BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ54145.1 tfus0 AAZ54145.1 GIB00263CH01 "conserved
hypothetical protein"
         (306 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKUE_BACSU RecName: Full=Uncharacterized metallophosphoesterase ...    72   6e-15
YAEI_ECOLI RecName: Full=Phosphodiesterase yaeI;         EC=3.1....    66   4e-13
YPBG_BACSU RecName: Full=Uncharacterized protein ypbG;Flags: Pre...    58   1e-10
Y461_CHLTR RecName: Full=Uncharacterized metallophosphoesterase ...    53   4e-09
TMPPE_BOVIN RecName: Full=Transmembrane protein with metallophos...    51   2e-08
Y2345_DEIRA RecName: Full=Uncharacterized metallophosphoesterase...    43   3e-06
TMPPE_HUMAN RecName: Full=Transmembrane protein with metallophos...    40   2e-05
YKOQ_BACSU RecName: Full=Uncharacterized metallophosphoesterase ...    40   3e-05
YQZ2_CAEEL RecName: Full=Putative metallophosphoesterase F40B5.2...    39   6e-05
Y746_CHLMU RecName: Full=Uncharacterized metallophosphoesterase ...    37   2e-04
YA44_HELPJ RecName: Full=Uncharacterized metallophosphoesterase ...    36   4e-04

>YKUE_BACSU RecName: Full=Uncharacterized metallophosphoesterase
           ykuE;Flags: Precursor;
          Length = 286

 Score = 72.0 bits (175), Expect = 6e-15
 Identities = 75/265 (28%), Positives = 116/265 (43%), Gaps = 41/265 (15%)

Query: 47  ILAPGSDRLRILHLSDAHLTPGRRL--LIDWIRSLDAHNPDLVVNTGDSLAHP------Q 98
           ++  G D  +I+  SDAHL+    L  L   I +++   PDL+V TGD + +P      Q
Sbjct: 50  LIPHGFDGFKIVQFSDAHLSDYFTLEDLKTVILTINESKPDLIVFTGDIIDNPDTYQHHQ 109

Query: 99  AVKPFLDALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELG 158
           AV P L  L     +  L +YG++D                  A Y+             
Sbjct: 110 AVIPLLRKLNAPFGK--LCIYGNHDHGG------------YGTAVYK------------- 142

Query: 159 AAMREAGWLDLNNQKGHLT-AGNLRIAAAGIHDSHIGLDRYEKIAGPADPTADVRIGVMH 217
           + M   G+    N    L+ A   +I  A + D  +G   YE   G     +D    ++ 
Sbjct: 143 SLMTAGGFTVYRNGYQTLSLADGSKIEIASLDDLMLGNPDYE---GTLSRLSDRLFSILL 199

Query: 218 SPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHV 277
             EP    + T     L L+GHTHGGQI LPFYG ++T     +    G+ + G++ ++V
Sbjct: 200 VHEPDAALKTTDYPVNLQLSGHTHGGQIQLPFYGPIITP-PYGKVYTEGMYQTGSTHIYV 258

Query: 278 SGGLGTSPYAPVRFCCRPEAALLDL 302
           + GLG +   P+RF  +PE  +  L
Sbjct: 259 NRGLGMT-RLPLRFLAKPEITVFTL 282


>YAEI_ECOLI RecName: Full=Phosphodiesterase yaeI;       
           EC=3.1.4.-;
          Length = 270

 Score = 66.2 bits (160), Expect = 4e-13
 Identities = 69/275 (25%), Positives = 113/275 (41%), Gaps = 37/275 (13%)

Query: 34  ERNWFRLRHYEIPILAPGSDRLRILHLSDAHLTP--GRRLLIDWIRSLDAHNPDLVVNTG 91
           E  WF L  + +      +   +IL L+D H +      L+ D I       PDL++  G
Sbjct: 28  EPGWFELIRHRLAFFKDNAAPFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGG 87

Query: 92  DSLAHPQAVK--PFLDALGPLLD-RPGLFVYGSNDLFSPQPKNPARYLWRSSKADYRKRK 148
           D +    ++    F D L PL +  P    +G++D      KN                 
Sbjct: 88  DYVLFDMSLNFSAFSDVLSPLAECAPTFACFGNHDRPVGTEKNHL--------------- 132

Query: 149 IPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPT 208
                   +G  ++ AG   L NQ   +   N +    G  D   G  +      PA   
Sbjct: 133 --------IGETLKSAGITVLFNQATVIATPNRQFELVGTGDLWAGQCK----PPPASEA 180

Query: 209 ADVRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLS 268
              R+ + H+P+ + + R   + ++L+L GHTHGGQ+ +P  G        D+    GL+
Sbjct: 181 NLPRLVLAHNPDSKEVMR--DEPWDLMLCGHTHGGQLRVPLVGEPFAPVE-DKRYVAGLN 237

Query: 269 RNGTSWLHVSGGLGTSPYAPVRFCCRPEAALLDLI 303
             G   ++ + G+G S Y  +R  CRPE  +L+L+
Sbjct: 238 AFGERHIYTTRGVG-SLYG-LRLNCRPEVTMLELV 270


>YPBG_BACSU RecName: Full=Uncharacterized protein ypbG;Flags:
           Precursor;
          Length = 259

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 67/250 (26%), Positives = 103/250 (41%), Gaps = 37/250 (14%)

Query: 51  GSDRLRILHLSDAHLTPGRRLLI-DWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGP 109
           G   L I  +SD H    +RL+  D +    +H P LV+  GD            + +  
Sbjct: 43  GKPPLTIFFISDIH----KRLIDQDLLEKARSHAPHLVIIGGDLAEGGVPSARIEENIKR 98

Query: 110 LLDR--PGLFVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMREAGWL 167
           L+    P +FV+G+ND                    Y  R+       +L +  +  G +
Sbjct: 99  LVHFGVPIVFVWGNND--------------------YEVRQ------HKLYSIFKAHGVI 132

Query: 168 DLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTADVRIGVMHSPEPRNLDRF 227
            L N+    +     IA AG+ D  + +D YE+     D +  + I V H+PE       
Sbjct: 133 TLRNESVPFSYNGHTIAIAGVDDIRMEMDHYEEAIKELDES-QLNILVCHNPEIHEQIN- 190

Query: 228 TADGYELLLAGHTHGGQICLPFYGTL-VTNCGIDRARAWGLSRNGTSWLHVSGGLGTSPY 286
             DG +++L+GHTHGGQI    +G   +   GI +  A+ +S NG     V   LG  P 
Sbjct: 191 EDDGIDVILSGHTHGGQIRFGKFGPYELGKTGIVKNAAYLIS-NGYGTTKVPLRLGAEPE 249

Query: 287 APVRFCCRPE 296
             +   C PE
Sbjct: 250 THIVTLCGPE 259


>Y461_CHLTR RecName: Full=Uncharacterized metallophosphoesterase
           CT_461;         EC=3.1.-.-;Flags: Precursor;
          Length = 329

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 74/281 (26%), Positives = 121/281 (43%), Gaps = 44/281 (15%)

Query: 55  LRILHLSDAHL---TPGRRLLIDWIRSLDAHNPDLVVNTGDSLAH-----PQAVKPFLDA 106
           LRI+ +SD HL   TP    L    R + + +PD++V TGD +       P+ +K FL +
Sbjct: 52  LRIVQISDLHLNHSTPDA-FLKKVSRKISSLSPDILVFTGDFVCRAKVETPERLKHFLCS 110

Query: 107 L-GPL-----LDRPGLFVYGSNDL---------FSPQPKNPA-----RYLWRSSKADYRK 146
           L  PL     L       Y S D+          + +P   A     + L+ SS+ ++  
Sbjct: 111 LHAPLGCFACLGNHDYATYVSRDIHGKINTISAMNSRPLKRAFTSVYQSLFASSRNEFAD 170

Query: 147 RKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPAD 206
              P +P   L + +R   +  L+NQ   L+     I   G+ D        +K     +
Sbjct: 171 TLNPQIPNPHLVSILRNTPFQLLHNQSATLSD---TINIVGLGDFFAKQFDPKKAFTDYN 227

Query: 207 PTADVRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPF--YGTLVTN--CGIDR- 261
           PT     G++ S  P  +        +++ +GH+HG QI LP+  +   +TN   G++  
Sbjct: 228 PTLP---GIILSHNPDTIHHLQDYPGDVVFSGHSHGPQISLPWPKFANTITNKLSGLENP 284

Query: 262 --ARAWGLSRNGTSWLHVSGGLGTSPYAPVRFCCRPEAALL 300
             AR        +  L+V+ GLG   +  +RFC  PE  L+
Sbjct: 285 ELARGLFSFPEESRLLYVNRGLG--GWKRIRFCSPPEICLM 323


>TMPPE_BOVIN RecName: Full=Transmembrane protein with
           metallophosphoesterase domain;         EC=3.1.-.-;
          Length = 444

 Score = 50.8 bits (120), Expect = 2e-08
 Identities = 57/210 (27%), Positives = 89/210 (42%), Gaps = 23/210 (10%)

Query: 44  EIPI--LAPGSDRLRILHLSDAHLTP--GRRLLIDWIRSLDAHNPDLVVNTGDSL-AHPQ 98
           E+P+  L P  + L+I+ LSD HL P  GR  +  ++R ++   PD+ V  GD   +   
Sbjct: 194 EVPVHRLPPSMNSLKIVLLSDIHLGPTVGRTKMDMFVRMVNTLEPDVTVIVGDLCDSEAS 253

Query: 99  AVKPFLDALGPLLDRPGL-FVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWREL 157
            ++  +  LG L  R G  FV G+++ ++    N    L   +        +        
Sbjct: 254 VLRTAVAPLGQLRSRLGTYFVTGNHEYYTSDVSNWFALLMSLNVQPLHNENVRI---SAT 310

Query: 158 GAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAG--PADPTADVRIGV 215
           GA   +  W+ L        AG   I A  +H +  G+D  + + G  P  PT    I +
Sbjct: 311 GAHREDDDWICL--------AGVDDIEANILHYTGHGMDLEKALEGCSPDHPT----ILL 358

Query: 216 MHSPEPRNLDRFTADGYELLLAGHTHGGQI 245
            H P              L+L+GHTH GQI
Sbjct: 359 AHQPLAAKRALQARPDINLILSGHTHAGQI 388


>Y2345_DEIRA RecName: Full=Uncharacterized metallophosphoesterase
           DR_2345;Flags: Precursor;
          Length = 305

 Score = 43.1 bits (100), Expect = 3e-06
 Identities = 27/63 (42%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 234 LLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGGLGTSPYAPVRFCC 293
           L+L+GHTHGGQ+ LP  G L           W     G    +VS GLG S   PVR  C
Sbjct: 234 LVLSGHTHGGQVRLPLLGALKVPADPRFTMGWVRGPQGIP-AYVSRGLGMSG-LPVRNLC 291

Query: 294 RPE 296
            PE
Sbjct: 292 EPE 294


>TMPPE_HUMAN RecName: Full=Transmembrane protein with
           metallophosphoesterase domain;         EC=3.1.-.-;
          Length = 453

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 55/214 (25%), Positives = 85/214 (39%), Gaps = 22/214 (10%)

Query: 44  EIPI--LAPGSDRLRILHLSDAHLTP--GRRLLIDWIRSLDAHNPDLVVNTGD-SLAHPQ 98
           E+PI  L    + L+I+ LSD HL P  GR  +  ++R ++   PD+ V  GD S +   
Sbjct: 194 EVPIHQLPASMNNLKIVLLSDIHLGPTVGRTKMEMFVRMVNVLEPDITVIVGDLSDSEAS 253

Query: 99  AVKPFLDALGPLLDRPG-LFVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWR-- 155
            ++  +  LG L    G  FV G+++ ++    N    L            +     R  
Sbjct: 254 VLRTAVAPLGQLHSHLGAYFVTGNHEYYTSDVSNWFALLESLHVQPLHNENVKISATRAQ 313

Query: 156 ----ELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTADV 211
                      +  W+ L        AG   I A  +H S  G+D  + + G   P   +
Sbjct: 314 RXXXXXXXXXEDEDWICL--------AGVDDIEADILHYSGHGMDLDKALEG-CSPDHTI 364

Query: 212 RIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQI 245
            I + H P              L+L+GHTH GQI
Sbjct: 365 -ILLAHQPLAAKRALQARPDINLILSGHTHAGQI 397


>YKOQ_BACSU RecName: Full=Uncharacterized metallophosphoesterase
           ykoQ;         EC=3.1.-.-;
          Length = 270

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 67/259 (25%), Positives = 105/259 (40%), Gaps = 47/259 (18%)

Query: 50  PGSDRLRILHLSDAHLTPGRRLLIDWIRSLDAHNP-DLVVNTGDSLAHPQAVKP---FLD 105
           P   +L ILHLSD HL     +  + +  L    P D++  TGD L   + +     +L+
Sbjct: 41  PARKKLNILHLSDLHLE-NISVSPEELYHLTKDQPVDIIALTGDFLDRKRNIPKLAGYLN 99

Query: 106 ALGPLLDRPGLF-VYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMREA 164
           AL  L    G++ V+G++D                         + +  ++ L   + E 
Sbjct: 100 ALQKLKPAYGMYAVFGNHDYV-----------------------LKEEDFQRLKRVLEEN 136

Query: 165 GWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYE----KIAGPADPTAD-VRIGVMHSP 219
           G + L N+       ++RI  A    + IG+D Y      I G      +   + + H P
Sbjct: 137 GCITLQNE-------HVRIETAAGPVNIIGIDDYSTNRSNITGSYQSLENGYHLVLTHDP 189

Query: 220 EPRNLDRFTAD-GYELLLAGHTHGGQICLPFYGTLVTNCGIDRAR-AWGLSRNGTSWLHV 277
              N+     D  Y+ LL+GH HGGQI  P    LV    + R     GL  +     ++
Sbjct: 190 ---NIILDMKDVHYDYLLSGHFHGGQIHWPKPYHLVKMGKLVRMNMIKGLHYHHDKPFYI 246

Query: 278 SGGLGTSPYAPVRFCCRPE 296
           S GLG +    +R   RPE
Sbjct: 247 SEGLGQTG-VNIRVGSRPE 264


>YQZ2_CAEEL RecName: Full=Putative metallophosphoesterase F40B5.2;  
                 EC=3.1.-.-;
          Length = 482

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 47/207 (22%), Positives = 76/207 (36%), Gaps = 38/207 (18%)

Query: 52  SDRLRILHLSDAHLTP--GRRLLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGP 109
           S  + I  LSD H+ P  GR  +   +   +A  PD++   GD       V+ F  A  P
Sbjct: 246 SGNVSIALLSDVHIGPSVGRTRIAKIVELTNALKPDIIAIAGDLA--DGLVRDFHGAAEP 303

Query: 110 LLDRPGLFVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMREAGWLDL 169
           L +                 K P    + +   +Y    + +  W      +       L
Sbjct: 304 LCNL----------------KAPGGVYFATGNHEYMHGNVTEWFW-----FLENCNITVL 342

Query: 170 NNQKGHLTAGNLRIAAAGIHDSHI--------GLDRYEKIAGPADPTADVRIGVMHSPEP 221
           +N   H+T    ++  AG  D +         G+D   K  G  +  +   I + H P  
Sbjct: 343 HNLNKHITVNGQKLCVAGADDLYALRSNVPGHGMD-LRKALGTCNSDS-TNILLAHQPNA 400

Query: 222 RNL---DRFTADGYELLLAGHTHGGQI 245
             +   D   +    L+L+GHTHGGQ+
Sbjct: 401 AKIVLSDSELSKKVNLILSGHTHGGQM 427


>Y746_CHLMU RecName: Full=Uncharacterized metallophosphoesterase
           TC_0746;         EC=3.1.-.-;Flags: Precursor;
          Length = 329

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 68/280 (24%), Positives = 116/280 (41%), Gaps = 42/280 (15%)

Query: 55  LRILHLSDAHLTPGR--RLLIDWIRSLDAHNPDLVVNTGDSLAHPQA-----VKPFLDAL 107
           LRI+ +SD HL        L    R + + +PD++V TGD +   +      +K FL +L
Sbjct: 52  LRIVQISDLHLNQSTPDAFLKKISRKVSSLSPDMLVFTGDFICRAKVESSNKLKNFLCSL 111

Query: 108 G-PL-----LDRPGLFVYGSNDLF---------SPQPKNPA-----RYLWRSSKADYRKR 147
             PL     L       Y S D+          S +P   A     + L+ SS  ++ + 
Sbjct: 112 NAPLGCFACLGNHDYATYVSRDIHGKINTIPETSSRPLRRALTSVYQSLFSSSHNEFAEE 171

Query: 148 KIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADP 207
             P  P   L + +    +  L+NQ   +T  ++ +   G+ D        +K     +P
Sbjct: 172 FTPQDPNPHLLSILHNTPFQLLHNQS--VTLSDV-VNIVGLGDFFAKQFDPKKAFTNYNP 228

Query: 208 TADVRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPF--YGTLVTN--CGIDR-- 261
           T     G++ S  P  +        +++ +GH+HG QI LP+  +   +TN   G++   
Sbjct: 229 TLP---GIILSHNPDTIHYLKDYPGDVVFSGHSHGPQISLPWPKFANTITNKLSGLENPE 285

Query: 262 -ARAWGLSRNGTSWLHVSGGLGTSPYAPVRFCCRPEAALL 300
            AR           L+V+ GLG   +  +RF   PE  ++
Sbjct: 286 LARGLFSFPQEKRLLYVNRGLG--GWKRIRFFSPPEICIM 323


>YA44_HELPJ RecName: Full=Uncharacterized metallophosphoesterase
           jhp_0380;         EC=3.1.-.-;
          Length = 370

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 233 ELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGL-SRNGTSWLHVSGGLGTSPYAPVRF 291
           +L+L+GHTH GQI  PF   LV    + +    GL   +GT+ ++VS G G     P+RF
Sbjct: 300 DLVLSGHTHAGQI-FPF-SLLVK---LAQTYLHGLYKHSGTTQIYVSSGAGYWG-IPLRF 353

Query: 292 CCRPEAALLDLIPR 305
               E A L L+P+
Sbjct: 354 LAPSEIAYLRLLPK 367


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.315    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,100,376,493
Number of extensions: 313574898
Number of successful extensions: 722977
Number of sequences better than 1.0e-03: 13370
Number of HSP's gapped: 711989
Number of HSP's successfully gapped: 15134
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)