sbjct: 75  --LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIV 132

Query: 140 IATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVT 199
           IATG  P  +    P  E  +T    + L + P+++ ++G+G  G E A   ++ GS+VT
Sbjct: 133 IATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVT 190

Query: 200 LVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGS 259
           +V+  DR++   D   +  L +    +G+         ++ R   G  +   DG  +   
Sbjct: 191 VVALEDRLLFQFDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLGFD 250

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAA 319
             +  VG  PNT +LGLE AGI +   G V  D    T+ PGVYA GD TG + L  VA 
Sbjct: 251 SVIWAVGRAPNTRDLGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAI 310

Query: 320 MQG-RIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLAT 378
             G R+A     G +   L    + + VF HP L+ VG +E +      D   V     T
Sbjct: 311 AAGRRLAERLFDGQSERKLDYDNIPTVVFAHPPLSKVGLSEPEARERLGDVLTVYETSFT 370

Query: 379 NPRAKM--HNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHT 436
             R  +  H  +   +KL+C      V+G  ++G  A E++   ++AV+   T  D  +T
Sbjct: 371 PMRYALNEHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGFAVAVKMGATKADFDNT 429

Query: 437 FAVYP 441
            A++P
Sbjct: 430 VAIHP 434


>2rabA [x.x.x] GLUTATHIONE AMIDE REDUCTASE
          Length = 451

 Score =  159 bits (402), Expect = 2e-41
 Identities = 121/425 (28%), Positives = 191/425 (44%), Gaps = 15/425 (3%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDL 79
           AA  G  V +IE   +GG  V   CVP K +   S     V++A   G+           
Sbjct: 22  AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQAST------- 74

Query: 80  VRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVL 139
             ++   + A   R   A +      +   G+  + G AR VD H + V  +R+ AD ++
Sbjct: 75  --LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIV 132

Query: 140 IATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVT 199
           IATG  P  +    P  E  +T    + L + P+++ ++G+G  G E A   ++ GS+VT
Sbjct: 133 IATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVT 190

Query: 200 LVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGS 259
           +V+  DR++   D   +  L +    +G+         ++ R   G  +   DG  +   
Sbjct: 191 VVALEDRLLFQFDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLGFD 250

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAA 319
             +  VG  PNT +LGLE AGI +   G V  D    T+ PGVYA GD TG + L  VA 
Sbjct: 251 SVIWAVGRAPNTRDLGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAI 310

Query: 320 MQG-RIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLAT 378
             G R+A     G +   L    + + VF HP L+ VG +E +      D   V     T
Sbjct: 311 AAGRRLAERLFDGQSERKLDYDNIPTVVFAHPPLSKVGLSEPEARERLGDVLTVYETSFT 370

Query: 379 NPRAKM--HNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHT 436
             R  +  H  +   +KL+C      V+G  ++G  A E++   ++AV+   T  D  +T
Sbjct: 371 PMRYALNEHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGFAVAVKMGATKADFDNT 429

Query: 437 FAVYP 441
            A++P
Sbjct: 430 VAIHP 434


>1ojtA [x.x.x] SURFACE PROTEIN
          Length = 482

 Score =  158 bits (399), Expect = 3e-41
 Identities = 129/471 (27%), Positives = 202/471 (42%), Gaps = 35/471 (7%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATSVRTSYVKE 62
           VV++GGGPGGY AA  AA  G  V ++ER   +GG  +   C+PSK L+  +     V+ 
Sbjct: 9   VVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRH 68

Query: 63  AATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVD 122
            A  GI       D D++R     V +R+       +   A   ++  V++I G+ + +D
Sbjct: 69  LAANGIKYPEPELDIDMLRAYKDGVVSRL-------TGGLAGMAKSRKVDVIQGDGQFLD 121

Query: 123 PHIVAV--------------GDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYD 167
           PH + V              G+++I A    +IA G+   +LP   P+  RI+       
Sbjct: 122 PHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFI-PEDPRIIDSSGALA 180

Query: 168 LNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRG 227
           L E+P K           E    Y  LGS + +V   D +M   D D  +V +     R 
Sbjct: 181 LKEVPGKXXXXXXXXXXXEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRF 240

Query: 228 MTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSH----CLMTVGMVPNTANLGLEEAGIRL 283
             ++ N++  +V   + GV V        +        L+  G  PN   +  E+AG+ +
Sbjct: 241 DNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVAV 300

Query: 284 DERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVA 343
            +RGF++VD+  RT+ P +YA GD  G  MLA  A  +G +A  +  G   +      + 
Sbjct: 301 TDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHK-AYFDARVIP 359

Query: 344 STVFTHPELAAVGATEDDVVSGRVDGRIV---KLPLATNPRAKMHNTRDGFVKLICRQHT 400
              +T PE+A VG TE   +S +   R +     P A + RA  +     F KLI    T
Sbjct: 360 GVAYTSPEVAWVGETE---LSAKASARKITKANFPWAASGRAIANGCDKPFTKLIFDAET 416

Query: 401 GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
                              V LA++      D+  T   +P+L  S+  AA
Sbjct: 417 XXXXXXXXXXXXXXXXXXEVCLAIEMGCDAADIGKTIHPHPTLGESIGMAA 467


>1bhyA [x.x.x] P64K
          Length = 482

 Score =  157 bits (398), Expect = 4e-41
 Identities = 129/471 (27%), Positives = 202/471 (42%), Gaps = 35/471 (7%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIER-DGIGGASVLTDCVPSKTLIATSVRTSYVKE 62
           VV++GGGPGGY AA  AA  G  V ++ER   +GG  +   C+PSK L+  +     V+ 
Sbjct: 9   VVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRH 68

Query: 63  AATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVD 122
            A  GI       D D++R     V +R+       +   A   ++  V++I G+ + +D
Sbjct: 69  LAANGIKYPEPELDIDMLRAYKDGVVSRL-------TGGLAGMAKSRKVDVIQGDGQFLD 121

Query: 123 PHIVAV--------------GDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYD 167
           PH + V              G+++I A    +IA G+   +LP   P+  RI+       
Sbjct: 122 PHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFI-PEDPRIIDSSGALA 180

Query: 168 LNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRG 227
           L E+P K           E    Y  LGS + +V   D +M   D D  +V +     R 
Sbjct: 181 LKEVPGKXXXXXXXXXXXEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRF 240

Query: 228 MTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSH----CLMTVGMVPNTANLGLEEAGIRL 283
             ++ N++  +V   + GV V        +        L+  G  PN   +  E+AG+ +
Sbjct: 241 DNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVAV 300

Query: 284 DERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVA 343
            +RGF++VD+  RT+ P +YA GD  G  MLA  A  +G +A  +  G   +      + 
Sbjct: 301 TDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHK-AYFDARVIP 359

Query: 344 STVFTHPELAAVGATEDDVVSGRVDGRIV---KLPLATNPRAKMHNTRDGFVKLICRQHT 400
              +T PE+A VG TE   +S +   R +     P A + RA  +     F KLI    T
Sbjct: 360 GVAYTSPEVAWVGETE---LSAKASARKITKANFPWAASGRAIANGCDKPFTKLIFDAET 416

Query: 401 GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
                              V LA++      D+  T   +P+L  S+  AA
Sbjct: 417 XXXXXXXXXXXXXXXXXXEVYLAIEMGCDAADIGKTIHPHPTLGESIGMAA 467


>2qaeA [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
          Length = 465

 Score =  155 bits (391), Expect = 3e-40
 Identities = 122/448 (27%), Positives = 202/448 (45%), Gaps = 15/448 (3%)

Query: 16  AALVAAQLGADVTVIERDG-IGGASVLTDCVPSKTLI-ATSVRTSYVKEAATLGINVGNE 73
           A++ AAQLG     +E+ G +GG  +   C+PSK L+ AT +        A  G+ +G E
Sbjct: 17  ASIKAAQLGMKTACVEKRGALGGTCLNVGCIPSKALLHATHLYHDAHANFARYGL-MGGE 75

Query: 74  PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVG---- 129
               D  +++ +      +R  +  +       +   V    GE      H + V     
Sbjct: 76  GVTMDSAKMQQQK-----ERAVKGLTGGVEYLFKKNKVTYYKGEGSFETAHSIRVNGLDG 130

Query: 130 -DERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFA 188
             E +     +IATG+ P ELP    D + +L+      L  +P+ +          E  
Sbjct: 131 KQEMLETKKTIIATGSEPTELPFLPFDEKVVLSSTGALALPRVPKTMXXXXXXXXXLELG 190

Query: 189 NAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRG-MTVLGNSRAESVTRTDAGVL 247
           + +  LG++VT+V    R  PT D D    L    A+   M  + +++    T     V 
Sbjct: 191 SVWARLGAEVTVVEFAPRCAPTLDEDVTNALVGALAKNEKMKFMTSTKVVGGTNNGDSVS 250

Query: 248 VRLTDGR-VIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAG 306
           + +   R  +     L++VG  P T  LGL++  +  +ERGFV++     TS P VYA G
Sbjct: 251 LEVEGKRETVTCEALLVSVGRRPFTGGLGLDKINVAKNERGFVKIGDHFETSIPDVYAIG 310

Query: 307 DCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGR 366
           D      + +  A    +A    L      +    + + ++T PE+A+VG +ED++    
Sbjct: 311 DVVDKGPMLAHKAEDEGVACAEILAGKPGHVNYGVIPAVIYTMPEVASVGKSEDELKKEG 370

Query: 367 VDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQ 426
           V  ++ K P   N RAK  +T DGFVK++  + T  +LG  IV   A ELI    LA++ 
Sbjct: 371 VAYKVGKFPFNANSRAKAVSTEDGFVKVLVDKATDRILGVHIVCTTAGELIGEACLAMEY 430

Query: 427 RLTVDDVAHTFAVYPSLSGSVTEAARSL 454
             + +DV  T   +P++S ++ EA  +L
Sbjct: 431 GASSEDVGRTCHAHPTMSEALKEACMAL 458


>2grtA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 461

 Score =  152 bits (384), Expect = 2e-39
 Identities = 129/456 (28%), Positives = 206/456 (45%), Gaps = 24/456 (5%)

Query: 5   VIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAA 64
           ++IGGG GG E+                  +GG  V   CVP K +  T+V + ++ + A
Sbjct: 7   LVIGGGSGGLESXXXXXXXXXXXXXXXSHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHA 66

Query: 65  TLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLV-DP 123
             G       E K   RV  +  +A V RL         N L    +EII G A    DP
Sbjct: 67  DYGFP---SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTSDP 119

Query: 124 H-IVAVGDERIRADVVLIATGAHPRELPTARPDGERI-LTWRQLYDLNELPEKLIVVGSG 181
              + V  ++  A  +LIATG  P     ++  G  + +T    + L ELP + ++VG+G
Sbjct: 120 KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG 179

Query: 182 VTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR 241
               E A    ALGS  +L+   D+V+ + D+  +    +     G+ VL  S+ + V +
Sbjct: 180 YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK 239

Query: 242 TDAGV---LVRLTDGRV-----IEGSHCLM-TVGMVPNTANLGLEEAGIRLDERGFVQVD 292
           T +G+   +V    GR+     I    CL+  +G VPNT +L L + GI+ D++G + VD
Sbjct: 240 TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD 299

Query: 293 RVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHAL--GAAVSPLRLSTVASTVFTHP 350
               T+  G+YA GD  G  +L  VA   GR  + H L      S L  + + + VF+HP
Sbjct: 300 EFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLFEYKEDSKLDYNNIPTVVFSHP 358

Query: 351 ELAAVGATEDDVVS--GRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
            +  VG TED+ +   G  + +           A         +K++C      V+G  +
Sbjct: 359 PIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHM 418

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLS 444
            G    E++   ++AV+   T  D  +T A++P+ S
Sbjct: 419 QGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSS 454


>1grtA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 462

 Score =  152 bits (384), Expect = 2e-39
 Identities = 129/456 (28%), Positives = 206/456 (45%), Gaps = 24/456 (5%)

Query: 5   VIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAA 64
           ++IGGG GG E+                  +GG  V   CVP K +  T+V + ++ + A
Sbjct: 8   LVIGGGSGGLESXXXXXXXXXXXXXXXSHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHA 67

Query: 65  TLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLV-DP 123
             G       E K   RV  +  +A V RL         N L    +EII G A    DP
Sbjct: 68  DYGFP---SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTSDP 120

Query: 124 H-IVAVGDERIRADVVLIATGAHPRELPTARPDGERI-LTWRQLYDLNELPEKLIVVGSG 181
              + V  ++  A  +LIATG  P     ++  G  + +T    + L ELP + ++VG+G
Sbjct: 121 KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG 180

Query: 182 VTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR 241
               E A    ALGS  +L+   D+V+ + D+  +    +     G+ VL  S+ + V +
Sbjct: 181 YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK 240

Query: 242 TDAGV---LVRLTDGRV-----IEGSHCLM-TVGMVPNTANLGLEEAGIRLDERGFVQVD 292
           T +G+   +V    GR+     I    CL+  +G VPNT +L L + GI+ D++G + VD
Sbjct: 241 TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD 300

Query: 293 RVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHAL--GAAVSPLRLSTVASTVFTHP 350
               T+  G+YA GD  G  +L  VA   GR  + H L      S L  + + + VF+HP
Sbjct: 301 EFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLFEYKEDSKLDYNNIPTVVFSHP 359

Query: 351 ELAAVGATEDDVVS--GRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVI 408
            +  VG TED+ +   G  + +           A         +K++C      V+G  +
Sbjct: 360 PIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHM 419

Query: 409 VGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLS 444
            G    E++   ++AV+   T  D  +T A++P+ S
Sbjct: 420 QGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSS 455


>2w0hB [x.x.x] TRYPANOTHIONE REDUCTASE
          Length = 487

 Score =  147 bits (371), Expect = 6e-38
 Identities = 121/468 (25%), Positives = 196/468 (41%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERD----------GIGGASVLTDCVPSKTLIAT 53
           +V++G G GG EA                            +GG  V   CVP K ++  
Sbjct: 6   LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXQATHGPPLFAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+   G  +  E   P  K L+  + K VN+ +    ++   DT      EG
Sbjct: 66  AQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKNKVVNS-INESYKSMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +   +G   L D H V V           E +  + +LIATG+ P  L    P  E  +T
Sbjct: 119 LSFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIATGSWPTRLGV--PGDEFCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L + P++++ VG G    EFA   N Y+  G  V L    D ++   D +  + 
Sbjct: 177 SNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPCGGYVDLCYRGDLILRGFDTEVRKS 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ V  N     +T+ + G   V   DG   +    ++ +G VP +  L L+
Sbjct: 237 LTKQLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEEDYDQVMLAIGRVPRSQALQLD 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+R  + G VQVD  S+TS   +YA GD T   ML  VA  +G   +    G      
Sbjct: 297 KAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G TE++         +      PL  N     H  ++  +++
Sbjct: 357 DHTKVACAVFSIPPIGTCGMTEEEAAKNYETVAVYASSFTPLMHNISGSKH--KEFMIRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           I  +  G VLG  ++G  A E+I +V + ++    + D   T  V+P+
Sbjct: 415 ITNESNGEVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPT 462


>2w0hA [x.x.x] TRYPANOTHIONE REDUCTASE
          Length = 485

 Score =  147 bits (371), Expect = 6e-38
 Identities = 121/468 (25%), Positives = 196/468 (41%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERD----------GIGGASVLTDCVPSKTLIAT 53
           +V++G G GG EA                            +GG  V   CVP K ++  
Sbjct: 6   LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXQATHGPPLFAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+   G  +  E   P  K L+  + K VN+ +    ++   DT      EG
Sbjct: 66  AQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKNKVVNS-INESYKSMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +   +G   L D H V V           E +  + +LIATG+ P  L    P  E  +T
Sbjct: 119 LSFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIATGSWPTRLGV--PGDEFCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L + P++++ VG G    EFA   N Y+  G  V L    D ++   D +  + 
Sbjct: 177 SNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPCGGYVDLCYRGDLILRGFDTEVRKS 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ V  N     +T+ + G   V   DG   +    ++ +G VP +  L L+
Sbjct: 237 LTKQLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEEDYDQVMLAIGRVPRSQALQLD 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+R  + G VQVD  S+TS   +YA GD T   ML  VA  +G   +    G      
Sbjct: 297 KAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G TE++         +      PL  N     H  ++  +++
Sbjct: 357 DHTKVACAVFSIPPIGTCGMTEEEAAKNYETVAVYASSFTPLMHNISGSKH--KEFMIRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           I  +  G VLG  ++G  A E+I +V + ++    + D   T  V+P+
Sbjct: 415 ITNESNGEVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPT 462


>2jk6A [x.x.x] TRYPANOTHIONE REDUCTASE
          Length = 489

 Score =  147 bits (371), Expect = 6e-38
 Identities = 121/468 (25%), Positives = 196/468 (41%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERD----------GIGGASVLTDCVPSKTLIAT 53
           +V++G G GG EA                            +GG  V   CVP K ++  
Sbjct: 7   LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXQATHGPPLFAALGGTCVNVGCVPKKLMVTG 66

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+   G  +  E   P  K L+  + K VN+ +    ++   DT      EG
Sbjct: 67  AQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKNKVVNS-INESYKSMFADT------EG 119

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +   +G   L D H V V           E +  + +LIATG+ P  L    P  E  +T
Sbjct: 120 LSFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIATGSWPTRLGV--PGDEFCIT 177

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L + P++++ VG G    EFA   N Y+  G  V L    D ++   D +  + 
Sbjct: 178 SNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPCGGYVDLCYRGDLILRGFDTEVRKS 237

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ V  N     +T+ + G   V   DG   +    ++ +G VP +  L L+
Sbjct: 238 LTKQLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEEDYDQVMLAIGRVPRSQALQLD 297

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+R  + G VQVD  S+TS   +YA GD T   ML  VA  +G   +    G      
Sbjct: 298 KAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRAT 357

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G TE++         +      PL  N     H  ++  +++
Sbjct: 358 DHTKVACAVFSIPPIGTCGMTEEEAAKNYETVAVYASSFTPLMHNISGSKH--KEFMIRI 415

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           I  +  G VLG  ++G  A E+I +V + ++    + D   T  V+P+
Sbjct: 416 ITNESNGEVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPT 463


>2ve2B [x.x.x] TRYPANOTHIONE REDUCTASE
          Length = 488

 Score =  145 bits (366), Expect = 2e-37
 Identities = 131/475 (27%), Positives = 208/475 (43%), Gaps = 54/475 (11%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAATLYKKRVAVIDVQTHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRL--AQAQSVDTANRLR---- 107
           +    +++E+A  G                  +V A  K+L  A+ ++V   N+      
Sbjct: 66  AQYMDHLRESAGFGWEFDGS------------SVKANWKKLIAAKNEAVLDINKSYEGMF 113

Query: 108 --TEGVEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDG 156
             TEG++  +G   L   ++V V +         ER++AD +L+ATG+ P ++P A P  
Sbjct: 114 NDTEGLDFFLGWGSLESKNVVVVRETADPKSAVKERLQADHILLATGSWP-QMP-AIPGI 171

Query: 157 ERILTWRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDA 213
           E  ++  + + L E P +++ VG G    EFA   NAY+  G  VTL    + ++   D 
Sbjct: 172 EHCISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPPGGKVTLCYRNNLILRGFDE 231

Query: 214 DAARVLEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTA 272
                +       G+ ++ N     V+  TD    V    G+ ++    +M +G +P T 
Sbjct: 232 TIREEVTKQLTANGIEIMTNENPAKVSLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTN 291

Query: 273 NLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGA 332
           +L L   G++L  +G VQVD  SRT+ P +YA GD T   ML  VA  +G   +    G 
Sbjct: 292 DLQLGNVGVKLTPKGGVQVDEFSRTNVPNIYAIGDITDRLMLTPVAINEGAALVDTVFGN 351

Query: 333 AVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDG-- 390
                  + VAS VF+ P +   G     +               ++    MHN      
Sbjct: 352 KPRKTDHTRVASAVFSIPPIGTCGL----IXXXXXXXXXXXXXYMSSFTPLMHNISGSKY 407

Query: 391 --FVKLICRQHT-GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
             FV  I   H+ G VLG  ++G  A E+I AV + ++    + D  +T  V+P+
Sbjct: 408 KKFVAKIVTNHSDGTVLGVHLLGDGAPEIIQAVGVCLRLNAKISDFYNTIGVHPT 462


>2ve2A [x.x.x] TRYPANOTHIONE REDUCTASE
          Length = 487

 Score =  145 bits (366), Expect = 2e-37
 Identities = 131/475 (27%), Positives = 208/475 (43%), Gaps = 54/475 (11%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 5   LVVIGAGSGGLEAGWNAATLYKKRVAVIDVQTHHGPPHYAALGGTCVNVGCVPKKLMVTG 64

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRL--AQAQSVDTANRLR---- 107
           +    +++E+A  G                  +V A  K+L  A+ ++V   N+      
Sbjct: 65  AQYMDHLRESAGFGWEFDGS------------SVKANWKKLIAAKNEAVLDINKSYEGMF 112

Query: 108 --TEGVEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDG 156
             TEG++  +G   L   ++V V +         ER++AD +L+ATG+ P ++P A P  
Sbjct: 113 NDTEGLDFFLGWGSLESKNVVVVRETADPKSAVKERLQADHILLATGSWP-QMP-AIPGI 170

Query: 157 ERILTWRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDA 213
           E  ++  + + L E P +++ VG G    EFA   NAY+  G  VTL    + ++   D 
Sbjct: 171 EHCISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPPGGKVTLCYRNNLILRGFDE 230

Query: 214 DAARVLEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTA 272
                +       G+ ++ N     V+  TD    V    G+ ++    +M +G +P T 
Sbjct: 231 TIREEVTKQLTANGIEIMTNENPAKVSLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTN 290

Query: 273 NLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGA 332
           +L L   G++L  +G VQVD  SRT+ P +YA GD T   ML  VA  +G   +    G 
Sbjct: 291 DLQLGNVGVKLTPKGGVQVDEFSRTNVPNIYAIGDITDRLMLTPVAINEGAALVDTVFGN 350

Query: 333 AVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDG-- 390
                  + VAS VF+ P +   G     +               ++    MHN      
Sbjct: 351 KPRKTDHTRVASAVFSIPPIGTCGL----IXXXXXXXXXXXXXYMSSFTPLMHNISGSKY 406

Query: 391 --FVKLICRQHT-GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
             FV  I   H+ G VLG  ++G  A E+I AV + ++    + D  +T  V+P+
Sbjct: 407 KKFVAKIVTNHSDGTVLGVHLLGDGAPEIIQAVGVCLRLNAKISDFYNTIGVHPT 461


>1grbA [c.3.1 - c.3.1 - d.87.1 (1bwcA)] GLUTATHIONE REDUCTASE
          Length = 461

 Score =  143 bits (361), Expect = 9e-37
 Identities = 122/426 (28%), Positives = 196/426 (46%), Gaps = 24/426 (5%)

Query: 35  IGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRL 94
           +GG  V   CVP K +  T+V + ++ + A  G       E K   RV  +  +A V RL
Sbjct: 37  LGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP---SCEGKFNWRVIKEKRDAYVSRL 93

Query: 95  AQAQSVDTANRLRTEGVEIIIGEARLV-DPH-IVAVGDERIRADVVLIATGAHPRELPTA 152
                    N L    +EII G A    DP   + V  ++  A  +LIATG  P     +
Sbjct: 94  NAIYQ----NNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHES 149

Query: 153 RPDGERI-LTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ 211
           +  G  + +T    + L ELP + ++VG+G    E A    ALGS  +L+   D+V+ + 
Sbjct: 150 QIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSF 209

Query: 212 DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGV---LVRLTDGRV-----IEGSHCLM 263
           D+  +    +     G+ VL  S+ + V +T +G+   +V    GR+     I    CL+
Sbjct: 210 DSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLL 269

Query: 264 -TVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQG 322
             +G VPNT +L L + GI+ D++G + VD    T+  G+YA GD  G  +L  VA   G
Sbjct: 270 WAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAG 329

Query: 323 RIAMWHAL--GAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPLAT 378
           R  + H L      S L  + + + VF+HP +  VG TED+ +   G  + +        
Sbjct: 330 R-KLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTP 388

Query: 379 NPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFA 438
              A         +K++C      V+G  + G    E++   ++AV+   T  D  +T A
Sbjct: 389 MYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVA 448

Query: 439 VYPSLS 444
           ++P+ S
Sbjct: 449 IHPTSS 454


>3dk9A [x.x.x] GLUTATHIONE REDUCTASE
          Length = 462

 Score =  143 bits (361), Expect = 9e-37
 Identities = 122/426 (28%), Positives = 196/426 (46%), Gaps = 24/426 (5%)

Query: 35  IGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRL 94
           +GG  V   CVP K +  T+V + ++ + A  G       E K   RV  +  +A V RL
Sbjct: 38  LGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP---SCEGKFNWRVIKEKRDAYVSRL 94

Query: 95  AQAQSVDTANRLRTEGVEIIIGEARLV-DPH-IVAVGDERIRADVVLIATGAHPRELPTA 152
                    N L    +EII G A    DP   + V  ++  A  +LIATG  P     +
Sbjct: 95  NAIYQ----NNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHES 150

Query: 153 RPDGERI-LTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ 211
           +  G  + +T    + L ELP + ++VG+G    E A    ALGS  +L+   D+V+ + 
Sbjct: 151 QIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSF 210

Query: 212 DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGV---LVRLTDGRV-----IEGSHCLM 263
           D+  +    +     G+ VL  S+ + V +T +G+   +V    GR+     I    CL+
Sbjct: 211 DSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLL 270

Query: 264 -TVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQG 322
             +G VPNT +L L + GI+ D++G + VD    T+  G+YA GD  G  +L  VA   G
Sbjct: 271 WAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAG 330

Query: 323 RIAMWHAL--GAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPLAT 378
           R  + H L      S L  + + + VF+HP +  VG TED+ +   G  + +        
Sbjct: 331 R-KLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTP 389

Query: 379 NPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFA 438
              A         +K++C      V+G  + G    E++   ++AV+   T  D  +T A
Sbjct: 390 MYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVA 449

Query: 439 VYPSLS 444
           ++P+ S
Sbjct: 450 IHPTSS 455


>1gesB [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
          Length = 449

 Score =  141 bits (356), Expect = 3e-36
 Identities = 120/430 (27%), Positives = 190/430 (44%), Gaps = 18/430 (4%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATL-GINVGNEPEDKD 78
           AA  G    +IE   +GG  V   CVP K +       + ++EA  + G + G    D  
Sbjct: 22  AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMYGPDYGF---DTT 74

Query: 79  LVRVELKTVNARVKRLAQAQSVDTA--NRLRTEGVEIIIGEARLVDPHIVAVGDERIRAD 136
           + +   +T+ A   R A    + T+  N L    V++I G AR VD   + V  E I AD
Sbjct: 75  INKFNWETLIA--SRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITAD 132

Query: 137 VVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGS 196
            +LIATG  P       P  E  +     + L  LPE++ VVG+G  G E       LG+
Sbjct: 133 HILIATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIGVELGGVINGLGA 190

Query: 197 DVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR-TDAGVLVRLTDGRV 255
              L    D  +P+ D   +  L +V    G  +  N+  ++V + TD  + + L DGR 
Sbjct: 191 KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRS 250

Query: 256 IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLA 315
                 +  +G  P   N+ LE AG++ +E+G++ VD+   T+  G+YA GD TG   L 
Sbjct: 251 ETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELT 310

Query: 316 SVAAMQGRIAMWHALGAAVSP-LRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIV 372
            VA   GR              L  S + + VF+HP +  VG TE       G    ++ 
Sbjct: 311 PVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVY 370

Query: 373 KLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDD 432
           K        A   + +   +KL+C      ++G   +G    E++   ++A++   T  D
Sbjct: 371 KSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKD 430

Query: 433 VAHTFAVYPS 442
             +T A++P+
Sbjct: 431 FDNTVAIHPT 440


>1gesA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
          Length = 448

 Score =  141 bits (356), Expect = 3e-36
 Identities = 120/430 (27%), Positives = 190/430 (44%), Gaps = 18/430 (4%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATL-GINVGNEPEDKD 78
           AA  G    +IE   +GG  V   CVP K +       + ++EA  + G + G    D  
Sbjct: 21  AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMYGPDYGF---DTT 73

Query: 79  LVRVELKTVNARVKRLAQAQSVDTA--NRLRTEGVEIIIGEARLVDPHIVAVGDERIRAD 136
           + +   +T+ A   R A    + T+  N L    V++I G AR VD   + V  E I AD
Sbjct: 74  INKFNWETLIA--SRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITAD 131

Query: 137 VVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGS 196
            +LIATG  P       P  E  +     + L  LPE++ VVG+G  G E       LG+
Sbjct: 132 HILIATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIGVELGGVINGLGA 189

Query: 197 DVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR-TDAGVLVRLTDGRV 255
              L    D  +P+ D   +  L +V    G  +  N+  ++V + TD  + + L DGR 
Sbjct: 190 KTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRS 249

Query: 256 IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLA 315
                 +  +G  P   N+ LE AG++ +E+G++ VD+   T+  G+YA GD TG   L 
Sbjct: 250 ETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELT 309

Query: 316 SVAAMQGRIAMWHALGAAVSP-LRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIV 372
            VA   GR              L  S + + VF+HP +  VG TE       G    ++ 
Sbjct: 310 PVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVY 369

Query: 373 KLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDD 432
           K        A   + +   +KL+C      ++G   +G    E++   ++A++   T  D
Sbjct: 370 KSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKD 429

Query: 433 VAHTFAVYPS 442
             +T A++P+
Sbjct: 430 FDNTVAIHPT 439


>1grgA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 460

 Score =  141 bits (355), Expect = 4e-36
 Identities = 121/424 (28%), Positives = 195/424 (45%), Gaps = 24/424 (5%)

Query: 37  GASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQ 96
           G +V   CVP K +  T+V + ++ + A  G       E K   RV  +  +A V RL  
Sbjct: 38  GGTVNVGCVPKKVMWNTAVHSEFMHDHADYGFP---SCEGKFNWRVIKEKRDAYVSRLNA 94

Query: 97  AQSVDTANRLRTEGVEIIIGEARLV-DPH-IVAVGDERIRADVVLIATGAHPRELPTARP 154
                  N L    +EII G A    DP   + V  ++  A  +LIATG  P     ++ 
Sbjct: 95  IYQ----NNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQI 150

Query: 155 DGERI-LTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDA 213
            G  + +T    + L ELP + ++VG+G    E A    ALGS  +L+   D+V+ + D+
Sbjct: 151 PGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDS 210

Query: 214 DAARVLEDVFARRGMTVLGNSRAESVTRTDAGV---LVRLTDGRV-----IEGSHCLM-T 264
             +    +     G+ VL  S+ + V +T +G+   +V    GR+     I    CL+  
Sbjct: 211 MISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWA 270

Query: 265 VGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRI 324
           +G VPNT +L L + GI+ D++G + VD    T+  G+YA GD  G  +L  VA   GR 
Sbjct: 271 IGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR- 329

Query: 325 AMWHAL--GAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPLATNP 380
            + H L      S L  + + + VF+HP +  VG TED+ +   G  + +          
Sbjct: 330 KLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMY 389

Query: 381 RAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVY 440
            A         +K++C      V+G  + G    E++   ++AV+   T  D  +T A++
Sbjct: 390 HAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIH 449

Query: 441 PSLS 444
           P+ S
Sbjct: 450 PTSS 453


>2tprA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 482

 Score =  140 bits (352), Expect = 1e-35
 Identities = 123/468 (26%), Positives = 204/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L LE
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLE 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + DV +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDVYNTIGVHPT 462


>1gxfA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
           FORM)
          Length = 484

 Score =  138 bits (347), Expect = 4e-35
 Identities = 132/467 (28%), Positives = 207/467 (44%), Gaps = 39/467 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGA------DVTVIER----DGIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EAA  AA L        DV ++        +GG  V   CVP K ++  
Sbjct: 5   LVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTG 64

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQA---QSVDTANRLRTEG 110
           +    +++E+A  G        D+  +R E K + A VK  A     +S D   R  TEG
Sbjct: 65  AQYMEHLRESAGFGWEF-----DRTTLRAEWKNLIA-VKDEAVLNINKSYDEMFR-DTEG 117

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +E  +G   L   ++V V +         ER+  + +L+A+G+ P  +P   P  E  ++
Sbjct: 118 LEFFLGWGSLESKNVVNVRESADPASAVKERLETEHILLASGSWPH-MPNI-PGIEHCIS 175

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L E P +++ VG G    EFA   NAY+     VTL    + ++   D      
Sbjct: 176 SNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREE 235

Query: 219 LEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ +L       V    D    V    G+ ++    +M +G  P T +L L+
Sbjct: 236 LTKQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQ 295

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
            AG+ + + G VQVD  SRT+   +YA GD T   ML  VA  +    +    G      
Sbjct: 296 NAGVMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKT 354

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTR-DGFV-KLI 395
             + VAS VF+ P +   G  E +V S R +   V L   T    K+  ++   FV K+I
Sbjct: 355 DHTRVASAVFSIPPIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKYKTFVAKII 413

Query: 396 CRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
                G VLG  ++G  A E+I  + + ++    + D  +T  V+P+
Sbjct: 414 TNHSDGTVLGVHLLGDNAPEIIQGIGICLKLNAKISDFYNTIGVHPT 460


>1fecB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 485

 Score =  138 bits (347), Expect = 4e-35
 Identities = 122/468 (26%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 5   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 64

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 65  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 117

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 118 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 175

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 176 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 235

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L LE
Sbjct: 236 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLE 295

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 296 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 355

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 356 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 413

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 414 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 461


>1fecA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 485

 Score =  138 bits (347), Expect = 4e-35
 Identities = 122/468 (26%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L LE
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLE 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 462


>1feaB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 484

 Score =  138 bits (347), Expect = 4e-35
 Identities = 122/468 (26%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L LE
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLE 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 462


>1feaA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 487

 Score =  138 bits (347), Expect = 4e-35
 Identities = 122/468 (26%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L LE
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLE 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 462


>1bzlA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
           FORM)
          Length = 486

 Score =  138 bits (347), Expect = 4e-35
 Identities = 132/467 (28%), Positives = 207/467 (44%), Gaps = 39/467 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGA------DVTVIER----DGIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EAA  AA L        DV ++        +GG  V   CVP K ++  
Sbjct: 7   LVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTG 66

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQA---QSVDTANRLRTEG 110
           +    +++E+A  G        D+  +R E K + A VK  A     +S D   R  TEG
Sbjct: 67  AQYMEHLRESAGFGWEF-----DRTTLRAEWKNLIA-VKDEAVLNINKSYDEMFR-DTEG 119

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +E  +G   L   ++V V +         ER+  + +L+A+G+ P  +P   P  E  ++
Sbjct: 120 LEFFLGWGSLESKNVVNVRESADPASAVKERLETEHILLASGSWPH-MPNI-PGIEHCIS 177

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L E P +++ VG G    EFA   NAY+     VTL    + ++   D      
Sbjct: 178 SNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREE 237

Query: 219 LEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ +L       V    D    V    G+ ++    +M +G  P T +L L+
Sbjct: 238 LTKQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQ 297

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
            AG+ + + G VQVD  SRT+   +YA GD T   ML  VA  +    +    G      
Sbjct: 298 NAGVMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTR-DGFV-KLI 395
             + VAS VF+ P +   G  E +V S R +   V L   T    K+  ++   FV K+I
Sbjct: 357 DHTRVASAVFSIPPIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKYKTFVAKII 415

Query: 396 CRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
                G VLG  ++G  A E+I  + + ++    + D  +T  V+P+
Sbjct: 416 TNHSDGTVLGVHLLGDNAPEIIQGIGICLKLNAKISDFYNTIGVHPT 462


>1aogB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 483

 Score =  138 bits (347), Expect = 4e-35
 Identities = 132/467 (28%), Positives = 207/467 (44%), Gaps = 39/467 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGA------DVTVIER----DGIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EAA  AA L        DV ++        +GG  V   CVP K ++  
Sbjct: 4   LVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTG 63

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQA---QSVDTANRLRTEG 110
           +    +++E+A  G        D+  +R E K + A VK  A     +S D   R  TEG
Sbjct: 64  AQYMEHLRESAGFGWEF-----DRTTLRAEWKNLIA-VKDEAVLNINKSYDEMFR-DTEG 116

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +E  +G   L   ++V V +         ER+  + +L+A+G+ P  +P   P  E  ++
Sbjct: 117 LEFFLGWGSLESKNVVNVRESADPASAVKERLETEHILLASGSWPH-MPNI-PGIEHCIS 174

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L E P +++ VG G    EFA   NAY+     VTL    + ++   D      
Sbjct: 175 SNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREE 234

Query: 219 LEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ +L       V    D    V    G+ ++    +M +G  P T +L L+
Sbjct: 235 LTKQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQ 294

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
            AG+ + + G VQVD  SRT+   +YA GD T   ML  VA  +    +    G      
Sbjct: 295 NAGVMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKT 353

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTR-DGFV-KLI 395
             + VAS VF+ P +   G  E +V S R +   V L   T    K+  ++   FV K+I
Sbjct: 354 DHTRVASAVFSIPPIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKYKTFVAKII 412

Query: 396 CRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
                G VLG  ++G  A E+I  + + ++    + D  +T  V+P+
Sbjct: 413 TNHSDGTVLGVHLLGDNAPEIIQGIGICLKLNAKISDFYNTIGVHPT 459


>1aogA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 485

 Score =  138 bits (347), Expect = 4e-35
 Identities = 132/467 (28%), Positives = 207/467 (44%), Gaps = 39/467 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGA------DVTVIER----DGIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EAA  AA L        DV ++        +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQA---QSVDTANRLRTEG 110
           +    +++E+A  G        D+  +R E K + A VK  A     +S D   R  TEG
Sbjct: 66  AQYMEHLRESAGFGWEF-----DRTTLRAEWKNLIA-VKDEAVLNINKSYDEMFR-DTEG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +E  +G   L   ++V V +         ER+  + +L+A+G+ P  +P   P  E  ++
Sbjct: 119 LEFFLGWGSLESKNVVNVRESADPASAVKERLETEHILLASGSWPH-MPNI-PGIEHCIS 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L E P +++ VG G    EFA   NAY+     VTL    + ++   D      
Sbjct: 177 SNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREE 236

Query: 219 LEDVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L       G+ +L       V    D    V    G+ ++    +M +G  P T +L L+
Sbjct: 237 LTKQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQ 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
            AG+ + + G VQVD  SRT+   +YA GD T   ML  VA  +    +    G      
Sbjct: 297 NAGVMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKT 355

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTR-DGFV-KLI 395
             + VAS VF+ P +   G  E +V S R +   V L   T    K+  ++   FV K+I
Sbjct: 356 DHTRVASAVFSIPPIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKYKTFVAKII 414

Query: 396 CRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
                G VLG  ++G  A E+I  + + ++    + D  +T  V+P+
Sbjct: 415 TNHSDGTVLGVHLLGDNAPEIIQGIGICLKLNAKISDFYNTIGVHPT 461


>1ndaA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE OXIDOREDUCTASE
          Length = 481

 Score =  137 bits (346), Expect = 5e-35
 Identities = 130/468 (27%), Positives = 202/468 (43%), Gaps = 41/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGA------DVTVIER----DGIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EAA  AA L        DV ++        +GG  V   CVP K ++  
Sbjct: 4   LVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTG 63

Query: 54  SVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLR-TEGVE 112
           +    +++E+A  G        D+  +R E K + A         +       R TEG+E
Sbjct: 64  AQYMEHLRESAGFGWEF-----DRTTLRAEWKKLIAVKDEAVLNINKSYEEMFRDTEGLE 118

Query: 113 IIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILTWR 163
             +G   L   ++V V +         ER+  + +L+A+G+ P  +P   P  E  ++  
Sbjct: 119 FFLGWGSLESKNVVNVRESADPASAVKERLETENILLASGSWPH-MPNI-PGIEHCISSN 176

Query: 164 QLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARVLE 220
           + + L E P +++ VG G    EFA   NAY+     VTL    + ++   D      L 
Sbjct: 177 EAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREELT 236

Query: 221 DVFARRGMTVLGNSRAESVT-RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEA 279
                 G+ +L       V    D    V    G+ ++    +M +G  P T +L L+ A
Sbjct: 237 KQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNA 296

Query: 280 GIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRL 339
           G+ + + G VQVD  SRT+   +YA GD T   ML  VA  +    +    G        
Sbjct: 297 GVMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTNPRKTDH 355

Query: 340 STVASTVFTHPELAAVGATEDDVVSGRVDGRIVKL----PLATNPRAKMHNTRDGFV-KL 394
           + VAS VF+ P +   G  E +V S R +   V L    PL  N     + T   FV K+
Sbjct: 356 TRVASAVFSIPPIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHNISGSKYKT---FVAKI 411

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           I     G VLG  ++G  A E+I  V + ++    + D  +T  V+P+
Sbjct: 412 ITNHSDGTVLGVHLLGDNAPEIIQGVGICLKLNAKISDFYNTIGVHPT 459


>1tytB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
           FORM
          Length = 486

 Score =  137 bits (344), Expect = 8e-35
 Identities = 121/468 (25%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L L+
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLD 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 462


>1tytA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
           FORM
          Length = 487

 Score =  137 bits (344), Expect = 8e-35
 Identities = 121/468 (25%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 7   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 66

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 67  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 119

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 120 LTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 177

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 178 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 237

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L L+
Sbjct: 238 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLD 297

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 298 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 357

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 358 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 415

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 416 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 463


>1typB [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 486

 Score =  137 bits (344), Expect = 8e-35
 Identities = 121/468 (25%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 6   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 65

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 66  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 118

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 119 LTFHQGWGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 176

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 177 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 236

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L L+
Sbjct: 237 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLD 296

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 297 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 356

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 357 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 414

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 415 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 462


>1typA [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
          Length = 487

 Score =  137 bits (344), Expect = 8e-35
 Identities = 121/468 (25%), Positives = 203/468 (43%), Gaps = 40/468 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGAD-VTVIERD---------GIGGASVLTDCVPSKTLIAT 53
           +V+IG G GG EA   AA L    V VI+            +GG  V   CVP K ++  
Sbjct: 7   LVVIGAGSGGLEAGWNAASLHKKRVAVIDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTG 66

Query: 54  SVRTSYVKEAATLGINVGNE---PEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEG 110
           +     ++E+A  G  +  E   P  K L+  + K V+  +    +    DT      EG
Sbjct: 67  ANYMDTIRESAGFGWELDRESVRPNWKALIAAKNKAVSG-INDSYEGMFADT------EG 119

Query: 111 VEIIIGEARLVDPHIVAVGD---------ERIRADVVLIATGAHPRELPTARPDGERILT 161
           +    G   L D H V V +         E +  + +L+ATG+ P+ L     D    +T
Sbjct: 120 LTFHQGWGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHLGIEGDD--LCIT 177

Query: 162 WRQLYDLNELPEKLIVVGSGVTGAEFA---NAYQALGSDVTLVSSRDRVMPTQDADAARV 218
             + + L+E P++ + VG G    EFA   NAY+A G  V L    D ++   D++  + 
Sbjct: 178 SNEAFYLDEAPKRALCVGGGYISIEFAGIFNAYKARGGQVDLAYRGDMILRGFDSELRKQ 237

Query: 219 LEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEGSHCLMTVGMVPNTANLGLE 277
           L +     G+ V  +     VT+   G   V    G   +    ++ +G VP +  L L+
Sbjct: 238 LTEQLRANGINVRTHENPAKVTKNADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLD 297

Query: 278 EAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPL 337
           +AG+ + + G ++VD  S+T+   +YA GD T   ML  VA  +G   +           
Sbjct: 298 KAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRAT 357

Query: 338 RLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVK---LPLATNPRAKMHNTRDGFVKL 394
             + VA  VF+ P +   G  E+D         + +    PL  N     +  +   V++
Sbjct: 358 DHTKVACAVFSIPPMGVCGYVEEDAAKKYDQVAVYESSFTPLMHNISGSTY--KKFMVRI 415

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPS 442
           +     G VLG  ++G  + E+I +V++ ++    + D  +T  V+P+
Sbjct: 416 VTNHADGEVLGVHMLGDSSPEIIQSVAICLKMGAKISDFYNTIGVHPT 463


>1gerB [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
          Length = 449

 Score =  135 bits (341), Expect = 2e-34
 Identities = 118/430 (27%), Positives = 189/430 (43%), Gaps = 18/430 (4%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATL-GINVGNEPEDKD 78
           AA  G    +IE   +GG  V   CVP K +       + ++EA  + G + G    D  
Sbjct: 22  AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMYGPDYGF---DTT 74

Query: 79  LVRVELKTVNARVKRLAQAQSVDTA--NRLRTEGVEIIIGEARLVDPHIVAVGDERIRAD 136
           + +   +T+ A   R A    + T+  N L    V++I G AR VD   + V  E I AD
Sbjct: 75  INKFNWETLIA--SRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITAD 132

Query: 137 VVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGS 196
            +LIATG  P       P  E  +     + L  LPE++ VVG+G    E A     LG+
Sbjct: 133 HILIATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGA 190

Query: 197 DVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR-TDAGVLVRLTDGRV 255
              L   +   + + D   +  L +V    G  +  N+  ++V + TD  + + L DGR 
Sbjct: 191 KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRS 250

Query: 256 IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLA 315
                 +  +G  P   N+ LE AG++ +E+G++ VD+   T+  G+YA GD TG   L 
Sbjct: 251 ETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELT 310

Query: 316 SVAAMQGRIAMWHALGAAVSP-LRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIV 372
            VA   GR              L  S + + VF+HP +  VG TE       G    ++ 
Sbjct: 311 PVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVY 370

Query: 373 KLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDD 432
           K        A   + +   +KL+C      ++G   +G    E++   ++A++   T  D
Sbjct: 371 KSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKD 430

Query: 433 VAHTFAVYPS 442
             +T A++P+
Sbjct: 431 FDNTVAIHPT 440


>1gerA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
          Length = 448

 Score =  135 bits (341), Expect = 2e-34
 Identities = 118/430 (27%), Positives = 189/430 (43%), Gaps = 18/430 (4%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATL-GINVGNEPEDKD 78
           AA  G    +IE   +GG  V   CVP K +       + ++EA  + G + G    D  
Sbjct: 21  AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMYGPDYGF---DTT 73

Query: 79  LVRVELKTVNARVKRLAQAQSVDTA--NRLRTEGVEIIIGEARLVDPHIVAVGDERIRAD 136
           + +   +T+ A   R A    + T+  N L    V++I G AR VD   + V  E I AD
Sbjct: 74  INKFNWETLIA--SRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITAD 131

Query: 137 VVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGS 196
            +LIATG  P       P  E  +     + L  LPE++ VVG+G    E A     LG+
Sbjct: 132 HILIATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGA 189

Query: 197 DVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR-TDAGVLVRLTDGRV 255
              L   +   + + D   +  L +V    G  +  N+  ++V + TD  + + L DGR 
Sbjct: 190 KTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRS 249

Query: 256 IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLA 315
                 +  +G  P   N+ LE AG++ +E+G++ VD+   T+  G+YA GD TG   L 
Sbjct: 250 ETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELT 309

Query: 316 SVAAMQGRIAMWHALGAAVSP-LRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIV 372
            VA   GR              L  S + + VF+HP +  VG TE       G    ++ 
Sbjct: 310 PVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVY 369

Query: 373 KLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDD 432
           K        A   + +   +KL+C      ++G   +G    E++   ++A++   T  D
Sbjct: 370 KSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKD 429

Query: 433 VAHTFAVYPS 442
             +T A++P+
Sbjct: 430 FDNTVAIHPT 439


>1dncA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 460

 Score =  135 bits (340), Expect = 2e-34
 Identities = 119/424 (28%), Positives = 194/424 (45%), Gaps = 24/424 (5%)

Query: 37  GASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQ 96
           G + +   VP K +  T+V + ++ + A  G       E K   RV  +  +A V RL  
Sbjct: 38  GGTCVNVGVPKKVMWNTAVHSEFMHDHADYGFP---SCEGKFNWRVIKEKRDAYVSRLNA 94

Query: 97  AQSVDTANRLRTEGVEIIIGEARLV-DPH-IVAVGDERIRADVVLIATGAHPRELPTARP 154
                  N L    +EII G A    DP   + V  ++  A  +LIATG  P     ++ 
Sbjct: 95  IYQ----NNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQI 150

Query: 155 DGERI-LTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDA 213
            G  + +T    + L ELP + ++VG+G    E A    ALGS  +L+   D+V+ + D+
Sbjct: 151 PGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDS 210

Query: 214 DAARVLEDVFARRGMTVLGNSRAESVTRTDAGV---LVRLTDGRV-----IEGSHCLM-T 264
             +    +     G+ VL  S+ + V +T +G+   +V    GR+     I    CL+  
Sbjct: 211 MISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWA 270

Query: 265 VGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRI 324
           +G VPNT +L L + GI+ D++G + VD    T+  G+YA GD  G  +L  VA   GR 
Sbjct: 271 IGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR- 329

Query: 325 AMWHAL--GAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPLATNP 380
            + H L      S L  + + + VF+HP +  VG TED+ +   G  + +          
Sbjct: 330 KLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMY 389

Query: 381 RAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVY 440
            A         +K++C      V+G  + G    E++   ++AV+   T  D  +T A++
Sbjct: 390 HAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIH 449

Query: 441 PSLS 444
           P+ S
Sbjct: 450 PTSS 453


>1gsnA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 457

 Score =  129 bits (323), Expect = 2e-32
 Identities = 118/423 (27%), Positives = 194/423 (45%), Gaps = 25/423 (5%)

Query: 37  GASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQ 96
           G + +   VP K +  T+V + ++ + A  G       E K   RV  +  +A V RL  
Sbjct: 38  GGTCVNVGVPKKVMWNTAVHSEFMHDHADYGFP---SCEGKFNWRVIKEKRDAYVSRLNA 94

Query: 97  AQSVDTANRLRTEGVEIIIGEARLV-DPH-IVAVGDERIRADVVLIATGAHPRELPTARP 154
                  N L    +EII G A    DP   + V  ++  A  +LIATG  P     ++ 
Sbjct: 95  IYQ----NNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQI 150

Query: 155 DGERI-LTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDA 213
            G  + +T    + L ELP + ++VG+G    E A    ALGS  +L+   D+V+ + D+
Sbjct: 151 PGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDS 210

Query: 214 DAARVLEDVFARRGMTVLGNSRAESVTRTDAGV---LVRLTDGRV-----IEGSHCLMTV 265
             +   E++    G+ VL  S+ + V +T +G+   +V    GR+     I     L  +
Sbjct: 211 MISTNTEEL-ENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDLLWAI 269

Query: 266 GMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIA 325
           G VPNT +L L + GI+ D++G + VD    T+  G+YA GD  G  +L  VA   GR  
Sbjct: 270 GRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-K 328

Query: 326 MWHAL--GAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPLATNPR 381
           + H L      S L  + + + VF+HP +  VG TED+ +   G  + +           
Sbjct: 329 LAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYH 388

Query: 382 AKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYP 441
           A         +K++  +   +V G  + G    E++   ++AV+   T  D  +T A++P
Sbjct: 389 AVTKRKTKCVMKMVANKEEKVV-GIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHP 447

Query: 442 SLS 444
           + S
Sbjct: 448 TSS 450


>1zkqA [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
          Length = 482

 Score =  120 bits (301), Expect = 8e-30
 Identities = 124/480 (25%), Positives = 201/480 (41%), Gaps = 33/480 (6%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE---------RDGIGGASVLTDCVPSKTLIATS 54
           +++IGGG GG   A  AAQLG  V V +         + G+GG  V   C+P K +   +
Sbjct: 6   LLVIGGGSGGLACAKEAAQLGKKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAA 65

Query: 55  VRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEII 114
           +    +++A   G  V         V+   KT+   V+   ++ +     +L+   V+  
Sbjct: 66  LLGGMIRDAHHYGWEVAQP------VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYF 119

Query: 115 IGEARLVDPHIVAVGDER-----IRADVVLIATGAHPRELPTARPDGERILTWRQLYDLN 169
             +A  VD H V   D+      + A+ ++IATG  PR     +   E  +T   ++ L 
Sbjct: 120 NIKASFVDEHTVRGVDKGGKATLLSAEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLK 179

Query: 170 ELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMT 229
           E P K +VVG+     E A     +G D T V  R   +   D   + ++ +     G  
Sbjct: 180 ESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSIPLRGFDQQMSSLVTEHMESHGTQ 238

Query: 230 VLGNSRAESVTRTDAGVL-VRLTD---GRVIEGSH--CLMTVGMVPNTANLGLEEAGIRL 283
            L       + +     L V   D   G+   G+    L  +G VP T  L LE+AGI  
Sbjct: 239 FLKGCVPSHIKKLPTNQLQVTWEDHASGKEDTGTFDTVLWAIGRVPETRTLNLEKAGIST 298

Query: 284 DERG-FVQVDRVSRTSTPGVYAAGD-CTGVNMLASVAAMQGRIAMWHALGAAVSPLRLST 341
           + +   + VD    TS P +YA GD   G   L   A   G++      G + + +  S 
Sbjct: 299 NPKNQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSN 358

Query: 342 VASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDG---FVKLIC-R 397
           V +TVFT  E   VG +E++ V+      +        P       RD    ++K++C R
Sbjct: 359 VPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMR 418

Query: 398 QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQG 457
           +   +VLG   +GP A E+    +L ++   +   V  T  ++P+ S  V +   S   G
Sbjct: 419 EPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSG 478


>1zdlA [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
          Length = 484

 Score =  120 bits (301), Expect = 8e-30
 Identities = 124/480 (25%), Positives = 201/480 (41%), Gaps = 33/480 (6%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE---------RDGIGGASVLTDCVPSKTLIATS 54
           +++IGGG GG   A  AAQLG  V V +         + G+GG  V   C+P K +   +
Sbjct: 5   LLVIGGGSGGLACAKEAAQLGKKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAA 64

Query: 55  VRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEII 114
           +    +++A   G  V         V+   KT+   V+   ++ +     +L+   V+  
Sbjct: 65  LLGGMIRDAHHYGWEVAQP------VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYF 118

Query: 115 IGEARLVDPHIVAVGDER-----IRADVVLIATGAHPRELPTARPDGERILTWRQLYDLN 169
             +A  VD H V   D+      + A+ ++IATG  PR     +   E  +T   ++ L 
Sbjct: 119 NIKASFVDEHTVRGVDKGGKATLLSAEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLK 178

Query: 170 ELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMT 229
           E P K +VVG+     E A     +G D T V  R   +   D   + ++ +     G  
Sbjct: 179 ESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSIPLRGFDQQMSSLVTEHMESHGTQ 237

Query: 230 VLGNSRAESVTRTDAGVL-VRLTD---GRVIEGSH--CLMTVGMVPNTANLGLEEAGIRL 283
            L       + +     L V   D   G+   G+    L  +G VP T  L LE+AGI  
Sbjct: 238 FLKGCVPSHIKKLPTNQLQVTWEDHASGKEDTGTFDTVLWAIGRVPETRTLNLEKAGIST 297

Query: 284 DERG-FVQVDRVSRTSTPGVYAAGD-CTGVNMLASVAAMQGRIAMWHALGAAVSPLRLST 341
           + +   + VD    TS P +YA GD   G   L   A   G++      G + + +  S 
Sbjct: 298 NPKNQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSN 357

Query: 342 VASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDG---FVKLIC-R 397
           V +TVFT  E   VG +E++ V+      +        P       RD    ++K++C R
Sbjct: 358 VPTTVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMR 417

Query: 398 QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQG 457
           +   +VLG   +GP A E+    +L ++   +   V  T  ++P+ S  V +   S   G
Sbjct: 418 EPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSG 477


>2nvkX [x.x.x] THIOREDOXIN REDUCTASE
          Length = 481

 Score =  119 bits (297), Expect = 2e-29
 Identities = 131/483 (27%), Positives = 203/483 (42%), Gaps = 42/483 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE----------RDGIGGASVLTDCVPSKTLIAT 53
           +++IGGG  G   A  A   GA V  ++          + G+GG  V   C+P K +   
Sbjct: 5   LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQA 64

Query: 54  SVRTSYVKEAATLGINVGN--EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGV 111
           S+    V EAA  G NV +  +P+   LV    ++V   +K +     VD    LR + V
Sbjct: 65  SLLGEAVHEAAAYGWNVDDKIKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKV 116

Query: 112 EIIIGEARLVDPHIVAV----GDERIRADVVLIATGAHPR--ELPTARPDGERILTWRQL 165
           E I G    VD H +      G+  I A   +IA G  PR  ++P A   G   +T   L
Sbjct: 117 EYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYG---ITSDDL 173

Query: 166 YDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFAR 225
           + L+  P K +VVG+G  G E A   + LG + T V  R  V+   D   A ++      
Sbjct: 174 FSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRGFDQQMAELVAASMEE 232

Query: 226 RGMTVLGNSRAESVTRTDAG-VLVRLTDGRVIEGSH-----CLMTVGMVPNTANLGLEEA 279
           RG+  L  +   SV + D G +LV+  +    E S       L  +G      +L L  A
Sbjct: 233 RGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNA 292

Query: 280 GIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVNMLASVAAMQGRIAMWHALGAAVSPLR 338
           G+ + ++  + VD    T+   +YA GD   G   L                  +   + 
Sbjct: 293 GVTV-QKDKIPVDSQEATNVANIYAVGDIIYGKPELTPXXXXXXXXXXXXXXXXSTQRMD 351

Query: 339 LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPR---AKMHNTRDGFVKLI 395
              VA+TVFT  E A VG +E+D V       I        P        + R  ++K +
Sbjct: 352 YKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAV 411

Query: 396 CRQH-TGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSL 454
             +H    V G   +GP A E+I   + A++  LT++ + +T  ++P+ +   T  A + 
Sbjct: 412 AERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITK 471

Query: 455 MQG 457
             G
Sbjct: 472 RSG 474


>3dh9A [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 482

 Score =  119 bits (297), Expect = 2e-29
 Identities = 131/483 (27%), Positives = 203/483 (42%), Gaps = 42/483 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE----------RDGIGGASVLTDCVPSKTLIAT 53
           +++IGGG  G   A  A   GA V  ++          + G+GG  V   C+P K +   
Sbjct: 8   LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQA 67

Query: 54  SVRTSYVKEAATLGINVGN--EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGV 111
           S+    V EAA  G NV +  +P+   LV    ++V   +K +     VD    LR + V
Sbjct: 68  SLLGEAVHEAAAYGWNVDDKIKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKV 119

Query: 112 EIIIGEARLVDPHIVAV----GDERIRADVVLIATGAHPR--ELPTARPDGERILTWRQL 165
           E I G    VD H +      G+  I A   +IA G  PR  ++P A   G   +T   L
Sbjct: 120 EYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYG---ITSDDL 176

Query: 166 YDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFAR 225
           + L+  P K +VVG+G  G E A   + LG + T V  R  V+   D   A ++      
Sbjct: 177 FSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRGFDQQMAELVAASMEE 235

Query: 226 RGMTVLGNSRAESVTRTDAG-VLVRLTDGRVIEGSH-----CLMTVGMVPNTANLGLEEA 279
           RG+  L  +   SV + D G +LV+  +    E S       L  +G      +L L  A
Sbjct: 236 RGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNA 295

Query: 280 GIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVNMLASVAAMQGRIAMWHALGAAVSPLR 338
           G+ + ++  + VD    T+   +YA GD   G   L                  +   + 
Sbjct: 296 GVTV-QKDKIPVDSQEATNVANIYAVGDIIYGKPELTPXXXXXXXXXXXXXXXXSTQRMD 354

Query: 339 LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPR---AKMHNTRDGFVKLI 395
              VA+TVFT  E A VG +E+D V       I        P        + R  ++K +
Sbjct: 355 YKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAV 414

Query: 396 CRQH-TGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSL 454
             +H    V G   +GP A E+I   + A++  LT++ + +T  ++P+ +   T  A + 
Sbjct: 415 AERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITK 474

Query: 455 MQG 457
             G
Sbjct: 475 RSG 477


>3dghA [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
          Length = 477

 Score =  119 bits (297), Expect = 2e-29
 Identities = 131/483 (27%), Positives = 203/483 (42%), Gaps = 42/483 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE----------RDGIGGASVLTDCVPSKTLIAT 53
           +++IGGG  G   A  A   GA V  ++          + G+GG  V   C+P K +   
Sbjct: 6   LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQA 65

Query: 54  SVRTSYVKEAATLGINVGN--EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGV 111
           S+    V EAA  G NV +  +P+   LV    ++V   +K +     VD    LR + V
Sbjct: 66  SLLGEAVHEAAAYGWNVDDKIKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKV 117

Query: 112 EIIIGEARLVDPHIVAV----GDERIRADVVLIATGAHPR--ELPTARPDGERILTWRQL 165
           E I G    VD H +      G+  I A   +IA G  PR  ++P A   G   +T   L
Sbjct: 118 EYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYG---ITSDDL 174

Query: 166 YDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFAR 225
           + L+  P K +VVG+G  G E A   + LG + T V  R  V+   D   A ++      
Sbjct: 175 FSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRGFDQQMAELVAASMEE 233

Query: 226 RGMTVLGNSRAESVTRTDAG-VLVRLTDGRVIEGSH-----CLMTVGMVPNTANLGLEEA 279
           RG+  L  +   SV + D G +LV+  +    E S       L  +G      +L L  A
Sbjct: 234 RGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNA 293

Query: 280 GIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVNMLASVAAMQGRIAMWHALGAAVSPLR 338
           G+ + ++  + VD    T+   +YA GD   G   L                  +   + 
Sbjct: 294 GVTV-QKDKIPVDSQEATNVANIYAVGDIIYGKPELTPXXXXXXXXXXXXXXXXSTQRMD 352

Query: 339 LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPR---AKMHNTRDGFVKLI 395
              VA+TVFT  E A VG +E+D V       I        P        + R  ++K +
Sbjct: 353 YKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAV 412

Query: 396 CRQH-TGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSL 454
             +H    V G   +GP A E+I   + A++  LT++ + +T  ++P+ +   T  A + 
Sbjct: 413 AERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITK 472

Query: 455 MQG 457
             G
Sbjct: 473 RSG 475


>3dghB [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
          Length = 473

 Score =  118 bits (296), Expect = 3e-29
 Identities = 130/477 (27%), Positives = 201/477 (42%), Gaps = 42/477 (8%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE----------RDGIGGASVLTDCVPSKTLIAT 53
           +++IGGG  G   A  A   GA V  ++          + G+GG  V   C+P K +   
Sbjct: 6   LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQA 65

Query: 54  SVRTSYVKEAATLGINVGN--EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGV 111
           S+    V EAA  G NV +  +P+   LV    ++V   +K +     VD    LR + V
Sbjct: 66  SLLGEAVHEAAAYGWNVDDKIKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKV 117

Query: 112 EIIIGEARLVDPHIVAV----GDERIRADVVLIATGAHPR--ELPTARPDGERILTWRQL 165
           E I G    VD H +      G+  I A   +IA G  PR  ++P A   G   +T   L
Sbjct: 118 EYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYG---ITSDDL 174

Query: 166 YDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFAR 225
           + L+  P K +VVG+G  G E A   + LG + T V  R  V+   D   A ++      
Sbjct: 175 FSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRGFDQQMAELVAASMEE 233

Query: 226 RGMTVLGNSRAESVTRTDAG-VLVRLTDGRVIEGSH-----CLMTVGMVPNTANLGLEEA 279
           RG+  L  +   SV + D G +LV+  +    E S       L  +G      +L L  A
Sbjct: 234 RGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNA 293

Query: 280 GIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVNMLASVAAMQGRIAMWHALGAAVSPLR 338
           G+ + ++  + VD    T+   +YA GD   G   L                  +   + 
Sbjct: 294 GVTV-QKDKIPVDSQEATNVANIYAVGDIIYGKPELTPXXXXXXXXXXXXXXXXSTQRMD 352

Query: 339 LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPR---AKMHNTRDGFVKLI 395
              VA+TVFT  E A VG +E+D V       I        P        + R  ++K +
Sbjct: 353 YKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAV 412

Query: 396 CRQH-TGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYPSLSGSVTEAA 451
             +H    V G   +GP A E+I   + A++  LT++ + +T  ++P+ +   T  A
Sbjct: 413 AERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLA 469


>2v6oA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
          Length = 586

 Score =  115 bits (287), Expect = 3e-28
 Identities = 112/440 (25%), Positives = 183/440 (41%), Gaps = 34/440 (7%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +    + +  +++A   G ++     D+  +     T+   V+ 
Sbjct: 142 GLGGTCVNVGCIPKKLMHQAGLLSHALEDAEHFGWSL-----DRSKISHNWSTMVEGVQS 196

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDER-----IRADVVLIATGAHPR- 147
              + +      LR   V  +  + RL+ PH V + D+      I  + +++ATG  P+ 
Sbjct: 197 HIGSLNWGYKVALRDNQVTYLNAKGRLISPHEVQITDKNQKVSTITGNKIILATGERPKY 256

Query: 148 -ELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
            E+P A   G   +T   L+ L   P K +V+G+     E A    +LG DVT V  R  
Sbjct: 257 PEIPGAVEYG---ITSDDLFSLPYFPGKTLVIGASYVALECAGFLASLGGDVT-VMVRSI 312

Query: 207 VMPTQDADAARVLEDVFARRGMTV--------LGNSRAESVTRTDAGVLV---RLTDGRV 255
           ++   D   A  + D     G+          +   +         G+L+     TDG+ 
Sbjct: 313 LLRGFDQQMAEKVGDYMENHGVKFAKLCVPDEIKQLKVVDTENNKPGLLLVKGHYTDGKK 372

Query: 256 IEGSH--CLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVN 312
            E      +  VG  P  + +  E  G++LD+ G V      +T+   VYA GD   G  
Sbjct: 373 FEEEFETVIFAVGREPQLSKVLCETVGVKLDKNGRVVCTDDEQTTVSNVYAIGDINAGKP 432

Query: 313 MLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIV 372
            L  VA   GR         A      S VA+TVFT  E  A G +E+D +    D  I 
Sbjct: 433 QLTPVAIQAGRYLARRLFAGATELTDYSNVATTVFTPLEYGACGLSEEDAIEKYGDKDIE 492

Query: 373 KLPLATNPRAKMHNTRDG---FVKLICRQHTGI-VLGGVIVGPRASELILAVSLAVQQRL 428
                  P       R+    ++KL+CR+   + VLG  ++GP A E+    ++A++   
Sbjct: 493 VYHSNFKPLEWTVAHREDNVCYMKLVCRKSDNMRVLGLHVLGPNAGEITQGYAVAIKMGA 552

Query: 429 TVDDVAHTFAVYPSLSGSVT 448
           T  D   T  ++P+ S + T
Sbjct: 553 TKADFDRTIGIHPTCSETFT 572


>3h4kA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
          Length = 588

 Score =  115 bits (287), Expect = 3e-28
 Identities = 112/440 (25%), Positives = 183/440 (41%), Gaps = 34/440 (7%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +    + +  +++A   G ++     D+  +     T+   V+ 
Sbjct: 144 GLGGTCVNVGCIPKKLMHQAGLLSHALEDAEHFGWSL-----DRSKISHNWSTMVEGVQS 198

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDER-----IRADVVLIATGAHPR- 147
              + +      LR   V  +  + RL+ PH V + D+      I  + +++ATG  P+ 
Sbjct: 199 HIGSLNWGYKVALRDNQVTYLNAKGRLISPHEVQITDKNQKVSTITGNKIILATGERPKY 258

Query: 148 -ELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
            E+P A   G   +T   L+ L   P K +V+G+     E A    +LG DVT V  R  
Sbjct: 259 PEIPGAVEYG---ITSDDLFSLPYFPGKTLVIGASYVALECAGFLASLGGDVT-VMVRSI 314

Query: 207 VMPTQDADAARVLEDVFARRGMTV--------LGNSRAESVTRTDAGVLV---RLTDGRV 255
           ++   D   A  + D     G+          +   +         G+L+     TDG+ 
Sbjct: 315 LLRGFDQQMAEKVGDYMENHGVKFAKLCVPDEIKQLKVVDTENNKPGLLLVKGHYTDGKK 374

Query: 256 IEGSH--CLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT-GVN 312
            E      +  VG  P  + +  E  G++LD+ G V      +T+   VYA GD   G  
Sbjct: 375 FEEEFETVIFAVGREPQLSKVLCETVGVKLDKNGRVVCTDDEQTTVSNVYAIGDINAGKP 434

Query: 313 MLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIV 372
            L  VA   GR         A      S VA+TVFT  E  A G +E+D +    D  I 
Sbjct: 435 QLTPVAIQAGRYLARRLFAGATELTDYSNVATTVFTPLEYGACGLSEEDAIEKYGDKDIE 494

Query: 373 KLPLATNPRAKMHNTRDG---FVKLICRQHTGI-VLGGVIVGPRASELILAVSLAVQQRL 428
                  P       R+    ++KL+CR+   + VLG  ++GP A E+    ++A++   
Sbjct: 495 VYHSNFKPLEWTVAHREDNVCYMKLVCRKSDNMRVLGLHVLGPNAGEITQGYAVAIKMGA 554

Query: 429 TVDDVAHTFAVYPSLSGSVT 448
           T  D   T  ++P+ S + T
Sbjct: 555 TKADFDRTIGIHPTCSETFT 574


>2hqmA [x.x.x] GLUTATHIONE REDUCTASE
          Length = 461

 Score =  113 bits (283), Expect = 1e-27
 Identities = 103/426 (24%), Positives = 174/426 (40%), Gaps = 15/426 (3%)

Query: 29  VIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVN 88
           ++E   +GG  V   CVP K +   S   + V  A   G+   N P DK+ +        
Sbjct: 30  LVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGL-YQNLPLDKEHLTFNWPEFK 88

Query: 89  ARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGD-----ERIRADVVLIATG 143
            +        +      L  E V+++ G AR      V V       E   A+ +L+ATG
Sbjct: 89  QKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATG 148

Query: 144 AHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSS 203
                 P   P  E        + L E P+K++VVG+G  G E A  +  LGS+  LV  
Sbjct: 149 GKAI-FPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIR 207

Query: 204 RDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVL-VRLTDGRVIEG-SHC 261
            + V+   D      + D + + G+ V   S+   V +     L + + D + I+     
Sbjct: 208 GETVLRKFDECIQNTITDHYVKEGINVHKLSKIVKVEKNVTDKLKIHMNDSKSIDDVDEL 267

Query: 262 LMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQ 321
           + T+G   +   +G E  GI+L+    +  D    T+ P +Y+ GD  G   L  VA   
Sbjct: 268 IWTIGR-KSHLGMGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAA 326

Query: 322 GRIAMWHALGAAV---SPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKLPL 376
           GR       G        L    V S +F+HPE  ++G +E + +   G+ + ++     
Sbjct: 327 GRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKF 386

Query: 377 ATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHT 436
                A +        K++C      V+G  IVG  ++E++    +A++   T  D  + 
Sbjct: 387 TAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNC 446

Query: 437 FAVYPS 442
            A++P+
Sbjct: 447 VAIHPT 452


>1onfA [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
          Length = 439

 Score =  105 bits (261), Expect = 3e-25
 Identities = 96/433 (22%), Positives = 189/433 (43%), Gaps = 42/433 (9%)

Query: 25  ADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVEL 84
           A V ++E+  +GG  V   CVP K +   +     ++ +   G +       K    + L
Sbjct: 25  AKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDT------KFSFNLPL 78

Query: 85  KTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPH--IVAVGDERIRADVVLIAT 142
             V  R K + +  ++   N L  + V++  G A  ++    ++AVG++ +   V  I  
Sbjct: 79  -LVERRDKYIQRLNNIYRQN-LSKDKVDLYEGTASFLEGRNILIAVGNKPVFPPVKGI-- 134

Query: 143 GAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVS 202
                         E  ++  + +++ E  +K+ +VGSG    E  N  + LG D  + +
Sbjct: 135 --------------ENTISSDEFFNIKE-SKKIGIVGSGYIAVELINVIKRLGIDSYIFA 179

Query: 203 SRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTR-TDAGVLVRLTDGRVIEG-SH 260
             +R++   D     VLE+   +  + ++  +    + + +D  + + L+DGR+ E   H
Sbjct: 180 RGNRILRKFDESVINVLENDMKKNNINIVTFADVVEIKKVSDKNLSIHLSDGRIYEHFDH 239

Query: 261 CLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNM----LAS 316
            +  VG  P+T NL LE+  +  +   ++ VD   RTS   +YA GDC  V      L  
Sbjct: 240 VIYCVGRSPDTENLKLEKLNVETNNN-YIVVDENQRTSVNNIYAVGDCCMVKFYNVQLTP 298

Query: 317 VAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS--GRVDGRIVKL 374
           VA   GR+                 + + +F+HP +  +G +E+  +   G+ + +I + 
Sbjct: 299 VAINAGRLLADRLFLKKTRKTNYKLIPTVIFSHPPIGTIGLSEEAAIQIYGKENVKIYES 358

Query: 375 PLATNPRAKMHNTRDG-----FVKLICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLT 429
              TN    +++         ++KL+C     ++ G  I+G  A E++   ++A++   T
Sbjct: 359 KF-TNLFFSVYDIEPELKEKTYLKLVCVGKDELIKGLHIIGLNADEIVQGFAVALKMNAT 417

Query: 430 VDDVAHTFAVYPS 442
             D   T  ++P+
Sbjct: 418 KKDFDETIPIHPT 430


>3eanF [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 488

 Score = 96.7 bits (239), Expect = 1e-22
 Identities = 107/430 (24%), Positives = 178/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V
Sbjct: 42  RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESV 95

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
           +    + +      LR + V       + + PH +      G E++  A+  LIATG  P
Sbjct: 96  QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERP 155

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 156 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 213

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG- 258
           ++   D D A  + +     G+  +       + + +AG   RL            IE  
Sbjct: 214 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDE 273

Query: 259 -SHCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLA 315
            +  L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L 
Sbjct: 274 FNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELT 333

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+      G +        V +TVFT  E    G +E+  V    +  I    
Sbjct: 334 PVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYH 393

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 394 SFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 453

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 454 QLDSTIGIHP 463


>3eanD [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 490

 Score = 96.7 bits (239), Expect = 1e-22
 Identities = 107/430 (24%), Positives = 178/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V
Sbjct: 44  RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESV 97

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
           +    + +      LR + V       + + PH +      G E++  A+  LIATG  P
Sbjct: 98  QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERP 157

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 158 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 215

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG- 258
           ++   D D A  + +     G+  +       + + +AG   RL            IE  
Sbjct: 216 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDE 275

Query: 259 -SHCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLA 315
            +  L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L 
Sbjct: 276 FNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELT 335

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+      G +        V +TVFT  E    G +E+  V    +  I    
Sbjct: 336 PVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYH 395

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 396 SFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 455

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 456 QLDSTIGIHP 465


>3eanC [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 485

 Score = 96.7 bits (239), Expect = 1e-22
 Identities = 107/430 (24%), Positives = 178/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V
Sbjct: 39  RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESV 92

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
           +    + +      LR + V       + + PH +      G E++  A+  LIATG  P
Sbjct: 93  QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERP 152

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 153 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 210

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG- 258
           ++   D D A  + +     G+  +       + + +AG   RL            IE  
Sbjct: 211 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDE 270

Query: 259 -SHCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLA 315
            +  L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L 
Sbjct: 271 FNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELT 330

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+      G +        V +TVFT  E    G +E+  V    +  I    
Sbjct: 331 PVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYH 390

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 391 SFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 450

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 451 QLDSTIGIHP 460


>3eanA [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 489

 Score = 96.7 bits (239), Expect = 1e-22
 Identities = 107/430 (24%), Positives = 178/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V
Sbjct: 43  RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESV 96

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
           +    + +      LR + V       + + PH +      G E++  A+  LIATG  P
Sbjct: 97  QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERP 156

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 157 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 214

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG- 258
           ++   D D A  + +     G+  +       + + +AG   RL            IE  
Sbjct: 215 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDE 274

Query: 259 -SHCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLA 315
            +  L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L 
Sbjct: 275 FNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELT 334

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+      G +        V +TVFT  E    G +E+  V    +  I    
Sbjct: 335 PVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYH 394

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 395 SFFWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQ 454

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 455 QLDSTIGIHP 464


>1h6vE [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
          Length = 491

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 106/428 (24%), Positives = 177/428 (41%), Gaps = 28/428 (6%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V+ 
Sbjct: 46  GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESVQN 99

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHPRE 148
              + +      LR + V       + + PH +      G E++  A+  LIATG  PR 
Sbjct: 100 HIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRY 159

Query: 149 LPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVM 208
           L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  ++
Sbjct: 160 LGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILL 217

Query: 209 PTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG--S 259
              D D A  + +     G+  +       + + +AG   RL            IE   +
Sbjct: 218 RGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFN 277

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLASV 317
             L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L  V
Sbjct: 278 TVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPV 337

Query: 318 AAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
           A   GR+      G +        V +TVFT  E    G +E+  V    +  I      
Sbjct: 338 AIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSF 397

Query: 378 TNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDV 433
             P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT   +
Sbjct: 398 FWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQL 457

Query: 434 AHTFAVYP 441
             T  ++P
Sbjct: 458 DSTIGIHP 465


>1h6vC [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
          Length = 482

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 106/428 (24%), Positives = 177/428 (41%), Gaps = 28/428 (6%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V+ 
Sbjct: 41  GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESVQN 94

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHPRE 148
              + +      LR + V       + + PH +      G E++  A+  LIATG  PR 
Sbjct: 95  HIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRY 154

Query: 149 LPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVM 208
           L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  ++
Sbjct: 155 LGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILL 212

Query: 209 PTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG--S 259
              D D A  + +     G+  +       + + +AG   RL            IE   +
Sbjct: 213 RGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFN 272

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLASV 317
             L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L  V
Sbjct: 273 TVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPV 332

Query: 318 AAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
           A   GR+      G +        V +TVFT  E    G +E+  V    +  I      
Sbjct: 333 AIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSF 392

Query: 378 TNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDV 433
             P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT   +
Sbjct: 393 FWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQL 452

Query: 434 AHTFAVYP 441
             T  ++P
Sbjct: 453 DSTIGIHP 460


>1h6vB [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
          Length = 487

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 106/428 (24%), Positives = 177/428 (41%), Gaps = 28/428 (6%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V+ 
Sbjct: 46  GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESVQN 99

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHPRE 148
              + +      LR + V       + + PH +      G E++  A+  LIATG  PR 
Sbjct: 100 HIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRY 159

Query: 149 LPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVM 208
           L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  ++
Sbjct: 160 LGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILL 217

Query: 209 PTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG--S 259
              D D A  + +     G+  +       + + +AG   RL            IE   +
Sbjct: 218 RGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFN 277

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLASV 317
             L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L  V
Sbjct: 278 TVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPV 337

Query: 318 AAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
           A   GR+      G +        V +TVFT  E    G +E+  V    +  I      
Sbjct: 338 AIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSF 397

Query: 378 TNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDV 433
             P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT   +
Sbjct: 398 FWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQL 457

Query: 434 AHTFAVYP 441
             T  ++P
Sbjct: 458 DSTIGIHP 465


>1h6vA [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
          Length = 490

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 106/428 (24%), Positives = 177/428 (41%), Gaps = 28/428 (6%)

Query: 34  GIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKR 93
           G+GG  V   C+P K +   ++    +K++   G  +      +D V+ + + +   V+ 
Sbjct: 45  GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL------EDTVKHDWEKMTESVQN 98

Query: 94  LAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHPRE 148
              + +      LR + V       + + PH +      G E++  A+  LIATG  PR 
Sbjct: 99  HIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRY 158

Query: 149 LPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVM 208
           L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  ++
Sbjct: 159 LGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILL 216

Query: 209 PTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEG--S 259
              D D A  + +     G+  +       + + +AG   RL            IE   +
Sbjct: 217 RGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFN 276

Query: 260 HCLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGD-CTGVNMLASV 317
             L+ VG    T  +GLE  G++++E+ G + V    +T+ P +YA GD   G   L  V
Sbjct: 277 TVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPV 336

Query: 318 AAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLA 377
           A   GR+      G +        V +TVFT  E    G +E+  V    +  I      
Sbjct: 337 AIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSF 396

Query: 378 TNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDV 433
             P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT   +
Sbjct: 397 FWPLEWTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQL 456

Query: 434 AHTFAVYP 441
             T  ++P
Sbjct: 457 DSTIGIHP 464


>2zzcA [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
          Length = 485

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 43  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 100

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 101 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 156

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 157 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 214

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 215 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 274

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 275 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 334

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 335 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 394

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 395 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 454

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 455 QLDSTIGIHP 464


>2zzbC [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
          Length = 493

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 46  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 103

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 104 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 159

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 160 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 217

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 218 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 277

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 278 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 337

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 338 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 397

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 398 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 457

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 458 QLDSTIGIHP 467


>2zz0B [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
          Length = 487

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 46  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 103

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 104 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 159

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 160 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 217

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 218 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 277

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 278 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 337

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 338 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 397

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 398 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 457

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 458 QLDSTIGIHP 467


>2j3nF [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 485

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 44  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 101

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 102 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 157

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 158 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 215

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 216 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 275

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 276 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 335

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 336 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 395

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 396 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 455

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 456 QLDSTIGIHP 465


>2j3nD [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 491

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 44  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 101

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 102 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 157

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 158 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 215

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 216 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 275

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 276 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 335

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 336 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 395

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 396 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 455

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 456 QLDSTIGIHP 465


>2j3nC [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 490

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 43  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 100

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 101 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 156

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 157 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 214

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 215 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 274

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 275 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 334

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 335 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 394

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 395 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 454

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 455 QLDSTIGIHP 464


>2j3nB [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 486

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 44  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 101

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 102 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 157

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 158 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 215

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 216 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 275

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 276 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 335

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 336 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 395

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 396 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 455

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 456 QLDSTIGIHP 465


>2j3nA [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 486

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 43  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 100

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 101 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 156

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 157 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 214

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 215 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 274

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 275 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 334

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 335 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 394

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 395 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 454

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 455 QLDSTIGIHP 464


>2cfyA [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 484

 Score = 95.9 bits (237), Expect = 2e-22
 Identities = 110/430 (25%), Positives = 179/430 (41%), Gaps = 28/430 (6%)

Query: 32  RDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGNEPEDKDLVRVELKTVNARV 91
           R G+GG  V   C+P K +   ++    ++++   G  V  E    D  R+ ++ V   +
Sbjct: 43  RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV-EETVKHDWDRM-IEAVQNHI 100

Query: 92  KRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAV----GDERI-RADVVLIATGAHP 146
             L     V     LR + V       + + PH +      G E+I  A+  LIATG  P
Sbjct: 101 GSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERP 156

Query: 147 RELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDR 206
           R L     D E  ++   L+ L   P K +VVG+     E A     +G DVT V  R  
Sbjct: 157 RYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSI 214

Query: 207 VMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL-------TDGRVIEGS 259
           ++   D D A  + +     G+  +       V + +AG   RL           +IEG 
Sbjct: 215 LLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGE 274

Query: 260 H--CLMTVGMVPNTANLGLEEAGIRLDER-GFVQVDRVSRTSTPGVYAAGDCTGVNM-LA 315
           +   ++ +G    T  +GLE  G++++E+ G + V    +T+ P +YA GD     + L 
Sbjct: 275 YNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELT 334

Query: 316 SVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLP 375
            VA   GR+        +        V +TVFT  E  A G +E+  V    +  I    
Sbjct: 335 PVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYH 394

Query: 376 LATNPRAKMHNTRDG---FVKLICR-QHTGIVLGGVIVGPRASELILAVSLAVQQRLTVD 431
               P      +RD    + K+IC  +    V+G  ++GP A E+    + A++  LT  
Sbjct: 395 SYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 454

Query: 432 DVAHTFAVYP 441
            +  T  ++P
Sbjct: 455 QLDSTIGIHP 464


>3ic9C [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 471

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 91/345 (26%), Positives = 145/345 (42%), Gaps = 18/345 (5%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGN-EPEDKD 78
           AA+   D  V+   G  G +      PSK LIA +  + +  +    GI V       K 
Sbjct: 23  AAKKHTDKVVLIEGGAYGTTCARVGCPSKLLIAAADASYHASQTDLFGIQVDRISVNGKA 82

Query: 79  LVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDE-RIRADV 137
           + R++ +               D  +++R        G A+ +D H + V D  ++ A  
Sbjct: 83  VKRIQTERDRXXXXXXXXXXXXDEQDKIR--------GFAKFLDEHTLQVDDHSQVIAKR 134

Query: 138 VLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSD 197
           ++IATG+ P         G R+LT   L++LN+LP+ + V G GV G E   A   LG  
Sbjct: 135 IVIATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFGPGVIGLELGQALSRLGVI 194

Query: 198 VTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL--TDGRV 255
           V +      V   QD +  R  E  F              ++ + DA  ++    +  + 
Sbjct: 195 VKVFGRSGSVANLQD-EEKRYAEKTFNEEFYFDAKARVISTIEKEDAVEVIYFDKSGQKT 253

Query: 256 IEG-SHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVS-RTSTPGVYAAGDCTGVNM 313
            E   + L   G   N   LGLE   I LD++     D ++ +TS   ++ AGD      
Sbjct: 254 TESFQYVLAATGRKANVDKLGLENTSIELDKKNSPLFDELTLQTSVDHIFVAGDANNTLT 313

Query: 314 LASVAAMQGRIAMWHALGA--AVSPLRLSTVASTVFTHPELAAVG 356
           L   AA  G++A  +A GA   ++  +     S VFT P++A+VG
Sbjct: 314 LLHEAADDGKVAGTNA-GAYPVIAQGQRRAPLSVVFTEPQVASVG 357


>3ic9A [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
          Length = 469

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 91/345 (26%), Positives = 145/345 (42%), Gaps = 18/345 (5%)

Query: 20  AAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINVGN-EPEDKD 78
           AA+   D  V+   G  G +      PSK LIA +  + +  +    GI V       K 
Sbjct: 21  AAKKHTDKVVLIEGGAYGTTCARVGCPSKLLIAAADASYHASQTDLFGIQVDRISVNGKA 80

Query: 79  LVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDE-RIRADV 137
           + R++ +               D  +++R        G A+ +D H + V D  ++ A  
Sbjct: 81  VKRIQTERDRXXXXXXXXXXXXDEQDKIR--------GFAKFLDEHTLQVDDHSQVIAKR 132

Query: 138 VLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSD 197
           ++IATG+ P         G R+LT   L++LN+LP+ + V G GV G E   A   LG  
Sbjct: 133 IVIATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFGPGVIGLELGQALSRLGVI 192

Query: 198 VTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRL--TDGRV 255
           V +      V   QD +  R  E  F              ++ + DA  ++    +  + 
Sbjct: 193 VKVFGRSGSVANLQD-EEKRYAEKTFNEEFYFDAKARVISTIEKEDAVEVIYFDKSGQKT 251

Query: 256 IEG-SHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVS-RTSTPGVYAAGDCTGVNM 313
            E   + L   G   N   LGLE   I LD++     D ++ +TS   ++ AGD      
Sbjct: 252 TESFQYVLAATGRKANVDKLGLENTSIELDKKNSPLFDELTLQTSVDHIFVAGDANNTLT 311

Query: 314 LASVAAMQGRIAMWHALGA--AVSPLRLSTVASTVFTHPELAAVG 356
           L   AA  G++A  +A GA   ++  +     S VFT P++A+VG
Sbjct: 312 LLHEAADDGKVAGTNA-GAYPVIAQGQRRAPLSVVFTEPQVASVG 355


>3cgcA [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
          Length = 444

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 89/344 (25%), Positives = 155/344 (45%), Gaps = 35/344 (10%)

Query: 136 DVVLIATGAHP-------RELPTAR-----PDGERILTWRQLYDLNELPEKLIVVGSGVT 183
           D +LIATG  P       R+L         PD ERIL   +  + N++ E + ++G G  
Sbjct: 106 DRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERIL---KTLETNKV-EDVTIIGGGAI 161

Query: 184 GAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTD 243
           G E A  +  LG  V ++   D +    D D A  +     +  + +L N   ++    +
Sbjct: 162 GLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNE 221

Query: 244 AGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVY 303
               V  TD    +    L++VG+ PNT    LE   IR + +G ++V+   +T+   VY
Sbjct: 222 RVEAVE-TDKGTYKADLVLVSVGVKPNTD--FLEGTNIRTNHKGAIEVNAYMQTNVQDVY 278

Query: 304 AAGDC-TGVNMLASV---------AAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELA 353
           AAGDC T  +++  +         A  QGR+A  + L    +           F +  LA
Sbjct: 279 AAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLA 338

Query: 354 AVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPR- 412
             G  E +     +  + VK+  +TN      N +  ++KL+ R  T  +LGG ++G   
Sbjct: 339 RTGLNEKEAKGLHIPYKTVKVD-STNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEG 397

Query: 413 ASELILAVSLAVQQRLTV---DDVAHTFA-VYPSLSGSVTEAAR 452
             + I  +++A+  ++++   +DV  ++A  Y S+   + +AAR
Sbjct: 398 VDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAAR 441


>2cduB [x.x.x] NADPH OXIDASE
          Length = 448

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 81/372 (21%), Positives = 159/372 (42%), Gaps = 39/372 (10%)

Query: 83  ELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRA-DVVLIA 141
           EL  + A V+   Q  +VD               E + +    +   +E+  A D +++ 
Sbjct: 66  ELSNLGANVQMRHQVTNVDP--------------ETKTIKVKDLITNEEKTEAYDKLIMT 111

Query: 142 TGAHPRELPTARPDGERILTWRQLYDLNELPEK------LIVVGSGVTGAEFANAYQALG 195
           TG+ P   P    D  R+   +   D  +L E+      + ++GSG  GAE A AY    
Sbjct: 112 TGSKPTVPPIPGIDSSRVYLCKNYNDAKKLFEEAPKAKTITIIGSGYIGAELAEAYSNQN 171

Query: 196 SDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGR 254
            +V L+   +RV+    D +   +L   +   G+ ++  S+  +    D  ++ +  DG+
Sbjct: 172 YNVNLIDGHERVLYKYFDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGK 231

Query: 255 VIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNM- 313
            I+    ++ +G  PNT    L +  + + + G +  D    +S   ++AAGD   V+  
Sbjct: 232 EIKSDIAILCIGFRPNTE---LLKGKVAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHYN 288

Query: 314 ---------LASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS 364
                    LA+ A  QGR+   +     V    + T +S+         V    +  ++
Sbjct: 289 PTNSNAYIPLATNAVRQGRLVGLNLTEDKVKD--MGTQSSSGLKLYGRTYVSTGINTALA 346

Query: 365 GRVDGRIVKLPLATNPRAK-MHNTRDGFVKLICRQHTGIVLGGVIVGPR-ASELILAVSL 422
              + ++ ++ +A N R + M +T +  + L+    T ++LGG +      S+    +S+
Sbjct: 347 KANNLKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSV 406

Query: 423 AVQQRLTVDDVA 434
            +Q + T+DD+A
Sbjct: 407 CIQNKNTIDDLA 418


>2cduA [x.x.x] NADPH OXIDASE
          Length = 450

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 81/372 (21%), Positives = 159/372 (42%), Gaps = 39/372 (10%)

Query: 83  ELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRA-DVVLIA 141
           EL  + A V+   Q  +VD               E + +    +   +E+  A D +++ 
Sbjct: 66  ELSNLGANVQMRHQVTNVDP--------------ETKTIKVKDLITNEEKTEAYDKLIMT 111

Query: 142 TGAHPRELPTARPDGERILTWRQLYDLNELPEK------LIVVGSGVTGAEFANAYQALG 195
           TG+ P   P    D  R+   +   D  +L E+      + ++GSG  GAE A AY    
Sbjct: 112 TGSKPTVPPIPGIDSSRVYLCKNYNDAKKLFEEAPKAKTITIIGSGYIGAELAEAYSNQN 171

Query: 196 SDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGR 254
            +V L+   +RV+    D +   +L   +   G+ ++  S+  +    D  ++ +  DG+
Sbjct: 172 YNVNLIDGHERVLYKYFDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGK 231

Query: 255 VIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNM- 313
            I+    ++ +G  PNT    L +  + + + G +  D    +S   ++AAGD   V+  
Sbjct: 232 EIKSDIAILCIGFRPNTE---LLKGKVAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHYN 288

Query: 314 ---------LASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATEDDVVS 364
                    LA+ A  QGR+   +     V    + T +S+         V    +  ++
Sbjct: 289 PTNSNAYIPLATNAVRQGRLVGLNLTEDKVKD--MGTQSSSGLKLYGRTYVSTGINTALA 346

Query: 365 GRVDGRIVKLPLATNPRAK-MHNTRDGFVKLICRQHTGIVLGGVIVGPR-ASELILAVSL 422
              + ++ ++ +A N R + M +T +  + L+    T ++LGG +      S+    +S+
Sbjct: 347 KANNLKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSV 406

Query: 423 AVQQRLTVDDVA 434
            +Q + T+DD+A
Sbjct: 407 CIQNKNTIDDLA 418


>1joaA [x.x.x] NADH PEROXIDASE
          Length = 446

 Score = 70.5 bits (171), Expect = 9e-15
 Identities = 109/461 (23%), Positives = 177/461 (38%), Gaps = 72/461 (15%)

Query: 3   KVVIIGGGPGGYEAALVAAQLGADVTVI---ERDGIGGASVLTDCVPSKTLIATSVRTSY 59
           KV+++G   GGYEA      L  D  +    + D I   S +   +  K     SVR   
Sbjct: 2   KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMT 61

Query: 60  VKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEAR 119
            ++  + G+NV +  E   +  ++ K     VK L                         
Sbjct: 62  GEKMESRGVNVFSNTE---ITAIQPKEHQVTVKDLVS----------------------- 95

Query: 120 LVDPHIVAVGDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEK---- 174
                    G+ER+   D ++I+ GA P EL     D + I   R      +L +K    
Sbjct: 96  ---------GEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDP 146

Query: 175 ----LIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMT 229
               ++V+GSG                VT++   DR +    D +   VL +      +T
Sbjct: 147 EVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNIT 206

Query: 230 VLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFV 289
           +      E     D  V   +TD    +    ++ VG+ PNTA L   +  + L   G +
Sbjct: 207 IATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGTLELHPNGLI 262

Query: 290 QVDRVSRTSTPGVYAAGDCTGVN----------MLASVAAMQGRIAMWHALGAAVSPLR- 338
           + D   RTS P V+A GD T +            LA+ A  QGR A+ + L   V P   
Sbjct: 263 KTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKN-LEEPVKPFPG 321

Query: 339 -LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHN--TRDGFVKLI 395
              +    VF + + A+ G  E   V  +  G+  K            N   +  + KL+
Sbjct: 322 VQGSSGLAVFDY-KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLV 377

Query: 396 CRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAH 435
               T  +LG  ++     +  I A+SLA+Q ++T++D+A+
Sbjct: 378 YDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAY 418


>1f8wA [c.3.1 - c.3.1 - d.87.1] NADH PEROXIDASE
          Length = 446

 Score = 70.5 bits (171), Expect = 9e-15
 Identities = 109/461 (23%), Positives = 177/461 (38%), Gaps = 72/461 (15%)

Query: 3   KVVIIGGGPGGYEAALVAAQLGADVTVI---ERDGIGGASVLTDCVPSKTLIATSVRTSY 59
           KV+++G   GGYEA      L  D  +    + D I   S +   +  K     SVR   
Sbjct: 2   KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMT 61

Query: 60  VKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEAR 119
            ++  + G+NV +  E   +  ++ K     VK L                         
Sbjct: 62  GEKMESRGVNVFSNTE---ITAIQPKEHQVTVKDLVS----------------------- 95

Query: 120 LVDPHIVAVGDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEK---- 174
                    G+ER+   D ++I+ GA P EL     D + I   R      +L +K    
Sbjct: 96  ---------GEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDP 146

Query: 175 ----LIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMT 229
               ++V+GSG                VT++   DR +    D +   VL +      +T
Sbjct: 147 EVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNIT 206

Query: 230 VLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFV 289
           +      E     D  V   +TD    +    ++ VG+ PNTA L   +  + L   G +
Sbjct: 207 IATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGTLELHPNGLI 262

Query: 290 QVDRVSRTSTPGVYAAGDCTGVN----------MLASVAAMQGRIAMWHALGAAVSPLR- 338
           + D   RTS P V+A GD T +            LA+ A  QGR A+ + L   V P   
Sbjct: 263 KTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNAMKQGRFAVKN-LEEPVKPFPG 321

Query: 339 -LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHN--TRDGFVKLI 395
              +    VF + + A+ G  E   V  +  G+  K            N   +  + KL+
Sbjct: 322 VQGSSGLAVFDY-KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLV 377

Query: 396 CRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAH 435
               T  +LG  ++     +  I A+SLA+Q ++T++D+A+
Sbjct: 378 YDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAY 418


>2v3aA [x.x.x] RUBREDOXIN REDUCTASE
          Length = 381

 Score = 68.6 bits (166), Expect = 4e-14
 Identities = 80/306 (26%), Positives = 134/306 (43%), Gaps = 47/306 (15%)

Query: 128 VGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPE------------KL 175
           +G+E +R   +++A GA P  +P    +G+       LY +N+L +            ++
Sbjct: 92  IGEEEVRYRDLVLAWGAEPIRVPV---EGD---AQDALYPINDLEDYARFRQAAAGKRRV 145

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMP-TQDADAARVLEDVFARRGMTVLGNS 234
           +++G+G+ G EFAN   + G  + +V+  ++VMP      AA+ ++      G+      
Sbjct: 146 LLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGP 205

Query: 235 RAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRV 294
              S+ +   G+   L+DG VI     +  VG+ P T  L    AG+ ++ RG V VDR 
Sbjct: 206 VLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRT-ELAF-AAGLAVN-RGIV-VDRS 261

Query: 295 SRTSTPGVYAAGDCT---GVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPE 351
            RTS   +YA GDC    G+N+L  +  M    A+   L    S +    +  TV T P 
Sbjct: 262 LRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKT-PA 320

Query: 352 LAAVGATEDDVVSGR--VDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIV 409
              V +     + G+  V+G    L                  K++CR   G V+G  + 
Sbjct: 321 CPLVVSPPPRGMDGQWLVEGSGTDL------------------KVLCRDTAGRVIGYALT 362

Query: 410 GPRASE 415
           G   +E
Sbjct: 363 GAAVNE 368


>1nhsA [x.x.x] NADH PEROXIDASE
          Length = 446

 Score = 68.6 bits (166), Expect = 4e-14
 Identities = 108/461 (23%), Positives = 176/461 (38%), Gaps = 72/461 (15%)

Query: 3   KVVIIGGGPGGYEAALVAAQLGADVTVI---ERDGIGGASVLTDCVPSKTLIATSVRTSY 59
           KV+++G   GGYEA      L  D  +    + D I     +   +  K     SVR   
Sbjct: 2   KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMT 61

Query: 60  VKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEAR 119
            ++  + G+NV +  E   +  ++ K     VK L                         
Sbjct: 62  GEKMESRGVNVFSNTE---ITAIQPKEHQVTVKDLVS----------------------- 95

Query: 120 LVDPHIVAVGDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEK---- 174
                    G+ER+   D ++I+ GA P EL     D + I   R      +L +K    
Sbjct: 96  ---------GEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDP 146

Query: 175 ----LIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMT 229
               ++V+GSG                VT++   DR +    D +   VL +      +T
Sbjct: 147 EVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNIT 206

Query: 230 VLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFV 289
           +      E     D  V   +TD    +    ++ VG+ PNTA L   +  + L   G +
Sbjct: 207 IATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGTLELHPNGLI 262

Query: 290 QVDRVSRTSTPGVYAAGDCTGVN----------MLASVAAMQGRIAMWHALGAAVSPLR- 338
           + D   RTS P V+A GD T +            LA+ A  QGR A+ + L   V P   
Sbjct: 263 KTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKN-LEEPVKPFPG 321

Query: 339 -LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHN--TRDGFVKLI 395
              +    VF + + A+ G  E   V  +  G+  K            N   +  + KL+
Sbjct: 322 VQGSSGLAVFDY-KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLV 377

Query: 396 CRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAH 435
               T  +LG  ++     +  I A+SLA+Q ++T++D+A+
Sbjct: 378 YDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAY 418


>3iwaA [x.x.x] FAD-DEPENDENT PYRIDINE NUCLEOTIDE-DISULPHIDE
          Length = 397

 Score = 68.2 bits (165), Expect = 5e-14
 Identities = 77/291 (26%), Positives = 131/291 (45%), Gaps = 27/291 (9%)

Query: 174 KLIVVGSGVTGAEFANAYQAL-GSDVTLVSSRDRVMPTQDADA-ARVLEDVFARRGMTVL 231
           K ++VG G  G E A +   + G D T+V   D++MP   + + +++L     +  + V 
Sbjct: 115 KAVIVGGGFIGLEMAVSLADMWGIDTTVVELADQIMPGFTSKSLSQMLRHDLEKNDVVVH 174

Query: 232 GNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQV 291
              +   +   +  V   +TD R ++    ++  G+ PNT      +AG+ LD RG + V
Sbjct: 175 TGEKVVRLEGENGKVARVITDKRTLDADLVILAAGVSPNTQLA--RDAGLELDPRGAIIV 232

Query: 292 DRVSRTSTPGVYAAGDCT----------GVNMLASVAAMQGRIAMWH-ALGAAVSPLRLS 340
           D   RTS P ++A GDC           G   L S+A  QGR+   + A G A  P  + 
Sbjct: 233 DTRMRTSDPDIFAGGDCVTIPNLVTGKPGFFPLGSMANRQGRVIGTNLADGDATFPGAVG 292

Query: 341 TVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHT 400
           + A  +F   E +A GA         V+G + +   A N   +   T    V    R+  
Sbjct: 293 SWAVKLF---EGSASGA------GLTVEGALREGYDAVNVHVEQIMTLQLVVDRPTRRVL 343

Query: 401 GIVLGGVIVGPRASELILAVSLAVQQRLTVDDVAHTFAVYP--SLSGSVTE 449
           GI  G   +G   +  I AV+  +  + TV+D+++   V    +++G+V +
Sbjct: 344 GI-QGFSTLGDALTARINAVATMLASKPTVEDISNAEVVMDIVNVAGNVAD 393


>1nhqA [x.x.x] NADH PEROXIDASE
          Length = 447

 Score = 67.8 bits (164), Expect = 6e-14
 Identities = 108/462 (23%), Positives = 176/462 (38%), Gaps = 73/462 (15%)

Query: 3   KVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTD----CVPSKTLIATSVRTS 58
           KV+++G   GGYEA      L  D  +   +     S L+      +  K     SVR  
Sbjct: 2   KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYM 61

Query: 59  YVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEA 118
             ++  + G+NV +  E   +  ++ K     VK L                        
Sbjct: 62  TGEKMESRGVNVFSNTE---ITAIQPKEHQVTVKDLVS---------------------- 96

Query: 119 RLVDPHIVAVGDERIRA-DVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEK--- 174
                     G+ER+   D ++I+ GA P EL     D + I   R      +L +K   
Sbjct: 97  ----------GEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVD 146

Query: 175 -----LIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGM 228
                ++V+GSG                VT++   DR +    D +   VL +      +
Sbjct: 147 PEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNI 206

Query: 229 TVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGF 288
           T+      E     D  V   +TD    +    ++ VG+ PNTA L   +  + L   G 
Sbjct: 207 TIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGTLELHPNGL 262

Query: 289 VQVDRVSRTSTPGVYAAGDCTGVN----------MLASVAAMQGRIAMWHALGAAVSPLR 338
           ++ D   RTS P V+A GD T +            LA+ A  QGR A+ + L   V P  
Sbjct: 263 IKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKN-LEEPVKPFP 321

Query: 339 --LSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHN--TRDGFVKL 394
               +    VF + + A+ G  E   V  +  G+  K            N   +  + KL
Sbjct: 322 GVQGSSGLAVFDY-KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKL 377

Query: 395 ICRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAH 435
           +    T  +LG  ++     +  I A+SLA+Q ++T++D+A+
Sbjct: 378 VYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAY 419


>1nhrA [x.x.x] NADH PEROXIDASE
          Length = 447

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 92/367 (25%), Positives = 150/367 (40%), Gaps = 42/367 (11%)

Query: 102 TANRLRTEGVEIIIG-EARLVDP--HIVAV-----GDERIRA-DVVLIATGAHPRELPTA 152
           T  ++ + GV +    E   + P  H V V     G+ER+   D ++I+ GA P EL   
Sbjct: 62  TGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIP 121

Query: 153 RPDGERILTWRQLYDLNELPEK--------LIVVGSGVTGAEFANAYQALGSDVTLVSSR 204
             D + I   R      +L +K        ++V+GSG                VT++   
Sbjct: 122 GKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDIL 181

Query: 205 DRVMPTQ-DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLM 263
           DR +    D +   VL +      +T+      E     D  V   +TD    +    ++
Sbjct: 182 DRPLGVYLDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVV 240

Query: 264 TVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVN----------M 313
            VG+ PNTA L   +  + L   G ++ D   RTS P V+A GD T +            
Sbjct: 241 AVGVRPNTAWL---KGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIA 297

Query: 314 LASVAAMQGRIAMWHALGAAVSPLR--LSTVASTVFTHPELAAVGATEDDVVSGRVDGRI 371
           LA+ A  QGR A+ + L   V P      +    VF + + A+ G  E   V  +  G+ 
Sbjct: 298 LATNARKQGRFAVKN-LEEPVKPFPGVQGSSGLAVFDY-KFASTGINE---VMAQKLGKE 352

Query: 372 VKLPLATNPRAKMHN--TRDGFVKLICRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRL 428
            K            N   +  + KL+    T  +LG  ++     +  I A+SLA+Q ++
Sbjct: 353 TKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKM 412

Query: 429 TVDDVAH 435
           T++D+A+
Sbjct: 413 TIEDLAY 419


>1nhpA [x.x.x] NADH PEROXIDASE
          Length = 447

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 92/367 (25%), Positives = 150/367 (40%), Gaps = 42/367 (11%)

Query: 102 TANRLRTEGVEIIIG-EARLVDP--HIVAV-----GDERIRA-DVVLIATGAHPRELPTA 152
           T  ++ + GV +    E   + P  H V V     G+ER+   D ++I+ GA P EL   
Sbjct: 62  TGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIP 121

Query: 153 RPDGERILTWRQLYDLNELPEK--------LIVVGSGVTGAEFANAYQALGSDVTLVSSR 204
             D + I   R      +L +K        ++V+GSG                VT++   
Sbjct: 122 GKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDIL 181

Query: 205 DRVMPTQ-DADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLM 263
           DR +    D +   VL +      +T+      E     D  V   +TD    +    ++
Sbjct: 182 DRPLGVYLDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVV 240

Query: 264 TVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVN----------M 313
            VG+ PNTA L   +  + L   G ++ D   RTS P V+A GD T +            
Sbjct: 241 AVGVRPNTAWL---KGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIA 297

Query: 314 LASVAAMQGRIAMWHALGAAVSPLR--LSTVASTVFTHPELAAVGATEDDVVSGRVDGRI 371
           LA+ A  QGR A+ + L   V P      +    VF + + A+ G  E   V  +  G+ 
Sbjct: 298 LATNARKQGRFAVKN-LEEPVKPFPGVQGSSGLAVFDY-KFASTGINE---VMAQKLGKE 352

Query: 372 VKLPLATNPRAKMHN--TRDGFVKLICRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRL 428
            K            N   +  + KL+    T  +LG  ++     +  I A+SLA+Q ++
Sbjct: 353 TKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKM 412

Query: 429 TVDDVAH 435
           T++D+A+
Sbjct: 413 TIEDLAY 419


>1mo9A [c.3.1 - c.3.1 - d.87.1] ORF3
          Length = 522

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 75/339 (22%), Positives = 138/339 (40%), Gaps = 25/339 (7%)

Query: 118 ARLVDPHIVAVGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYD-LNELP-EKL 175
           A+++D H V    +  +A  +++A GA P  L     + + +     L + L+  P    
Sbjct: 157 AKVIDNHTVEAAGKVFKAKNLILAVGAGPGTLDVPGVNAKGVFDHATLVEELDYEPGSTX 216

Query: 176 IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSR 235
                  T  E+   + A G    ++   + +   +D +    + D    +GM ++  S 
Sbjct: 217 XXXXXSKTAVEYGCFFNATGRRTVMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISGSN 276

Query: 236 AESVTRTDAG----VLVRLTDGRV-IEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQ 290
              +     G    V+    +G + IE     + +G  P +A L  +  G+ L  +G V 
Sbjct: 277 VTRIEEDANGRVQAVVAMTPNGEMRIETDFVFLGLGEQPRSAELA-KILGLDLGPKGEVL 335

Query: 291 VDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP 350
           V+   +TS P VYA GD  G  M    A   G  A  + +G  +S          + TH 
Sbjct: 336 VNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNVMGEKIS-YTPKNYPDFLHTHY 394

Query: 351 ELAAVGATEDDVVSGRVDGRIVKLP----------LATNPRAKMH------NTRDGFVKL 394
           E++ +G  E++  +   +   +K+P          L  + R  ++          GF K+
Sbjct: 395 EVSFLGMGEEEARAAGHEIVTIKMPPDTENGLNVALPASDRTMLYAFGKGTAHMSGFQKI 454

Query: 395 ICRQHTGIVLGGVIVGPRASELILAVSLAVQQRLTVDDV 433
           +    T  VLG   VG  A +    +++ ++Q LTVD++
Sbjct: 455 VIDAKTRKVLGAHHVGYGAKDAFQYLNVLIKQGLTVDEL 493


>2bc1A [x.x.x] NADH OXIDASE
          Length = 473

 Score = 63.9 bits (154), Expect = 9e-13
 Identities = 68/285 (23%), Positives = 110/285 (38%), Gaps = 34/285 (11%)

Query: 173 EKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMT-- 229
           +++ VVG+G  G E A A+Q  G +V L+   D  +    D D   ++       G+   
Sbjct: 178 KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYYDRDLTDLMAKNMEEHGIQLA 237

Query: 230 -------VLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIR 282
                  V GN + E +          +TD    +    ++ VG  PNT    L    I 
Sbjct: 238 FGETVKEVAGNGKVEKI----------ITDKNEYDVDMVILAVGFRPNTT---LGNGKID 284

Query: 283 LDERGFVQVDRVSRTSTPGVYAAGDC----------TGVNMLASVAAMQGRIAMWHALGA 332
           L   G   V++   TS PGVYA GDC          T    LAS A   G +A  +A G 
Sbjct: 285 LFRNGAFLVNKRQETSIPGVYAIGDCATIYDNATRDTNYIALASNAVRTGIVAAHNACGT 344

Query: 333 AVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFV 392
            +  + +            + + G T +       D  + +      P    H      +
Sbjct: 345 DLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTI 404

Query: 393 KLICRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAHT 436
           K++  + +  +LG  +      S  I   SLA+Q+ +T++ +A T
Sbjct: 405 KIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT 449


>2bc0A [x.x.x] NADH OXIDASE
          Length = 472

 Score = 63.9 bits (154), Expect = 9e-13
 Identities = 68/285 (23%), Positives = 110/285 (38%), Gaps = 34/285 (11%)

Query: 173 EKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQ-DADAARVLEDVFARRGMT-- 229
           +++ VVG+G  G E A A+Q  G +V L+   D  +    D D   ++       G+   
Sbjct: 177 KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYYDRDLTDLMAKNMEEHGIQLA 236

Query: 230 -------VLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIR 282
                  V GN + E +          +TD    +    ++ VG  PNT    L    I 
Sbjct: 237 FGETVKEVAGNGKVEKI----------ITDKNEYDVDMVILAVGFRPNTT---LGNGKID 283

Query: 283 LDERGFVQVDRVSRTSTPGVYAAGDC----------TGVNMLASVAAMQGRIAMWHALGA 332
           L   G   V++   TS PGVYA GDC          T    LAS A   G +A  +A G 
Sbjct: 284 LFRNGAFLVNKRQETSIPGVYAIGDCATIYDNATRDTNYIALASNAVRTGIVAAHNACGT 343

Query: 333 AVSPLRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFV 392
            +  + +            + + G T +       D  + +      P    H      +
Sbjct: 344 DLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTI 403

Query: 393 KLICRQHTGIVLGGVIVGPR-ASELILAVSLAVQQRLTVDDVAHT 436
           K++  + +  +LG  +      S  I   SLA+Q+ +T++ +A T
Sbjct: 404 KIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT 448


>3ctyB [x.x.x] THIOREDOXIN REDUCTASE
          Length = 305

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 254 RVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNM 313
           ++IE     + VG++P T+ L  +++G++LDERG++ VD   RTS PGVYAAGD T  N 
Sbjct: 225 KLIETDGVFIYVGLIPQTSFL--KDSGVKLDERGYIVVDSRQRTSVPGVYAAGDVTSGN- 281

Query: 314 LASVAAMQG 322
            A +A+  G
Sbjct: 282 FAQIASAVG 290


>3ctyA [x.x.x] THIOREDOXIN REDUCTASE
          Length = 304

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 254 RVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNM 313
           ++IE     + VG++P T+ L  +++G++LDERG++ VD   RTS PGVYAAGD T  N 
Sbjct: 224 KLIETDGVFIYVGLIPQTSFL--KDSGVKLDERGYIVVDSRQRTSVPGVYAAGDVTSGN- 280

Query: 314 LASVAAMQG 322
            A +A+  G
Sbjct: 281 FAQIASAVG 289


>1m6iA [c.3.1 - c.3.1 - d.87.1] PROGRAMMED CELL DEATH PROTEIN 8
          Length = 459

 Score = 54.3 bits (129), Expect = 7e-10
 Identities = 57/221 (25%), Positives = 104/221 (47%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 95  GVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 154

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + ++G G  G+E A A     +ALG++V  +     +  ++
Sbjct: 155 FRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKI 214

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 215 LPEYLSNWT--MEKV-RREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGL 271

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 272 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 309


>3cgbA [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
          Length = 431

 Score = 54.3 bits (129), Expect = 7e-10
 Identities = 113/479 (23%), Positives = 192/479 (40%), Gaps = 84/479 (17%)

Query: 5   VIIGGGPGGYEAALVAAQLGADVTVIERDGI------GGASVLTDCVPS-KTLIATSVRT 57
           VIIGG   G  A +V     A+V  +E+  I      G   V++  + S + LIA +V+T
Sbjct: 3   VIIGGDAAGSAAQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKT 62

Query: 58  SYVKEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGE 117
              K                         ++A+V+   +   VDT  +       I+  E
Sbjct: 63  FRDKYG-----------------------IDAKVRH--EVTKVDTEKK-------IVYAE 90

Query: 118 ARLVDPHIVAVGDERIRADVVLIATGAHP------RELPTAR-----PDGERILTWRQLY 166
                 H           D +LIATG  P      R+L         PD ERIL   +  
Sbjct: 91  ------HTKTKDVFEFSYDRLLIATGVRPVPEWEGRDLQGVHLLKTIPDAERIL---KTL 141

Query: 167 DLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARR 226
           + N++ +  +           A  +  LG  V  +   D +    D DA  + ++   + 
Sbjct: 142 ETNKVED--VTXXXXXXXXLEAETFVELGKKVR-IERNDHIGTIYDGDAEYIYKEA-DKH 197

Query: 227 GMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDER 286
            + +L N   ++    +    V  TD    +    L++VG+ PNT  L  E   IR + +
Sbjct: 198 HIEILTNENVKAFKGNERVEAVE-TDKGTYKADLVLVSVGVKPNTDFL--EGTNIRTNHK 254

Query: 287 GFVQVDRVSRTSTPGVYAAGDC-TGVNMLASV---------AAMQGRIAMWHALGAAVSP 336
           G ++V+   +T+   VYAAGDC T  +++  +         A  QGR+A  +        
Sbjct: 255 GAIEVNAY-QTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNLDKRRAFK 313

Query: 337 LRLSTVASTVFTHPELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLIC 396
             L T    +  +  LA  G  E +     +  + VK+  +TN      N +  ++KL+ 
Sbjct: 314 GTLGT--GIIKFNLTLARTGLNEKEAKGLHIPYKTVKVD-STNA-GYYPNAKPLYLKLLY 369

Query: 397 RQHTGIVLGGVIVGPRASELILAVSLAVQQRL--TVDDVAHTFA-VYPSLSGSVTEAAR 452
           R  T  +LGG ++G    +  + V  A+  +    ++DV  ++A  Y S+   + +AAR
Sbjct: 370 RSDTKQLLGGQVIGEEGVDKRIDVIAALFNKSIHDLEDVDLSYAPPYNSVWDPIQQAAR 428


>1gv4A [c.3.1 - c.3.1 - d.87.1] PROGRAMED CELL DEATH PROTEIN 8
          Length = 490

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 103 GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 162

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 163 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 222

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 223 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 279

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 280 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 317


>3gd4B [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 435

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 95  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 154

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 155 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 214

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 215 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 271

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 272 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 309


>3gd4A [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 445

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 96  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 155

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 156 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 215

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 216 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 272

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 273 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 310


>3gd3D [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 465

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 96  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 155

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 156 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 215

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 216 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 272

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 273 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 310


>3gd3C [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 467

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 96  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 155

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 156 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 215

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 216 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 272

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 273 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 310


>3gd3B [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 476

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 97  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 156

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 157 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 216

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 217 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 273

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 274 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 311


>3gd3A [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
          Length = 463

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query: 110 GVEIIIGEARL---VDPHIVAVGD-ERIRADVVLIATGAHPRELPTARPDGERILT---- 161
           GV ++ G+  +   V  ++V + D  +I  +  LIATG  PR L      G  + +    
Sbjct: 96  GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTL 155

Query: 162 ------WRQLYDLNELPEKLIVVGSGVTGAEFANAY----QALGSDVTLV----SSRDRV 207
                 +R L  ++   + + V+G G  G+E A A     QA G +V  +     +  ++
Sbjct: 156 FRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKI 215

Query: 208 MPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGM 267
           +P   ++    +E V  R G+ V+ N+  +SV  +   +L++L DGR +E  H +  VG+
Sbjct: 216 LPQYLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL 272

Query: 268 VPNTANLGLEEAGIRLDERGF-VQVDRVSRTSTPGVYAAGD 307
            PN          I  D  GF V  +  +R++   ++ AGD
Sbjct: 273 EPNVELAKTGGLEIDSDFGGFRVNAELQARSN---IWVAGD 310


>3f8pD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 310

 Score = 51.6 bits (122), Expect = 5e-09
 Identities = 57/268 (21%), Positives = 111/268 (41%), Gaps = 24/268 (8%)

Query: 48  KTLIATSVRTSYVKEAATLGINVGN-EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRL 106
           KTL+        + EA  +   +G  E +  D+++V     N  +++      +D   ++
Sbjct: 31  KTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKV----FNKHIEKYEVPVLLDIVEKI 86

Query: 107 RTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATGAHPREL--PTARPDGERILTWRQ 164
              G E ++   R  +           +AD V++  G   R+L  P  +    R +++  
Sbjct: 87  ENRGDEFVVKTKRKGE----------FKADSVILGIGVKRRKLGVPGEQEFAGRGISYCS 136

Query: 165 LYDLNELPEKLI-VVGSGVTGAEFANAYQALGSDVTLVSSRD--RVMPTQDADAARVLED 221
           + D      +++ V+G G +  E A    +  + V L+  RD  +  P       +    
Sbjct: 137 VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNV 196

Query: 222 VFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGI 281
            F     +V+   + + V +      ++  + + +  +   + +G  P T     +  GI
Sbjct: 197 EFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNGI 252

Query: 282 RLDERGFVQVDRVSRTSTPGVYAAGDCT 309
             D  G+++VD   RTS PGV+AAGDCT
Sbjct: 253 ETDTNGYIKVDEWMRTSVPGVFAAGDCT 280


>3ef6A [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--
          Length = 400

 Score = 51.2 bits (121), Expect = 6e-09
 Identities = 48/182 (26%), Positives = 78/182 (42%), Gaps = 11/182 (6%)

Query: 133 IRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPE------KLIVVGSGVTGAE 186
           + AD ++IATG+  R +         ++T R   D+  L +      +L++VG G+ G E
Sbjct: 96  LSADAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQVLRDSWTSATRLLIVGGGLIGCE 155

Query: 187 FANAYQALGSDVTLVSSRDRVM-PTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAG 245
            A   + LG  VT++ + D ++           L  +    G+ V   +     +     
Sbjct: 156 VATTARKLGLSVTILEAGDELLVRVLGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQL 215

Query: 246 VLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAA 305
             V  +DGR       L+ VG  P  A+    +AG+  D RG + VD    T   GV+A 
Sbjct: 216 EQVMASDGRSFVADSALICVGAEP--ADQLARQAGLACD-RGVI-VDHCGATLAKGVFAV 271

Query: 306 GD 307
           GD
Sbjct: 272 GD 273


>1xhcA [c.3.1 - c.3.1 - d.87.1] NADH OXIDASE /NITRITE REDUCTASE
          Length = 346

 Score = 50.4 bits (119), Expect = 1e-08
 Identities = 64/228 (28%), Positives = 103/228 (45%), Gaps = 26/228 (11%)

Query: 107 RTEGVEIIIGE-ARLVDP--HIVAVGDERIRADVVLIATGAHPRELPTARPDGERILTWR 163
           R  G+EI + E A+L+D    +V      +  D +++ATGA  RE P  +   E +LT R
Sbjct: 63  RKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARARE-PQIKGK-EYLLTLR 120

Query: 164 QLYDLNELPEKL-------IVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAA 216
            ++D + + E +                    N  +A G  V L+  R  +    D + +
Sbjct: 121 TIFDADRIKESIENSXXXXXXXXXXXXXXXXXNLAEA-GYHVKLIH-RGAMFLGLDEELS 178

Query: 217 RVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGL 276
            +++D+    G+    NS  E +   + GVL   T+   IEG   +  +G+VPN      
Sbjct: 179 NMIKDMLEETGVKFFLNS--ELLEANEEGVL---TNSGFIEGKVKICAIGIVPNVDLA-- 231

Query: 277 EEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC---TGVNMLASVAAMQ 321
             +GI    RG + +D   RTS   VYA GDC   +G+    + AAM+
Sbjct: 232 RRSGIHTG-RGIL-IDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAME 277


>1yqzA [x.x.x] COENZYME A DISULFIDE REDUCTASE
          Length = 437

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 35/135 (25%), Positives = 57/135 (42%), Gaps = 6/135 (4%)

Query: 173 EKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLG 232
           +K++VVG+G    E        G   TL+   D++    DAD  + + D   +R +    
Sbjct: 148 DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY-- 205

Query: 233 NSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVD 292
             R                 G+V      +  VG  PN+  +  E + I+LD +GF+ V+
Sbjct: 206 --RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSNIKLDRKGFIPVN 261

Query: 293 RVSRTSTPGVYAAGD 307
               T+ P +YA GD
Sbjct: 262 DKFETNVPNIYAIGD 276


>1q1wB [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
          Length = 421

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 54/241 (22%), Positives = 92/241 (38%), Gaps = 35/241 (14%)

Query: 84  LKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATG 143
           L+T +A   +  Q         +  +  ++I+ + R +D             D +++ATG
Sbjct: 62  LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVLATG 109

Query: 144 AHPRELPTARPDGERILTWRQLYDLNELP---------EKLIVVGSGVTGAEFANAYQAL 194
             PR LP A     +   +R L  L +            +L+V+G G  G E A      
Sbjct: 110 GRPRPLPVASGAVGKANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKA 169

Query: 195 GSDVTLVSSRDRVMPTQDADAARVLED-------VFARRGMTVLGNSRAESVTRTDAGVL 247
              VTL+ +  RV+    A       +       V  R G  V G   +    +  A   
Sbjct: 170 NMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGTQVCGFEMSTDQQKVTA--- 226

Query: 248 VRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGD 307
           V   DG  +     +  +G++PN        AG+++D    + ++   +TS P + A GD
Sbjct: 227 VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAGLQVDNG--IVINEHMQTSDPLIMAVGD 282

Query: 308 C 308
           C
Sbjct: 283 C 283


>1q1wA [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
          Length = 422

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 54/241 (22%), Positives = 92/241 (38%), Gaps = 35/241 (14%)

Query: 84  LKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATG 143
           L+T +A   +  Q         +  +  ++I+ + R +D             D +++ATG
Sbjct: 63  LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVLATG 110

Query: 144 AHPRELPTARPDGERILTWRQLYDLNELP---------EKLIVVGSGVTGAEFANAYQAL 194
             PR LP A     +   +R L  L +            +L+V+G G  G E A      
Sbjct: 111 GRPRPLPVASGAVGKANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKA 170

Query: 195 GSDVTLVSSRDRVMPTQDADAARVLED-------VFARRGMTVLGNSRAESVTRTDAGVL 247
              VTL+ +  RV+    A       +       V  R G  V G   +    +  A   
Sbjct: 171 NMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGTQVCGFEMSTDQQKVTA--- 227

Query: 248 VRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGD 307
           V   DG  +     +  +G++PN        AG+++D    + ++   +TS P + A GD
Sbjct: 228 VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAGLQVDNG--IVINEHMQTSDPLIMAVGD 283

Query: 308 C 308
           C
Sbjct: 284 C 284


>1q1rA [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
          Length = 421

 Score = 48.5 bits (114), Expect = 4e-08
 Identities = 54/241 (22%), Positives = 92/241 (38%), Gaps = 35/241 (14%)

Query: 84  LKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATG 143
           L+T +A   +  Q         +  +  ++I+ + R +D             D +++ATG
Sbjct: 63  LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVLATG 110

Query: 144 AHPRELPTARPDGERILTWRQLYDLNELP---------EKLIVVGSGVTGAEFANAYQAL 194
             PR LP A     +   +R L  L +            +L+V+G G  G E A      
Sbjct: 111 GRPRPLPVASGAVGKANNFRYLRTLEDAECIRRQLIADNRLVVIGGGYIGLEVAATAIKA 170

Query: 195 GSDVTLVSSRDRVMPTQDADAARVLED-------VFARRGMTVLGNSRAESVTRTDAGVL 247
              VTL+ +  RV+    A       +       V  R G  V G   +    +  A   
Sbjct: 171 NMHVTLLDTAARVLERVTAPPVSAFYEHLHREAGVDIRTGTQVCGFEMSTDQQKVTA--- 227

Query: 248 VRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGD 307
           V   DG  +     +  +G++PN        AG+++D    + ++   +TS P + A GD
Sbjct: 228 VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAGLQVDNG--IVINEHMQTSDPLIMAVGD 283

Query: 308 C 308
           C
Sbjct: 284 C 284


>3f8rD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 298

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 60/266 (22%), Positives = 107/266 (40%), Gaps = 28/266 (10%)

Query: 48  KTLIATSVRTSYVKEAATLGINVGN-EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRL 106
           KTL+        + EA  +   +G  E +  D+++V     N  +++      +D   ++
Sbjct: 28  KTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKV----FNKHIEKYEVPVLLDIVEKI 83

Query: 107 RTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATGAHPREL--PTARPDGERILTWRQ 164
              G E ++   R  +           +AD V++  G   R+L  P  +    R +++  
Sbjct: 84  ENRGDEFVVKTKRKGE----------FKADSVILGIGVKRRKLGVPGEQEFAGRGISYCS 133

Query: 165 LYDLNELPEKLI-VVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVF 223
           + D      +++ V+G G +  E A    +  + V L+  RD    T  A    V E V 
Sbjct: 134 VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRD----TFKAQPIYV-ETVK 188

Query: 224 ARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRL 283
            +  +  + NS  + +                   +   + +G  P T     +  GI  
Sbjct: 189 KKPNVEFVLNSVVKEIXXXXXXXXXXXXXXXX---NGVFIEIGFDPPTDFA--KSNGIET 243

Query: 284 DERGFVQVDRVSRTSTPGVYAAGDCT 309
           D  G+++VD   RTS PGV+AAGDCT
Sbjct: 244 DTNGYIKVDEWMRTSVPGVFAAGDCT 269


>3f8dD [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 298

 Score = 48.1 bits (113), Expect = 5e-08
 Identities = 60/266 (22%), Positives = 107/266 (40%), Gaps = 28/266 (10%)

Query: 48  KTLIATSVRTSYVKEAATLGINVGN-EPEDKDLVRVELKTVNARVKRLAQAQSVDTANRL 106
           KTL+        + EA  +   +G  E +  D+++V     N  +++      +D   ++
Sbjct: 28  KTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKV----FNKHIEKYEVPVLLDIVEKI 83

Query: 107 RTEGVEIIIGEARLVDPHIVAVGDERIRADVVLIATGAHPREL--PTARPDGERILTWRQ 164
              G E ++   R  +           +AD V++  G   R+L  P  +    R +++  
Sbjct: 84  ENRGDEFVVKTKRKGE----------FKADSVILGIGVKRRKLGVPGEQEFAGRGISYCS 133

Query: 165 LYDLNELPEKLI-VVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVF 223
           + D      +++ V+G G +  E A    +  + V L+  RD    T  A    V E V 
Sbjct: 134 VADAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRD----TFKAQPIYV-ETVK 188

Query: 224 ARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRL 283
            +  +  + NS  + +                   +   + +G  P T     +  GI  
Sbjct: 189 KKPNVEFVLNSVVKEIXXXXXXXXXXXXXXXX---NGVFIEIGFDPPTDFA--KSNGIET 243

Query: 284 DERGFVQVDRVSRTSTPGVYAAGDCT 309
           D  G+++VD   RTS PGV+AAGDCT
Sbjct: 244 DTNGYIKVDEWMRTSVPGVFAAGDCT 269


>3f8rB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 309

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 103 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEI 162

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 163 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 220

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 221 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 278

Query: 309 T 309
           T
Sbjct: 279 T 279


>3f8rA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 308

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 102 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEI 161

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 162 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 219

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 220 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 277

Query: 309 T 309
           T
Sbjct: 278 T 278


>3f8pC [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 308

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 101 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEI 160

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 161 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 218

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 219 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 276

Query: 309 T 309
           T
Sbjct: 277 T 277


>3f8pB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 306

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 100 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEI 159

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 160 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 217

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 218 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 275

Query: 309 T 309
           T
Sbjct: 276 T 276


>3f8pA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 307

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 101 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEI 160

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 161 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 218

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 219 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 276

Query: 309 T 309
           T
Sbjct: 277 T 277


>3f8dC [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 307

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 101 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVADAPLFKNRVVAVIGGGDSALEGAEI 160

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 161 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 218

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 219 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 276

Query: 309 T 309
           T
Sbjct: 277 T 277


>3f8dB [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 309

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 103 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVADAPLFKNRVVAVIGGGDSALEGAEI 162

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 163 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 220

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 221 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 278

Query: 309 T 309
           T
Sbjct: 279 T 279


>3f8dA [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
          Length = 308

 Score = 47.8 bits (112), Expect = 7e-08
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 9/181 (4%)

Query: 134 RADVVLIATGAHPREL--PTARPDGERILTWRQLYDLNELPEKLI-VVGSGVTGAEFANA 190
           +AD V++  G   R+L  P  +    R +++  + D      +++ V+G G +  E A  
Sbjct: 102 KADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVADAPLFKNRVVAVIGGGDSALEGAEI 161

Query: 191 YQALGSDVTLVSSRD--RVMPTQDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLV 248
             +  + V L+  RD  +  P       +     F     +V+   + + V +      +
Sbjct: 162 LSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENL 219

Query: 249 RLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           +  + + +  +   + +G  P T     +  GI  D  G+++VD   RTS PGV+AAGDC
Sbjct: 220 KTGEIKELNVNGVFIEIGFDPPTDFA--KSNGIETDTNGYIKVDEWMRTSVPGVFAAGDC 277

Query: 309 T 309
           T
Sbjct: 278 T 278


>1hyuA [c.47.1 - c.47.1 - c.3.1 - c.3.1] ALKYL HYDROPEROXIDE
           REDUCTASE SUBUNIT F
          Length = 521

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 53/189 (28%), Positives = 86/189 (45%), Gaps = 19/189 (10%)

Query: 133 IRADVVLIATGAHPRELPTARPDGERI--LTWRQLYDLNELPEKLI-VVGSGVTGAEFAN 189
           ++A  ++IATGA  R +     D  R   +T+    D      K + V+G G +G E A 
Sbjct: 313 LKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAI 372

Query: 190 AYQALGSDVTLVSSRDRVMPTQDADAARVLED-VFARRGMTVLGNSRAESVTRTDAGVLV 248
               +   VTL+       P   AD  +VL+D V + + + ++ N++   V    + V+ 
Sbjct: 373 DLAGIVEHVTLLE----FAPEMKAD--QVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVG 426

Query: 249 RLTDGRVIEGSHCL------MTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGV 302
                RV    H +      + +G++PNT  L   E  +  +  G + +D    TS  GV
Sbjct: 427 LEYRDRVSGDIHSVALAGIFVQIGLLPNTHWL---EGALERNRMGEIIIDAKCETSVKGV 483

Query: 303 YAAGDCTGV 311
           +AAGDCT V
Sbjct: 484 FAAGDCTTV 492


>1cl0A [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
          Length = 316

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 52/185 (28%), Positives = 82/185 (44%), Gaps = 17/185 (9%)

Query: 136 DVVLIATGAHPRELPTARPD---GERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQ 192
           D ++IATGA  R L     +   G  +             +K+ V+G G T  E A    
Sbjct: 106 DALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLS 165

Query: 193 ALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRA-ESVTRTDAGVL-VRL 250
            + S+V L+  RD     +     R+++ V    G  +L  +R  E VT    GV  VRL
Sbjct: 166 NIASEVHLIHRRDGFR-AEKILIKRLMDKV--ENGNIILHTNRTLEEVTGDQMGVTGVRL 222

Query: 251 TDGRVIEGSHCLMTVGM---VPNTANLGLEEAGIRLDERGFVQVD-----RVSRTSTPGV 302
            D +  +    L   G+   + ++ N  + E  + L E G+++V        ++TS PGV
Sbjct: 223 RDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLEL-ENGYIKVQSGIHGNATQTSIPGV 281

Query: 303 YAAGD 307
           +AAGD
Sbjct: 282 FAAGD 286


>1tdfA [x.x.x] THIOREDOXIN REDUCTASE
          Length = 316

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 52/185 (28%), Positives = 82/185 (44%), Gaps = 17/185 (9%)

Query: 136 DVVLIATGAHPRELPTARPD---GERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQ 192
           D ++IATGA  R L     +   G  +             +K+ V+G G T  E A    
Sbjct: 106 DALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLS 165

Query: 193 ALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRA-ESVTRTDAGVL-VRL 250
            + S+V L+  RD     +     R+++ V    G  +L  +R  E VT    GV  VRL
Sbjct: 166 NIASEVHLIHRRDGFR-AEKILIKRLMDKV--ENGNIILHTNRTLEEVTGDQMGVTGVRL 222

Query: 251 TDGRVIEGSHCLMTVGM---VPNTANLGLEEAGIRLDERGFVQVD-----RVSRTSTPGV 302
            D +  +    L   G+   + ++ N  + E  + L E G+++V        ++TS PGV
Sbjct: 223 RDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLEL-ENGYIKVQSGIHGNATQTSIPGV 281

Query: 303 YAAGD 307
           +AAGD
Sbjct: 282 FAAGD 286


>1f6mA [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
          Length = 320

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 52/185 (28%), Positives = 82/185 (44%), Gaps = 17/185 (9%)

Query: 136 DVVLIATGAHPRELPTARPD---GERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQ 192
           D ++IATGA  R L     +   G  +             +K+ V+G G T  E A    
Sbjct: 106 DALIIATGASARYLGLPSEEAFKGRGVSASATCDGFFYRNQKVAVIGGGNTAVEEALYLS 165

Query: 193 ALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRA-ESVTRTDAGVL-VRL 250
            + S+V L+  RD     +     R+++ V    G  +L  +R  E VT    GV  VRL
Sbjct: 166 NIASEVHLIHRRDGFR-AEKILIKRLMDKV--ENGNIILHTNRTLEEVTGDQMGVTGVRL 222

Query: 251 TDGRVIEGSHCLMTVGM---VPNTANLGLEEAGIRLDERGFVQVD-----RVSRTSTPGV 302
            D +  +    L   G+   + ++ N  + E  + L E G+++V        ++TS PGV
Sbjct: 223 RDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLEL-ENGYIKVQSGIHGNATQTSIPGV 281

Query: 303 YAAGD 307
           +AAGD
Sbjct: 282 FAAGD 286


>1fl2A [c.3.1 - c.3.1] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
          Length = 310

 Score = 45.8 bits (107), Expect = 2e-07
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 21/190 (11%)

Query: 133 IRADVVLIATGAHPRELPTARPDGERI--LTWRQLYDLNELPEKLI-VVGSGVTGAEFAN 189
           ++A  +++ATGA  R +     D  R   +T+    D      K + V+G G +G E A 
Sbjct: 102 LKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAI 161

Query: 190 AYQALGSDVTLVSSRDRVMPTQDADAARVLEDVF-ARRGMTVLGNSRAESVTRTDAGVLV 248
               +   VTL+       P   AD  +VL+D   + + + ++ N++   V + D   +V
Sbjct: 162 DLAGIVEHVTLLE----FAPEMKAD--QVLQDKLRSLKNVDIILNAQTTEV-KGDGSKVV 214

Query: 249 RLT-------DGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPG 301
            L        D   IE +   + +G++PNT  L   E  +  +  G + +D    T+  G
Sbjct: 215 GLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL---EGAVERNRMGEIIIDAKCETNVKG 271

Query: 302 VYAAGDCTGV 311
           V+AAGDCT V
Sbjct: 272 VFAAGDCTTV 281


>2q7vB [x.x.x] THIOREDOXIN REDUCTASE
          Length = 309

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 75/313 (23%), Positives = 119/313 (38%), Gaps = 48/313 (15%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEA 63
           VVIIGGGP G  AA+   +      ++E+   GG    ++ V                  
Sbjct: 6   VVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVE----------------- 48

Query: 64  ATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVD- 122
                N    PE   +  +EL       +R+ Q Q+     ++  + V+ +  +A     
Sbjct: 49  -----NFPGFPEP--IAGMEL------AQRMHQ-QAEKFGAKVEMDEVQGVQHDATSHPY 94

Query: 123 PHIVAVGDERIRADVVLIATGAHPRELPTARPD---GERILTWRQLYDLNELPEKLIVVG 179
           P  V   +   RA  V++ATGA PR+L     D   G+ + T                  
Sbjct: 95  PFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVSTCATCDGFFYXXXXXXXXX 154

Query: 180 SGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESV 239
                 E          +VT++  RD +   + A A       FA   M  + ++  E +
Sbjct: 155 XXDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQAR-----AFANPKMKFIWDTAVEEI 209

Query: 240 TRTD--AGVLVR-LTDGRVIE--GSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRV 294
              D  +GV +R L  G V E       + +G VPNTA     +  + L + G+V V   
Sbjct: 210 QGADSVSGVKLRNLKTGEVSELATDGVFIFIGHVPNTA---FVKDTVSLRDDGYVDVRDE 266

Query: 295 SRTSTPGVYAAGD 307
             T+ P ++AAGD
Sbjct: 267 IYTNIPMLFAAGD 279


>2q7vA [x.x.x] THIOREDOXIN REDUCTASE
          Length = 313

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 75/313 (23%), Positives = 119/313 (38%), Gaps = 48/313 (15%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEA 63
           VVIIGGGP G  AA+   +      ++E+   GG    ++ V                  
Sbjct: 10  VVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVE----------------- 52

Query: 64  ATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVD- 122
                N    PE   +  +EL       +R+ Q Q+     ++  + V+ +  +A     
Sbjct: 53  -----NFPGFPEP--IAGMEL------AQRMHQ-QAEKFGAKVEMDEVQGVQHDATSHPY 98

Query: 123 PHIVAVGDERIRADVVLIATGAHPRELPTARPD---GERILTWRQLYDLNELPEKLIVVG 179
           P  V   +   RA  V++ATGA PR+L     D   G+ + T                  
Sbjct: 99  PFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVSTCATCDGFFYXXXXXXXXX 158

Query: 180 SGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESV 239
                 E          +VT++  RD +   + A A       FA   M  + ++  E +
Sbjct: 159 XXDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQAR-----AFANPKMKFIWDTAVEEI 213

Query: 240 TRTD--AGVLVR-LTDGRVIE--GSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRV 294
              D  +GV +R L  G V E       + +G VPNTA     +  + L + G+V V   
Sbjct: 214 QGADSVSGVKLRNLKTGEVSELATDGVFIFIGHVPNTA---FVKDTVSLRDDGYVDVRDE 270

Query: 295 SRTSTPGVYAAGD 307
             T+ P ++AAGD
Sbjct: 271 IYTNIPMLFAAGD 283


>2yvjA [x.x.x] FERREDOXIN REDUCTASE
          Length = 402

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 63/214 (29%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 107 RTEGVEIIIG-EARLVDP--HIVAVGDER-IRADVVLIATGAHPRELPTARPDGERILTW 162
           R   VE ++G  A+  DP  H VA+ D R +    +++ATGA PR LPT +     + T 
Sbjct: 66  RAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTL 125

Query: 163 RQLYDLNEL------PEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAA 216
           R L D   +        +             A   +  G  V+LV ++ R+M      A 
Sbjct: 126 RTLEDARRIQAGLRPQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM---SRAAP 182

Query: 217 RVLEDVFARRGMTVLGNSRAE-SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLG 275
             L D  AR       + R E SVT +  GV V L DG  I     ++ VG+        
Sbjct: 183 ATLADFVARYHAAQGVDLRFERSVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXX 239

Query: 276 LEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT 309
                       F  VD   RT+ P VYA GD T
Sbjct: 240 XXXXXXXXXXXIF--VDAYGRTTCPDVYALGDVT 271


>2gr3A [x.x.x] FERREDOXIN REDUCTASE
          Length = 402

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 63/214 (29%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 107 RTEGVEIIIG-EARLVDP--HIVAVGDER-IRADVVLIATGAHPRELPTARPDGERILTW 162
           R   VE ++G  A+  DP  H VA+ D R +    +++ATGA PR LPT +     + T 
Sbjct: 66  RAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTL 125

Query: 163 RQLYDLNEL------PEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAA 216
           R L D   +        +             A   +  G  V+LV ++ R+M      A 
Sbjct: 126 RTLEDARRIQAGLRPQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM---SRAAP 182

Query: 217 RVLEDVFARRGMTVLGNSRAE-SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLG 275
             L D  AR       + R E SVT +  GV V L DG  I     ++ VG+        
Sbjct: 183 ATLADFVARYHAAQGVDLRFERSVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXX 239

Query: 276 LEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT 309
                       F  VD   RT+ P VYA GD T
Sbjct: 240 XXXXXXXXXXXIF--VDAYGRTTCPDVYALGDVT 271


>2gqwA [x.x.x] FERREDOXIN REDUCTASE
          Length = 401

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 63/214 (29%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 107 RTEGVEIIIG-EARLVDP--HIVAVGDER-IRADVVLIATGAHPRELPTARPDGERILTW 162
           R   VE ++G  A+  DP  H VA+ D R +    +++ATGA PR LPT +     + T 
Sbjct: 65  RAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTL 124

Query: 163 RQLYDLNEL------PEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAA 216
           R L D   +        +             A   +  G  V+LV ++ R+M      A 
Sbjct: 125 RTLEDARRIQAGLRPQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM---SRAAP 181

Query: 217 RVLEDVFARRGMTVLGNSRAE-SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLG 275
             L D  AR       + R E SVT +  GV V L DG  I     ++ VG+        
Sbjct: 182 ATLADFVARYHAAQGVDLRFERSVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXX 238

Query: 276 LEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT 309
                       F  VD   RT+ P VYA GD T
Sbjct: 239 XXXXXXXXXXXIF--VDAYGRTTCPDVYALGDVT 270


>1d7yA [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
          Length = 401

 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 63/214 (29%), Positives = 86/214 (40%), Gaps = 19/214 (8%)

Query: 107 RTEGVEIIIG-EARLVDP--HIVAVGDER-IRADVVLIATGAHPRELPTARPDGERILTW 162
           R   VE ++G  A+  DP  H VA+ D R +    +++ATGA PR LPT +     + T 
Sbjct: 66  RAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQGATMPVHTL 125

Query: 163 RQLYDLNEL------PEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAA 216
           R L D   +        +             A   +  G  V+LV ++ R+M      A 
Sbjct: 126 RTLEDARRIQAGLRPQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM---SRAAP 182

Query: 217 RVLEDVFARRGMTVLGNSRAE-SVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLG 275
             L D  AR       + R E SVT +  GV V L DG  I     ++ VG+        
Sbjct: 183 ATLADFVARYHAAQGVDLRFERSVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXX 239

Query: 276 LEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDCT 309
                       F  VD   RT+ P VYA GD T
Sbjct: 240 XXXXXXXXXXXIF--VDAYGRTTCPDVYALGDVT 271


>1vdcA [x.x.x] NADPH DEPENDENT THIOREDOXIN REDUCTASE
          Length = 322

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 41/143 (28%), Positives = 63/143 (44%), Gaps = 19/143 (13%)

Query: 175 LIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLED-VFARRGMTVLGN 233
           L V+G G +  E AN     GS V ++  RD         A+++++    +   + V+ N
Sbjct: 159 LAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFR------ASKIMQQRALSNPKIDVIWN 212

Query: 234 SRA-ESVTRTDAGVLVRLTDGRVIEG-------SHCLMTVGMVPNTANLGLEEAGIRLDE 285
           S   E+    +  VL  L    V+ G       S     +G  P T  L   + G+ LD 
Sbjct: 213 SSVVEAYGDGERDVLGGLKVKNVVTGDVSDLKVSGLFFAIGHEPATKFL---DGGVELDS 269

Query: 286 RGFVQVDR-VSRTSTPGVYAAGD 307
            G+V      ++TS PGV+AAGD
Sbjct: 270 DGYVVTKPGTTQTSVPGVFAAGD 292


>3fg2P [x.x.x] PUTATIVE RUBREDOXIN REDUCTASE
          Length = 404

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 45/179 (25%), Positives = 69/179 (38%), Gaps = 12/179 (6%)

Query: 138 VLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKL------IVVGSGVTGAEFANAY 191
           +++ATGA  R L         +L  R L +   L +++      +V+G+G  G EFA   
Sbjct: 102 LVLATGARNRMLDVPNASLPDVLYLRTLDESEVLRQRMPDKKHVVVIGAGFIGLEFAATA 161

Query: 192 QALGSDVTLVSSRDRVMP-TQDADAARVLEDVFARRGMTVLGNSRA-ESVTRTDAGVLVR 249
           +A G +V +V    RVM      + +    D  +  G+ +    RA E     D    V 
Sbjct: 162 RAKGLEVDVVELAPRVMARVVTPEISSYFHDRHSGAGIRMHYGVRATEIAAEGDRVTGVV 221

Query: 250 LTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTPGVYAAGDC 308
           L+DG  +           +PN                    VD+   TS P + A GDC
Sbjct: 222 LSDGNTLPCDLXXXXXXXIPNVE----XXXXXXXXXXXXXXVDQQLLTSDPHISAIGDC 276


>2i0zA [x.x.x] NAD(FAD)-UTILIZING DEHYDROGENASES
          Length = 416

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 14/29 (48%), Positives = 23/29 (79%)

Query: 4  VVIIGGGPGGYEAALVAAQLGADVTVIER 32
          V++IGGGP G  AA+ AA+ GA+V ++++
Sbjct: 5  VIVIGGGPSGLMAAIGAAEEGANVLLLDK 33


>2vhyB [x.x.x] ALANINE DEHYDROGENASE
          Length = 330

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhyA [x.x.x] ALANINE DEHYDROGENASE
          Length = 324

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhxD [x.x.x] ALANINE DEHYDROGENASE
          Length = 367

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhxC [x.x.x] ALANINE DEHYDROGENASE
          Length = 365

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhxB [x.x.x] ALANINE DEHYDROGENASE
          Length = 368

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhxA [x.x.x] ALANINE DEHYDROGENASE
          Length = 368

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhwE [x.x.x] ALANINE DEHYDROGENASE
          Length = 373

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhwB [x.x.x] ALANINE DEHYDROGENASE
          Length = 370

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhwA [x.x.x] ALANINE DEHYDROGENASE
          Length = 371

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>2vhvA [x.x.x] ALANINE DEHYDROGENASE
          Length = 371

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 4   VVIIGGGPGGYEAALVAAQLGADVTVIE 31
           VV+IG G  GY AA +A  +GA VTV++
Sbjct: 171 VVVIGAGTAGYNAARIANGMGATVTVLD 198


>3d8xA [x.x.x] THIOREDOXIN REDUCTASE 1
          Length = 318

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 44/188 (23%), Positives = 79/188 (42%), Gaps = 18/188 (9%)

Query: 131 ERIRADVVLIATGAHPRE--LPTARPDGERILTWRQLYDLNELP----EKLIVVGSGVTG 184
           E +  D +++ATGA  +   LP      ++ ++   + D   +P    + L V+G G + 
Sbjct: 107 EPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCD-GAVPIFRNKPLAVIGGGDSA 165

Query: 185 AEFANAYQALGSDVTLVSSRDRVMPT----QDADAARVLEDVFARRGMTVLGNSRAESVT 240
            E A      GS V ++  +D +  +    + A+    +E ++    +   G+ +  +  
Sbjct: 166 CEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNAL 225

Query: 241 RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQ-VDRVSRTST 299
           R         TD  V   S     +G  P T    +    +  DE G+++ V   S TS 
Sbjct: 226 RIKNTKKNEETDLPV---SGLFYAIGHTPATK---IVAGQVDTDEAGYIKTVPGSSLTSV 279

Query: 300 PGVYAAGD 307
           PG +AAGD
Sbjct: 280 PGFFAAGD 287


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 961,527,505
Number of extensions: 37689905
Number of successful extensions: 96391
Number of sequences better than 1.0e-03: 2785
Number of HSP's gapped: 93031
Number of HSP's successfully gapped: 3019
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)