BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ55991.1 tfus0 AAZ55991.1 GIB00263CH01 "conserved
hypothetical protein"
         (252 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CBIZ_METMA RecName: Full=Adenosylcobinamide amidohydrolase;     ...    75   6e-16

>CBIZ_METMA RecName: Full=Adenosylcobinamide amidohydrolase;        
           Short=AdoCbi hydrolase;         EC=3.5.1.90;
          Length = 200

 Score = 75.1 bits (183), Expect = 6e-16
 Identities = 50/150 (33%), Positives = 71/150 (47%), Gaps = 14/150 (9%)

Query: 40  AASSVLGGGLGPRDYVINAQVDGDYRRTDPDNHLEELATHFGMTGTGVGLLTAANVSEAC 99
           A S+ L GG    +Y+ N QV   +    P+  + E A   G+    +GLLTA N+    
Sbjct: 18  AVSTGLNGGRARVEYIFNKQVPRTFNPPSPEEFIREEARKDGIETASLGLLTAVNMEYLQ 77

Query: 100 FADDHGVEVLATVGLGRPTWAAADPALDEARLPGEETRPGTINIVVAVPAPMSDTALVNL 159
             +D  +    T G+   +   A              + GTINI++   A +S+TAL   
Sbjct: 78  VIEDDYMTAFITAGVSNCSEFRA--------------KAGTINIILVSKARLSETALFGA 123

Query: 160 VATATEAKVQALFDSGYACTGTASDAVCVA 189
           + TATEAK  AL + GY   GT +DAV VA
Sbjct: 124 IITATEAKGLALLEKGYNFLGTNTDAVIVA 153


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.320    0.140    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,300,469,392
Number of extensions: 366527870
Number of successful extensions: 862610
Number of sequences better than 1.0e-03: 16505
Number of HSP's gapped: 841524
Number of HSP's successfully gapped: 20433
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)