BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ56054.1 tfus0 AAZ56054.1 GIB00263CH01 "Excinuclease ABC
subunit C"
         (656 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UVRC_THEFY RecName: Full=UvrABC system protein C;         Short=...  1216   0.0  
UVRC_BEUC1 RecName: Full=UvrABC system protein C;         Short=...   791   0.0  
UVRC_STRAW RecName: Full=UvrABC system protein C;         Short=...   751   0.0  
UVRC_RENSM RecName: Full=UvrABC system protein C;         Short=...   744   0.0  
UVRC_ARTCA RecName: Full=UvrABC system protein C;         Short=...   734   0.0  
UVRC_STRCO RecName: Full=UvrABC system protein C;         Short=...   733   0.0  
UVRC_NOCFA RecName: Full=UvrABC system protein C;         Short=...   732   0.0  
UVRC_MYCPA RecName: Full=UvrABC system protein C;         Short=...   728   0.0  
UVRC_FRASN RecName: Full=UvrABC system protein C;         Short=...   721   0.0  
UVRC_MYCTU RecName: Full=UvrABC system protein C;         Short=...   716   0.0  
UVRC_MYCTA RecName: Full=UvrABC system protein C;         Short=...   716   0.0  
UVRC_MYCBT RecName: Full=UvrABC system protein C;         Short=...   716   0.0  
UVRC_MYCBP RecName: Full=UvrABC system protein C;         Short=...   716   0.0  
UVRC_MYCBO RecName: Full=UvrABC system protein C;         Short=...   716   0.0  
UVRC_PROAC RecName: Full=UvrABC system protein C;         Short=...   709   0.0  
UVRC_SALTO RecName: Full=UvrABC system protein C;         Short=...   706   0.0  
UVRC_ACIC1 RecName: Full=UvrABC system protein C;         Short=...   706   0.0  
UVRC_SALAI RecName: Full=UvrABC system protein C;         Short=...   704   0.0  
UVRC_FRASC RecName: Full=UvrABC system protein C;         Short=...   702   0.0  
UVRC_COREF RecName: Full=UvrABC system protein C;         Short=...   702   0.0  
UVRC_MYCA9 RecName: Full=UvrABC system protein C;         Short=...   701   0.0  
UVRC_MYCLE RecName: Full=UvrABC system protein C;         Short=...   699   0.0  
UVRC_MYCLB RecName: Full=UvrABC system protein C;         Short=...   699   0.0  
UVRC_MYCMM RecName: Full=UvrABC system protein C;         Short=...   696   0.0  
UVRC_ARTAT RecName: Full=UvrABC system protein C;         Short=...   694   0.0  
UVRC_MYCGI RecName: Full=UvrABC system protein C;         Short=...   692   0.0  
UVRC_ARTS2 RecName: Full=UvrABC system protein C;         Short=...   692   0.0  
UVRC_RHOE4 RecName: Full=UvrABC system protein C;         Short=...   690   0.0  
UVRC_MYCSS RecName: Full=UvrABC system protein C;         Short=...   685   0.0  
UVRC_MYCSK RecName: Full=UvrABC system protein C;         Short=...   685   0.0  
UVRC_MYCSJ RecName: Full=UvrABC system protein C;         Short=...   685   0.0  
UVRC_SACEN RecName: Full=UvrABC system protein C;         Short=...   684   0.0  
UVRC_KOCRD RecName: Full=UvrABC system protein C;         Short=...   679   0.0  
UVRC_CORJK RecName: Full=UvrABC system protein C;         Short=...   679   0.0  
UVRC_RHOSR RecName: Full=UvrABC system protein C;         Short=...   678   0.0  
UVRC_RHOOB RecName: Full=UvrABC system protein C;         Short=...   669   0.0  
UVRC_MYCVP RecName: Full=UvrABC system protein C;         Short=...   669   0.0  
UVRC_CORDI RecName: Full=UvrABC system protein C;         Short=...   656   0.0  
UVRC_MYCS2 RecName: Full=UvrABC system protein C;         Short=...   647   0.0  
UVRC_CORA7 RecName: Full=UvrABC system protein C;         Short=...   637   0.0  
UVRC_CORGB RecName: Full=UvrABC system protein C;         Short=...   625   0.0  
UVRC_CORGL RecName: Full=UvrABC system protein C;         Short=...   624   0.0  
UVRC_LEIXX RecName: Full=UvrABC system protein C;         Short=...   614   e-178
UVRC_BIFLO RecName: Full=UvrABC system protein C;         Short=...   548   e-158
UVRC_BIFLD RecName: Full=UvrABC system protein C;         Short=...   548   e-158
UVRC_STRGG RecName: Full=UvrABC system protein C;         Short=...   530   e-152
UVRC_SYMTH RecName: Full=UvrABC system protein C;         Short=...   441   e-125
UVRC_ALKOO RecName: Full=UvrABC system protein C;         Short=...   412   e-117
UVRC_DEHE1 RecName: Full=UvrABC system protein C;         Short=...   403   e-114
UVRC_CARHZ RecName: Full=UvrABC system protein C;         Short=...   396   e-112
UVRC_CLOAB RecName: Full=UvrABC system protein C;         Short=...   394   e-112
UVRC_CLOTE RecName: Full=UvrABC system protein C;         Short=...   392   e-111
UVRC_DEHSC RecName: Full=UvrABC system protein C;         Short=...   392   e-111
UVRC_DEHSB RecName: Full=UvrABC system protein C;         Short=...   392   e-111
UVRC_ALKMQ RecName: Full=UvrABC system protein C;         Short=...   392   e-111
UVRC_CLOTH RecName: Full=UvrABC system protein C;         Short=...   391   e-111
UVRC_TROW8 RecName: Full=UvrABC system protein C;         Short=...   390   e-110
UVRC_TROWT RecName: Full=UvrABC system protein C;         Short=...   389   e-110
UVRC_EUBE2 RecName: Full=UvrABC system protein C;         Short=...   388   e-110
UVRC_CLOPS RecName: Full=UvrABC system protein C;         Short=...   387   e-109
UVRC_MOOTA RecName: Full=UvrABC system protein C;         Short=...   386   e-109
UVRC_CLOP1 RecName: Full=UvrABC system protein C;         Short=...   385   e-109
UVRC_CLOPE RecName: Full=UvrABC system protein C;         Short=...   384   e-108
UVRC_GLOVI RecName: Full=UvrABC system protein C;         Short=...   382   e-108
UVRC_CLOK5 RecName: Full=UvrABC system protein C;         Short=...   378   e-107
UVRC_GEMAT RecName: Full=UvrABC system protein C;         Short=...   378   e-107
UVRC_CLOCE RecName: Full=UvrABC system protein C;         Short=...   377   e-106
UVRC_RUBXD RecName: Full=UvrABC system protein C;         Short=...   375   e-106
UVRC_SYNWW RecName: Full=UvrABC system protein C;         Short=...   370   e-104
UVRC_CLOB8 RecName: Full=UvrABC system protein C;         Short=...   370   e-104
UVRC_METBU RecName: Full=UvrABC system protein C;         Short=...   369   e-104
UVRC_THETN RecName: Full=UvrABC system protein C;         Short=...   368   e-104
UVRC_SYNJB RecName: Full=UvrABC system protein C;         Short=...   367   e-103
UVRC_MICAN RecName: Full=UvrABC system protein C;         Short=...   367   e-103
UVRC_PROA2 RecName: Full=UvrABC system protein C;         Short=...   363   e-102
UVRC_DESAA RecName: Full=UvrABC system protein C;         Short=...   363   e-102
UVRC_CYAP4 RecName: Full=UvrABC system protein C;         Short=...   362   e-102
UVRC_ALHEH RecName: Full=UvrABC system protein C;         Short=...   362   e-102
UVRC_THICR RecName: Full=UvrABC system protein C;         Short=...   362   e-102
UVRC_ALCBS RecName: Full=UvrABC system protein C;         Short=...   361   e-102
UVRC_SYNJA RecName: Full=UvrABC system protein C;         Short=...   359   e-101
UVRC_RHOS4 RecName: Full=UvrABC system protein C;         Short=...   358   e-101
UVRC_CHLTE RecName: Full=UvrABC system protein C;         Short=...   358   e-100
UVRC_PSEMY RecName: Full=UvrABC system protein C;         Short=...   355   e-100
UVRC_NOSP7 RecName: Full=UvrABC system protein C;         Short=...   354   1e-99
UVRC_PELLD RecName: Full=UvrABC system protein C;         Short=...   353   2e-99
UVRC_ACIBL RecName: Full=UvrABC system protein C;         Short=...   353   2e-99
UVRC_CHLCH RecName: Full=UvrABC system protein C;         Short=...   352   4e-99
UVRC_THEP3 RecName: Full=UvrABC system protein C;         Short=...   352   5e-99
UVRC_PSEA7 RecName: Full=UvrABC system protein C;         Short=...   351   9e-99
UVRC_THEPX RecName: Full=UvrABC system protein C;         Short=...   351   1e-98
UVRC_DESAP RecName: Full=UvrABC system protein C;         Short=...   351   1e-98
UVRC_METFK RecName: Full=UvrABC system protein C;         Short=...   350   3e-98
UVRC_GEOMG RecName: Full=UvrABC system protein C;         Short=...   350   3e-98
UVRC_PSEAE RecName: Full=UvrABC system protein C;         Short=...   349   4e-98
UVRC_PSEAB RecName: Full=UvrABC system protein C;         Short=...   348   6e-98
UVRC_PSEA8 RecName: Full=UvrABC system protein C;         Short=...   348   6e-98
UVRC_SYNAS RecName: Full=UvrABC system protein C;         Short=...   348   1e-97
UVRC_MAGSA RecName: Full=UvrABC system protein C;         Short=...   348   1e-97
UVRC_CLOPH RecName: Full=UvrABC system protein C;         Short=...   348   1e-97
UVRC_NITOC RecName: Full=UvrABC system protein C;         Short=...   347   1e-97
UVRC_METST RecName: Full=UvrABC system protein C;         Short=...   347   1e-97
UVRC_ANASP RecName: Full=UvrABC system protein C;         Short=...   347   2e-97
UVRC_YERPS RecName: Full=UvrABC system protein C;         Short=...   346   3e-97
UVRC_PELPB RecName: Full=UvrABC system protein C;         Short=...   346   4e-97
UVRC_GEOSL RecName: Full=UvrABC system protein C;         Short=...   346   4e-97
UVRC_YERE8 RecName: Full=UvrABC system protein C;         Short=...   345   5e-97
UVRC_CLONN RecName: Full=UvrABC system protein C;         Short=...   345   6e-97
UVRC_CLOBM RecName: Full=UvrABC system protein C;         Short=...   345   6e-97
UVRC_YERPN RecName: Full=UvrABC system protein C;         Short=...   345   8e-97
UVRC_YERPE RecName: Full=UvrABC system protein C;         Short=...   345   8e-97
UVRC_YERPA RecName: Full=UvrABC system protein C;         Short=...   345   8e-97
UVRC_YERP3 RecName: Full=UvrABC system protein C;         Short=...   345   8e-97
UVRC_PSEFS RecName: Full=UvrABC system protein C;         Short=...   344   1e-96
UVRC_GLUOX RecName: Full=UvrABC system protein C;         Short=...   344   1e-96
UVRC_CLOBK RecName: Full=UvrABC system protein C;         Short=...   344   1e-96
UVRC_AZOVD RecName: Full=UvrABC system protein C;         Short=...   344   1e-96
UVRC_PSE14 RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_CLOBL RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_CLOBJ RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_BDEBA RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_PSEU2 RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_PSEE4 RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_METCA RecName: Full=UvrABC system protein C;         Short=...   343   2e-96
UVRC_SALHS RecName: Full=UvrABC system protein C;         Short=...   343   3e-96
UVRC_CLOBH RecName: Full=UvrABC system protein C;         Short=...   342   4e-96
UVRC_CLOB1 RecName: Full=UvrABC system protein C;         Short=...   342   4e-96
UVRC_SACD2 RecName: Full=UvrABC system protein C;         Short=...   342   5e-96
UVRC_CITK8 RecName: Full=UvrABC system protein C;         Short=...   342   5e-96
UVRC_ANASK RecName: Full=UvrABC system protein C;         Short=...   342   5e-96
UVRC_ESCF3 RecName: Full=UvrABC system protein C;         Short=...   341   9e-96
UVRC_ANADE RecName: Full=UvrABC system protein C;         Short=...   341   9e-96
UVRC_ERWCT RecName: Full=UvrABC system protein C;         Short=...   341   1e-95
UVRC_DICNV RecName: Full=UvrABC system protein C;         Short=...   341   1e-95
UVRC_CLOB6 RecName: Full=UvrABC system protein C;         Short=...   341   1e-95
UVRC_SALPK RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_SALPA RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_PARUW RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_SALTY RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_SALTI RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_SALPB RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_PSEPF RecName: Full=UvrABC system protein C;         Short=...   340   2e-95
UVRC_SYNS3 RecName: Full=UvrABC system protein C;         Short=...   340   3e-95
UVRC_SALNS RecName: Full=UvrABC system protein C;         Short=...   340   3e-95
UVRC_SALG2 RecName: Full=UvrABC system protein C;         Short=...   340   3e-95
UVRC_SALRD RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_SALEP RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_SALDC RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_SALA4 RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_PSEP1 RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_LEPBL RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_LEPBJ RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_DESPS RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_ANAD2 RecName: Full=UvrABC system protein C;         Short=...   339   5e-95
UVRC_SALSV RecName: Full=UvrABC system protein C;         Short=...   338   6e-95
UVRC_SALPC RecName: Full=UvrABC system protein C;         Short=...   338   6e-95
UVRC_SALCH RecName: Full=UvrABC system protein C;         Short=...   338   6e-95
UVRC_PSEPK RecName: Full=UvrABC system protein C;         Short=...   338   1e-94
UVRC_LEGPL RecName: Full=UvrABC system protein C;         Short=...   338   1e-94
UVRC_GRABC RecName: Full=UvrABC system protein C;         Short=...   338   1e-94
UVRC_CHLPD RecName: Full=UvrABC system protein C;         Short=...   338   1e-94
UVRC_GEOLS RecName: Full=UvrABC system protein C;         Short=...   337   1e-94
UVRC_ECO45 RecName: Full=UvrABC system protein C;         Short=...   337   1e-94
UVRC_ANAVT RecName: Full=UvrABC system protein C;         Short=...   337   1e-94
UVRC_JANSC RecName: Full=UvrABC system protein C;         Short=...   337   2e-94
UVRC_PSEPW RecName: Full=UvrABC system protein C;         Short=...   337   2e-94
UVRC_PROMT RecName: Full=UvrABC system protein C;         Short=...   337   2e-94
UVRC_PROM1 RecName: Full=UvrABC system protein C;         Short=...   337   2e-94
UVRC_SILPO RecName: Full=UvrABC system protein C;         Short=...   336   3e-94
UVRC_LEGPA RecName: Full=UvrABC system protein C;         Short=...   336   3e-94
UVRC_PROMP RecName: Full=UvrABC system protein C;         Short=...   336   4e-94
UVRC_PROMM RecName: Full=UvrABC system protein C;         Short=...   336   4e-94
UVRC_LEGPH RecName: Full=UvrABC system protein C;         Short=...   336   4e-94
UVRC_ECOK1 RecName: Full=UvrABC system protein C;         Short=...   336   4e-94
UVRC_TRIEI RecName: Full=UvrABC system protein C;         Short=...   335   5e-94
UVRC_MESSB RecName: Full=UvrABC system protein C;         Short=...   335   5e-94
UVRC_ECOUT RecName: Full=UvrABC system protein C;         Short=...   335   5e-94
UVRC_ECOSM RecName: Full=UvrABC system protein C;         Short=...   335   5e-94
UVRC_SODGM RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_SHISS RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_SHIB3 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOSE RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOLU RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOLI RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOLC RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOL6 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOHS RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECODH RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECOBW RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO8A RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO81 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO7I RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO5E RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO57 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO55 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO27 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_ECO24 RecName: Full=UvrABC system protein C;         Short=...   335   7e-94
UVRC_LEGPC RecName: Full=UvrABC system protein C;         Short=...   334   1e-93
UVRC_NEIMA RecName: Full=UvrABC system protein C;         Short=...   334   1e-93
UVRC_CALS8 RecName: Full=UvrABC system protein C;         Short=...   334   1e-93
UVRC_ERWT9 RecName: Full=UvrABC system protein C;         Short=...   333   3e-93
UVRC_DESAH RecName: Full=UvrABC system protein C;         Short=...   333   3e-93
UVRC_KLEP3 RecName: Full=UvrABC system protein C;         Short=...   333   3e-93
UVRC_LEPIC RecName: Full=UvrABC system protein C;         Short=...   332   4e-93
UVRC_ACIBY RecName: Full=UvrABC system protein C;         Short=...   332   4e-93
UVRC_SYNP6 RecName: Full=UvrABC system protein C;         Short=...   332   6e-93
UVRC_SYNE7 RecName: Full=UvrABC system protein C;         Short=...   332   6e-93
UVRC_SHEHH RecName: Full=UvrABC system protein C;         Short=...   332   6e-93
UVRC_PHOLL RecName: Full=UvrABC system protein C;         Short=...   332   6e-93
UVRC_MYXXD RecName: Full=UvrABC system protein C;         Short=...   332   6e-93
UVRC_NITEC RecName: Full=UvrABC system protein C;         Short=...   332   7e-93
UVRC_IDILO RecName: Full=UvrABC system protein C;         Short=...   332   7e-93
UVRC_NITMU RecName: Full=UvrABC system protein C;         Short=...   331   1e-92
UVRC_LEPIN RecName: Full=UvrABC system protein C;         Short=...   331   1e-92
UVRC_ACIBS RecName: Full=UvrABC system protein C;         Short=...   331   1e-92
UVRC_HAHCH RecName: Full=UvrABC system protein C;         Short=...   330   2e-92
UVRC_ACAM1 RecName: Full=UvrABC system protein C;         Short=...   330   2e-92
UVRC_PELCD RecName: Full=UvrABC system protein C;         Short=...   330   3e-92
UVRC_ACTSZ RecName: Full=UvrABC system protein C;         Short=...   329   5e-92
UVRC_SILST RecName: Full=UvrABC system protein C;         Short=...   328   6e-92
UVRC_BORA1 RecName: Full=UvrABC system protein C;         Short=...   328   6e-92
UVRC_PROMH RecName: Full=UvrABC system protein C;         Short=...   328   8e-92
UVRC_ZYMMO RecName: Full=UvrABC system protein C;         Short=...   327   1e-91
UVRC_NEIG1 RecName: Full=UvrABC system protein C;         Short=...   327   1e-91
UVRC_ACIC5 RecName: Full=UvrABC system protein C;         Short=...   327   2e-91
UVRC_PHOPR RecName: Full=UvrABC system protein C;         Short=...   327   2e-91
UVRC_ACIAD RecName: Full=UvrABC system protein C;         Short=...   326   3e-91
UVRC_SHESH RecName: Full=UvrABC system protein C;         Short=...   326   4e-91
UVRC_SHEPA RecName: Full=UvrABC system protein C;         Short=...   326   4e-91
UVRC_PASMU RecName: Full=UvrABC system protein C;         Short=...   326   4e-91
UVRC_ENTS8 RecName: Full=UvrABC system protein C;         Short=...   326   4e-91
UVRC_CLOD6 RecName: Full=UvrABC system protein C;         Short=...   325   5e-91
UVRC_SHEPW RecName: Full=UvrABC system protein C;         Short=...   325   7e-91
UVRC_HAEI8 RecName: Full=UvrABC system protein C;         Short=...   325   9e-91
UVRC_CHRVO RecName: Full=UvrABC system protein C;         Short=...   325   9e-91
UVRC_BRUME RecName: Full=UvrABC system protein C;         Short=...   325   9e-91
UVRC_BRUAB RecName: Full=UvrABC system protein C;         Short=...   325   9e-91
UVRC_BRUA2 RecName: Full=UvrABC system protein C;         Short=...   325   9e-91
UVRC_SHEFN RecName: Full=UvrABC system protein C;         Short=...   324   2e-90
UVRC_NEIMB RecName: Full=UvrABC system protein C;         Short=...   324   2e-90
UVRC_METTH RecName: Full=UvrABC system protein C;         Short=...   324   2e-90
UVRC_BRUSU RecName: Full=UvrABC system protein C;         Short=...   323   2e-90
UVRC_GEOKA RecName: Full=UvrABC system protein C;         Short=...   323   3e-90
UVRC_SHESM RecName: Full=UvrABC system protein C;         Short=...   322   4e-90
UVRC_SHEON RecName: Full=UvrABC system protein C;         Short=...   322   4e-90
UVRC_PSEFL RecName: Full=UvrABC system protein C;         Short=...   322   4e-90
UVRC_HAEIE RecName: Full=UvrABC system protein C;         Short=...   322   4e-90
UVRC_PSESM RecName: Full=UvrABC system protein C;         Short=...   322   6e-90
UVRC_EDWI9 RecName: Full=UvrABC system protein C;         Short=...   322   6e-90
UVRC_SOLUE RecName: Full=UvrABC system protein C;         Short=...   322   8e-90
UVRC_SHESA RecName: Full=UvrABC system protein C;         Short=...   322   8e-90
UVRC_NOVAD RecName: Full=UvrABC system protein C;         Short=...   322   8e-90
UVRC_SHESR RecName: Full=UvrABC system protein C;         Short=...   321   1e-89
UVRC_BURM1 RecName: Full=UvrABC system protein C;         Short=...   321   1e-89
UVRC_BACLD RecName: Full=UvrABC system protein C;         Short=...   321   1e-89
UVRC_SYNY3 RecName: Full=UvrABC system protein C;         Short=...   321   1e-89
UVRC_DICT6 RecName: Full=UvrABC system protein C;         Short=...   320   2e-89
UVRC_FINM2 RecName: Full=UvrABC system protein C;         Short=...   320   2e-89
UVRC_SHELP RecName: Full=UvrABC system protein C;         Short=...   319   4e-89
UVRC_POLSJ RecName: Full=UvrABC system protein C;         Short=...   319   4e-89
UVRC_CAUCR RecName: Full=UvrABC system protein C;         Short=...   319   4e-89
UVRC_SERP5 RecName: Full=UvrABC system protein C;         Short=...   319   5e-89
UVRC_OCEIH RecName: Full=UvrABC system protein C;         Short=...   319   5e-89
UVRC_THIDA RecName: Full=UvrABC system protein C;         Short=...   318   6e-89
UVRC_BACSU RecName: Full=UvrABC system protein C;         Short=...   318   6e-89
UVRC_BACA2 RecName: Full=UvrABC system protein C;         Short=...   318   6e-89
UVRC_PROM9 RecName: Full=UvrABC system protein C;         Short=...   318   8e-89
UVRC_LISMH RecName: Full=UvrABC system protein C;         Short=...   318   8e-89
UVRC_LISIN RecName: Full=UvrABC system protein C;         Short=...   318   8e-89
UVRC_RHORT RecName: Full=UvrABC system protein C;         Short=...   318   1e-88
UVRC_GEOSF RecName: Full=UvrABC system protein C;         Short=...   318   1e-88
UVRC_SHEB9 RecName: Full=UvrABC system protein C;         Short=...   317   1e-88
UVRC_RHILO RecName: Full=UvrABC system protein C;         Short=...   317   2e-88
UVRC_LISMO RecName: Full=UvrABC system protein C;         Short=...   317   2e-88
UVRC_LISW6 RecName: Full=UvrABC system protein C;         Short=...   317   2e-88
UVRC_SHEB8 RecName: Full=UvrABC system protein C;         Short=...   316   3e-88
UVRC_LISMC RecName: Full=UvrABC system protein C;         Short=...   316   3e-88
UVRC_SHESW RecName: Full=UvrABC system protein C;         Short=...   316   4e-88
UVRC_PROM4 RecName: Full=UvrABC system protein C;         Short=...   315   5e-88
UVRC_BREBN RecName: Full=UvrABC system protein C;         Short=...   315   5e-88
UVRC_BARHE RecName: Full=UvrABC system protein C;         Short=...   315   5e-88
UVRC_SPHAL RecName: Full=UvrABC system protein C;         Short=...   315   7e-88
UVRC_SYNSC RecName: Full=UvrABC system protein C;         Short=...   315   9e-88
UVRC_LISMF RecName: Full=UvrABC system protein C;         Short=...   315   9e-88
UVRC_SHEB5 RecName: Full=UvrABC system protein C;         Short=...   314   1e-87
UVRC_BURS3 RecName: Full=UvrABC system protein C;         Short=...   314   1e-87
UVRC_SYNPX RecName: Full=UvrABC system protein C;         Short=...   314   2e-87
UVRC_SHEPC RecName: Full=UvrABC system protein C;         Short=...   313   2e-87
UVRC_PSEF5 RecName: Full=UvrABC system protein C;         Short=...   313   2e-87
UVRC_HAEIN RecName: Full=UvrABC system protein C;         Short=...   312   5e-87
UVRC_COXBN RecName: Full=UvrABC system protein C;         Short=...   312   5e-87
UVRC_BURCH RecName: Full=UvrABC system protein C;         Short=...   312   5e-87
UVRC_BURCA RecName: Full=UvrABC system protein C;         Short=...   312   5e-87
UVRC_ACTP7 RecName: Full=UvrABC system protein C;         Short=...   312   5e-87
UVRC_ACTPJ RecName: Full=UvrABC system protein C;         Short=...   312   6e-87
UVRC_BURCC RecName: Full=UvrABC system protein C;         Short=...   311   8e-87
UVRC_VIBPA RecName: Full=UvrABC system protein C;         Short=...   311   1e-86
UVRC_COXB1 RecName: Full=UvrABC system protein C;         Short=...   311   1e-86
UVRC_BORPA RecName: Full=UvrABC system protein C;         Short=...   311   1e-86
UVRC_BORBR RecName: Full=UvrABC system protein C;         Short=...   311   1e-86
UVRC_SHEDO RecName: Full=UvrABC system protein C;         Short=...   310   2e-86
UVRC_BORPE RecName: Full=UvrABC system protein C;         Short=...   310   2e-86
UVRC_AZOSE RecName: Full=UvrABC system protein C;         Short=...   310   2e-86
UVRC_VIBVU RecName: Full=UvrABC system protein C;         Short=...   310   2e-86
UVRC_PSEA6 RecName: Full=UvrABC system protein C;         Short=...   310   2e-86
UVRC_VIBVY RecName: Full=UvrABC system protein C;         Short=...   310   3e-86
UVRC_COXBU RecName: Full=UvrABC system protein C;         Short=...   310   3e-86
UVRC_COXBR RecName: Full=UvrABC system protein C;         Short=...   310   3e-86
UVRC_COXB2 RecName: Full=UvrABC system protein C;         Short=...   310   3e-86
UVRC_BURVG RecName: Full=UvrABC system protein C;         Short=...   308   7e-86
UVRC_NITEU RecName: Full=UvrABC system protein C;         Short=...   308   9e-86
UVRC_DECAR RecName: Full=UvrABC system protein C;         Short=...   308   9e-86
UVRC_SHIDS RecName: Full=UvrABC system protein C;         Short=...   308   1e-85
UVRC_RALSO RecName: Full=UvrABC system protein C;         Short=...   308   1e-85
UVRC_BACHD RecName: Full=UvrABC system protein C;         Short=...   308   1e-85
UVRC_ACTP2 RecName: Full=UvrABC system protein C;         Short=...   308   1e-85
UVRC_HYPNA RecName: Full=UvrABC system protein C;         Short=...   306   3e-85
UVRC_DESHY RecName: Full=UvrABC system protein C;         Short=...   306   3e-85
UVRC_CHRSD RecName: Full=UvrABC system protein C;         Short=...   306   3e-85
UVRC_THEEB RecName: Full=UvrABC system protein C;         Short=...   306   3e-85
UVRC_RHIL3 RecName: Full=UvrABC system protein C;         Short=...   306   3e-85
UVRC_ANADF RecName: Full=UvrABC system protein C;         Short=...   306   4e-85
UVRC_HAEDU RecName: Full=UvrABC system protein C;         Short=...   305   6e-85
UVRC_LEPBP RecName: Full=UvrABC system protein C;         Short=...   304   1e-84
UVRC_LEPBA RecName: Full=UvrABC system protein C;         Short=...   304   1e-84
UVRC_BRAJA RecName: Full=UvrABC system protein C;         Short=...   304   2e-84
UVRC_SYNS9 RecName: Full=UvrABC system protein C;         Short=...   303   2e-84
UVRC_RALEJ RecName: Full=UvrABC system protein C;         Short=...   303   2e-84
UVRC_HERAR RecName: Full=UvrABC system protein C;         Short=...   303   2e-84
UVRC_RHIME RecName: Full=UvrABC system protein C;         Short=...   302   5e-84
UVRC_AGRT5 RecName: Full=UvrABC system protein C;         Short=...   302   6e-84
UVRC_BACC2 RecName: Full=UvrABC system protein C;         Short=...   301   1e-83
UVRC_RHOPA RecName: Full=UvrABC system protein C;         Short=...   300   2e-83
UVRC_JANMA RecName: Full=UvrABC system protein C;         Short=...   300   2e-83
UVRC_HAES2 RecName: Full=UvrABC system protein C;         Short=...   300   2e-83
UVRC_HAES1 RecName: Full=UvrABC system protein C;         Short=...   300   2e-83
UVRC_GEOSM RecName: Full=UvrABC system protein C;         Short=...   300   3e-83
UVRC_RHOPB RecName: Full=UvrABC system protein C;         Short=...   299   4e-83
UVRC_RHOFD RecName: Full=UvrABC system protein C;         Short=...   299   4e-83
UVRC_VIBCM RecName: Full=UvrABC system protein C;         Short=...   299   5e-83
UVRC_VIBCH RecName: Full=UvrABC system protein C;         Short=...   299   5e-83
UVRC_VIBC3 RecName: Full=UvrABC system protein C;         Short=...   299   5e-83
UVRC_NITHX RecName: Full=UvrABC system protein C;         Short=...   298   9e-83
UVRC_RHOPS RecName: Full=UvrABC system protein C;         Short=...   298   1e-82
UVRC_GEOBB RecName: Full=UvrABC system protein C;         Short=...   298   1e-82
UVRC_STRU0 RecName: Full=UvrABC system protein C;         Short=...   297   2e-82
UVRC_MANSM RecName: Full=UvrABC system protein C;         Short=...   296   3e-82
UVRC_ALISL RecName: Full=UvrABC system protein C;         Short=...   296   3e-82
UVRC_MARMM RecName: Full=UvrABC system protein C;         Short=...   296   3e-82
UVRC_BACWK RecName: Full=UvrABC system protein C;         Short=...   296   3e-82
UVRC_RHOP2 RecName: Full=UvrABC system protein C;         Short=...   296   4e-82
UVRC_BACHK RecName: Full=UvrABC system protein C;         Short=...   294   1e-81
UVRC_BACCZ RecName: Full=UvrABC system protein C;         Short=...   294   1e-81
UVRC_BACC3 RecName: Full=UvrABC system protein C;         Short=...   294   1e-81
UVRC_BACC0 RecName: Full=UvrABC system protein C;         Short=...   294   1e-81
UVRC_BACAH RecName: Full=UvrABC system protein C;         Short=...   294   1e-81
UVRC_BACC4 RecName: Full=UvrABC system protein C;         Short=...   294   2e-81
UVRC_BACAN RecName: Full=UvrABC system protein C;         Short=...   294   2e-81
UVRC_BACAC RecName: Full=UvrABC system protein C;         Short=...   294   2e-81
UVRC_BACAA RecName: Full=UvrABC system protein C;         Short=...   294   2e-81
UVRC_STREM RecName: Full=UvrABC system protein C;         Short=...   293   2e-81
UVRC_COLP3 RecName: Full=UvrABC system protein C;         Short=...   293   2e-81
UVRC_LYSSC RecName: Full=UvrABC system protein C;         Short=...   293   3e-81
UVRC_BACCR RecName: Full=UvrABC system protein C;         Short=...   293   3e-81
UVRC_BARQU RecName: Full=UvrABC system protein C;         Short=...   293   4e-81
UVRC_BACCQ RecName: Full=UvrABC system protein C;         Short=...   293   4e-81
UVRC_BACC7 RecName: Full=UvrABC system protein C;         Short=...   293   4e-81
UVRC_STRE4 RecName: Full=UvrABC system protein C;         Short=...   292   5e-81
UVRC_PROMA RecName: Full=UvrABC system protein C;         Short=...   291   8e-81
UVRC_PORGI RecName: Full=UvrABC system protein C;         Short=...   291   8e-81
UVRC_PORG3 RecName: Full=UvrABC system protein C;         Short=...   291   8e-81
UVRC_PELUB RecName: Full=UvrABC system protein C;         Short=...   291   8e-81
UVRC_STRS7 RecName: Full=UvrABC system protein C;         Short=...   291   1e-80
UVRC_ENTFA RecName: Full=UvrABC system protein C;         Short=...   291   1e-80
UVRC_BACC1 RecName: Full=UvrABC system protein C;         Short=...   291   1e-80
UVRC_RALME RecName: Full=UvrABC system protein C;         Short=...   290   2e-80
UVRC_NITWN RecName: Full=UvrABC system protein C;         Short=...   290   2e-80
UVRC_FLAJ1 RecName: Full=UvrABC system protein C;         Short=...   290   2e-80
UVRC_RHIEC RecName: Full=UvrABC system protein C;         Short=...   290   2e-80
UVRC_PEDPA RecName: Full=UvrABC system protein C;         Short=...   290   3e-80
UVRC_LACLM RecName: Full=UvrABC system protein C;         Short=...   290   3e-80
UVRC_LACBA RecName: Full=UvrABC system protein C;         Short=...   289   4e-80
UVRC_VIBF1 RecName: Full=UvrABC system protein C;         Short=...   288   7e-80
UVRC_GRAFK RecName: Full=UvrABC system protein C;         Short=...   288   1e-79
UVRC_STRA3 RecName: Full=UvrABC system protein C;         Short=...   287   2e-79
UVRC_STRA5 RecName: Full=UvrABC system protein C;         Short=...   286   3e-79
UVRC_STRA1 RecName: Full=UvrABC system protein C;         Short=...   286   3e-79
UVRC_BACSK RecName: Full=UvrABC system protein C;         Short=...   286   4e-79
UVRC_STRGC RecName: Full=UvrABC system protein C;         Short=...   286   5e-79
UVRC_OENOB RecName: Full=UvrABC system protein C;         Short=...   286   5e-79
UVRC_STRP6 RecName: Full=UvrABC system protein C;         Short=...   285   8e-79
UVRC_FRAP2 RecName: Full=UvrABC system protein C;         Short=...   285   8e-79
UVRC_STRPZ RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPM RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPG RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPF RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPD RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPC RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRPB RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STACT RecName: Full=UvrABC system protein C;         Short=...   285   1e-78
UVRC_STRP8 RecName: Full=UvrABC system protein C;         Short=...   284   1e-78
UVRC_STRP3 RecName: Full=UvrABC system protein C;         Short=...   284   1e-78
UVRC_STRP1 RecName: Full=UvrABC system protein C;         Short=...   284   1e-78
UVRC_XANOR RecName: Full=UvrABC system protein C;         Short=...   284   2e-78
UVRC_XANOP RecName: Full=UvrABC system protein C;         Short=...   284   2e-78
UVRC_XANOM RecName: Full=UvrABC system protein C;         Short=...   284   2e-78
UVRC_STRMU RecName: Full=UvrABC system protein C;         Short=...   284   2e-78
UVRC_STRP7 RecName: Full=UvrABC system protein C;         Short=...   283   3e-78
UVRC_STRZT RecName: Full=UvrABC system protein C;         Short=...   283   4e-78
UVRC_STRP4 RecName: Full=UvrABC system protein C;         Short=...   283   4e-78
UVRC_LACLA RecName: Full=UvrABC system protein C;         Short=...   283   4e-78
UVRC_DEIRA RecName: Full=UvrABC system protein C;         Short=...   283   4e-78
UVRC_STRZJ RecName: Full=UvrABC system protein C;         Short=...   282   5e-78
UVRC_STRPN RecName: Full=UvrABC system protein C;         Short=...   282   5e-78
UVRC_STRPI RecName: Full=UvrABC system protein C;         Short=...   282   5e-78
UVRC_LAWIP RecName: Full=UvrABC system protein C;         Short=...   282   5e-78
UVRC_STRR6 RecName: Full=UvrABC system protein C;         Short=...   282   7e-78
UVRC_STRPS RecName: Full=UvrABC system protein C;         Short=...   282   7e-78
UVRC_STRPJ RecName: Full=UvrABC system protein C;         Short=...   282   7e-78
UVRC_STRP2 RecName: Full=UvrABC system protein C;         Short=...   282   7e-78
UVRC_STRZP RecName: Full=UvrABC system protein C;         Short=...   281   1e-77
UVRC_XANCP RecName: Full=UvrABC system protein C;         Short=...   281   1e-77
UVRC_XANC8 RecName: Full=UvrABC system protein C;         Short=...   281   1e-77
UVRC_FUSNN RecName: Full=UvrABC system protein C;         Short=...   281   1e-77
UVRC_STRT1 RecName: Full=UvrABC system protein C;         Short=...   280   3e-77
UVRC_PSYCK RecName: Full=UvrABC system protein C;         Short=...   280   3e-77
UVRC_STRT2 RecName: Full=UvrABC system protein C;         Short=...   279   4e-77
UVRC_XANCB RecName: Full=UvrABC system protein C;         Short=...   278   7e-77
UVRC_STRSV RecName: Full=UvrABC system protein C;         Short=...   278   7e-77
UVRC_XANAC RecName: Full=UvrABC system protein C;         Short=...   278   1e-76
UVRC_STAEQ RecName: Full=UvrABC system protein C;         Short=...   278   1e-76
UVRC_FLAPJ RecName: Full=UvrABC system protein C;         Short=...   277   2e-76
UVRC_XANC5 RecName: Full=UvrABC system protein C;         Short=...   277   2e-76
UVRC_STRTD RecName: Full=UvrABC system protein C;         Short=...   276   4e-76
UVRC_STAES RecName: Full=UvrABC system protein C;         Short=...   276   4e-76
UVRC_LACPL RecName: Full=UvrABC system protein C;         Short=...   276   4e-76
UVRC_VEREI RecName: Full=UvrABC system protein C;         Short=...   276   5e-76
UVRC_BACP2 RecName: Full=UvrABC system protein C;         Short=...   276   5e-76
UVRC_LACS1 RecName: Full=UvrABC system protein C;         Short=...   275   8e-76
UVRC_PSEHT RecName: Full=UvrABC system protein C;         Short=...   275   1e-75
UVRC_FRATO RecName: Full=UvrABC system protein C;         Short=...   274   2e-75
UVRC_FRATH RecName: Full=UvrABC system protein C;         Short=...   274   2e-75
UVRC_FRATF RecName: Full=UvrABC system protein C;         Short=...   274   2e-75
UVRC_STAAU RecName: Full=UvrABC system protein C;         Short=...   273   3e-75
UVRC_STAAR RecName: Full=UvrABC system protein C;         Short=...   273   3e-75
UVRC_STAAB RecName: Full=UvrABC system protein C;         Short=...   273   3e-75
UVRC_FRATN RecName: Full=UvrABC system protein C;         Short=...   273   3e-75
UVRC_STAAT RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_STAAE RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_STAAC RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_STAA8 RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_STAA3 RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_FRATM RecName: Full=UvrABC system protein C;         Short=...   273   4e-75
UVRC_STAAW RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAAS RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAAN RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAAM RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAA9 RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAA2 RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_STAA1 RecName: Full=UvrABC system protein C;         Short=...   272   5e-75
UVRC_TREDE RecName: Full=UvrABC system protein C;         Short=...   272   7e-75
UVRC_FRATW RecName: Full=UvrABC system protein C;         Short=...   272   7e-75
UVRC_STAS1 RecName: Full=UvrABC system protein C;         Short=...   271   1e-74
UVRC_CYTH3 RecName: Full=UvrABC system protein C;         Short=...   271   2e-74
UVRC_METMP RecName: Full=UvrABC system protein C;         Short=...   270   3e-74
UVRC_STAHJ RecName: Full=UvrABC system protein C;         Short=...   269   4e-74
UVRC_LACSS RecName: Full=UvrABC system protein C;         Short=...   269   6e-74
UVRC_LACRJ RecName: Full=UvrABC system protein C;         Short=...   267   2e-73
UVRC_LACRD RecName: Full=UvrABC system protein C;         Short=...   267   2e-73
UVRC_FRATT RecName: Full=UvrABC system protein C;         Short=...   267   2e-73
UVRC_FRAT1 RecName: Full=UvrABC system protein C;         Short=...   267   2e-73
UVRC_METHJ RecName: Full=UvrABC system protein C;         Short=...   266   3e-73
UVRC_LACJO RecName: Full=UvrABC system protein C;         Short=...   266   5e-73
UVRC_BACTN RecName: Full=UvrABC system protein C;         Short=...   265   6e-73
UVRC_XYLF2 RecName: Full=UvrABC system protein C;         Short=...   265   1e-72
UVRC_XYLFT RecName: Full=UvrABC system protein C;         Short=...   264   1e-72
UVRC_LACCB RecName: Full=UvrABC system protein C;         Short=...   264   1e-72
UVRC_LACC3 RecName: Full=UvrABC system protein C;         Short=...   264   1e-72
UVRC_LACGA RecName: Full=UvrABC system protein C;         Short=...   263   4e-72
UVRC_CHLTR RecName: Full=UvrABC system protein C;         Short=...   262   5e-72
UVRC_CHLTA RecName: Full=UvrABC system protein C;         Short=...   262   5e-72
UVRC_THEP1 RecName: Full=UvrABC system protein C;         Short=...   261   9e-72
UVRC_PSYA2 RecName: Full=UvrABC system protein C;         Short=...   261   9e-72
UVRC_LACDB RecName: Full=UvrABC system protein C;         Short=...   261   1e-71
UVRC_LACDA RecName: Full=UvrABC system protein C;         Short=...   261   1e-71
UVRC_XYLFA RecName: Full=UvrABC system protein C;         Short=...   260   3e-71
UVRC_METMA RecName: Full=UvrABC system protein C;         Short=...   259   4e-71
UVRC_THESQ RecName: Full=UvrABC system protein C;         Short=...   259   5e-71
UVRC_PSYWF RecName: Full=UvrABC system protein C;         Short=...   258   8e-71
UVRC_CHLAB RecName: Full=UvrABC system protein C;         Short=...   257   2e-70
UVRC_THEMA RecName: Full=UvrABC system protein C;         Short=...   254   1e-69
UVRC_DEIGD RecName: Full=UvrABC system protein C;         Short=...   253   3e-69
UVRC_METAC RecName: Full=UvrABC system protein C;         Short=...   252   7e-69
UVRC_BACFR RecName: Full=UvrABC system protein C;         Short=...   251   1e-68
UVRC_BACFN RecName: Full=UvrABC system protein C;         Short=...   251   1e-68
UVRC_RICPR RecName: Full=UvrABC system protein C;         Short=...   251   2e-68
UVRC_RICTY RecName: Full=UvrABC system protein C;         Short=...   250   2e-68
UVRC_LACF3 RecName: Full=UvrABC system protein C;         Short=...   247   2e-67
UVRC_DESVH RecName: Full=UvrABC system protein C;         Short=...   247   2e-67
UVRC_ANAMM RecName: Full=UvrABC system protein C;         Short=...   246   4e-67
UVRC_RICBR RecName: Full=UvrABC system protein C;         Short=...   246   5e-67
UVRC_NAUPA RecName: Full=UvrABC system protein C;         Short=...   245   9e-67
UVRC_CHLFF RecName: Full=UvrABC system protein C;         Short=...   245   9e-67
UVRC_THELT RecName: Full=UvrABC system protein C;         Short=...   240   2e-65
UVRC_RICPU RecName: Full=UvrABC system protein C;         Short=...   239   4e-65
UVRC_RICAE RecName: Full=UvrABC system protein C;         Short=...   239   4e-65
UVRC_HALMA RecName: Full=UvrABC system protein C;         Short=...   239   5e-65
UVRC_CHLCV RecName: Full=UvrABC system protein C;         Short=...   237   2e-64
UVRC_RICCN RecName: Full=UvrABC system protein C;         Short=...   236   4e-64
UVRC_PETMO RecName: Full=UvrABC system protein C;         Short=...   236   4e-64
UVRC_RICRS RecName: Full=UvrABC system protein C;         Short=...   234   1e-63
UVRC_RICRO RecName: Full=UvrABC system protein C;         Short=...   234   1e-63
UVRC_CHLMU RecName: Full=UvrABC system protein C;         Short=...   233   3e-63
UVRC_WOLTR RecName: Full=UvrABC system protein C;         Short=...   232   8e-63
UVRC_METBF RecName: Full=UvrABC system protein C;         Short=...   232   8e-63
UVRC_LACH4 RecName: Full=UvrABC system protein C;         Short=...   231   1e-62
UVRC_CHLPN RecName: Full=UvrABC system protein C;         Short=...   228   9e-62
UVRC_LACAC RecName: Full=UvrABC system protein C;         Short=...   228   1e-61
UVRC_STRMK RecName: Full=UvrABC system protein C;         Short=...   227   3e-61
UVRC_STRM5 RecName: Full=UvrABC system protein C;         Short=...   227   3e-61
UVRC_RICCK RecName: Full=UvrABC system protein C;         Short=...   226   4e-61
UVRC_HALWD RecName: Full=UvrABC system protein C;         Short=...   226   6e-61
UVRC_WOLPP RecName: Full=UvrABC system protein C;         Short=...   225   1e-60
UVRC_RICFE RecName: Full=UvrABC system protein C;         Short=...   224   2e-60
UVRC_ANAPZ RecName: Full=UvrABC system protein C;         Short=...   222   6e-60
UVRC_WOLWR RecName: Full=UvrABC system protein C;         Short=...   221   2e-59
UVRC_WOLPM RecName: Full=UvrABC system protein C;         Short=...   219   7e-59
UVRC_THET8 RecName: Full=UvrABC system protein C;         Short=...   218   1e-58
UVRC_RICAH RecName: Full=UvrABC system protein C;         Short=...   214   2e-57
UVRC_HELPJ RecName: Full=UvrABC system protein C;         Short=...   211   1e-56
UVRC_NATPD RecName: Full=UvrABC system protein C;         Short=...   211   2e-56
UVRC_HELPY RecName: Full=UvrABC system protein C;         Short=...   211   2e-56
UVRC_HELP2 RecName: Full=UvrABC system protein C;         Short=...   210   2e-56
UVRC_HELPG RecName: Full=UvrABC system protein C;         Short=...   210   3e-56
UVRC_HELPH RecName: Full=UvrABC system protein C;         Short=...   209   6e-56
UVRC_HELAH RecName: Full=UvrABC system protein C;         Short=...   206   4e-55
UVRC_ARCB4 RecName: Full=UvrABC system protein C;         Short=...   206   6e-55
UVRC_HELPS RecName: Full=UvrABC system protein C;         Short=...   204   1e-54
UVRC_CAMJD RecName: Full=UvrABC system protein C;         Short=...   204   2e-54
UVRC_MESFL RecName: Full=UvrABC system protein C;         Short=...   204   2e-54
UVRC_CAMJ8 RecName: Full=UvrABC system protein C;         Short=...   201   2e-53
UVRC_CAMJJ RecName: Full=UvrABC system protein C;         Short=...   199   6e-53
UVRC_HALSA RecName: Full=UvrABC system protein C;         Short=...   198   1e-52
UVRC_HALS3 RecName: Full=UvrABC system protein C;         Short=...   198   1e-52
UVRC_CAMJE RecName: Full=UvrABC system protein C;         Short=...   197   2e-52
UVRC_CAMJR RecName: Full=UvrABC system protein C;         Short=...   196   4e-52
UVRC_THET2 RecName: Full=UvrABC system protein C;         Short=...   196   6e-52
UVRC_FERNB RecName: Full=UvrABC system protein C;         Short=...   196   6e-52
UVRC_BORGA RecName: Full=UvrABC system protein C;         Short=...   194   1e-51
UVRC_BORHD RecName: Full=UvrABC system protein C;         Short=...   194   2e-51
UVRC_WOLSU RecName: Full=UvrABC system protein C;         Short=...   192   7e-51
UVRC_BORAP RecName: Full=UvrABC system protein C;         Short=...   190   3e-50
UVRC_SULDN RecName: Full=UvrABC system protein C;         Short=...   187   2e-49
UVRC_BURPP RecName: Full=UvrABC system protein C;         Short=...   187   2e-49
UVRC_BURXL RecName: Full=UvrABC system protein C;         Short=...   187   3e-49
UVRC_MYCPE RecName: Full=UvrABC system protein C;         Short=...   185   9e-49
UVRC_BURTA RecName: Full=UvrABC system protein C;         Short=...   185   9e-49
UVRC_BORBZ RecName: Full=UvrABC system protein C;         Short=...   185   1e-48
UVRC_BORBU RecName: Full=UvrABC system protein C;         Short=...   185   1e-48
UVRC_BURCM RecName: Full=UvrABC system protein C;         Short=...   183   3e-48
UVRC_BURA4 RecName: Full=UvrABC system protein C;         Short=...   183   3e-48
UVRC_BORT9 RecName: Full=UvrABC system protein C;         Short=...   181   1e-47
UVRC_THEAB RecName: Full=UvrABC system protein C;         Short=...   181   2e-47
UVRC_HYDS0 RecName: Full=UvrABC system protein C;         Short=...   181   2e-47
UVRC_BURPS RecName: Full=UvrABC system protein C;         Short=...   175   9e-46
UVRC_BURP6 RecName: Full=UvrABC system protein C;         Short=...   175   9e-46
UVRC_BURP1 RecName: Full=UvrABC system protein C;         Short=...   175   9e-46
UVRC_BURP0 RecName: Full=UvrABC system protein C;         Short=...   175   9e-46
UVRC_BURMS RecName: Full=UvrABC system protein C;         Short=...   175   1e-45
UVRC_BURMA RecName: Full=UvrABC system protein C;         Short=...   175   1e-45
UVRC_BURM9 RecName: Full=UvrABC system protein C;         Short=...   175   1e-45
UVRC_BURM7 RecName: Full=UvrABC system protein C;         Short=...   175   1e-45
UVRC_HALLT RecName: Full=UvrABC system protein C;         Short=...   172   1e-44
UVRC_BORDL RecName: Full=UvrABC system protein C;         Short=...   171   1e-44
UVRC_BORRA RecName: Full=UvrABC system protein C;         Short=...   170   3e-44
UVRC_UREPA RecName: Full=UvrABC system protein C;         Short=...   170   4e-44
UVRC_UREP2 RecName: Full=UvrABC system protein C;         Short=...   170   4e-44
UVRC_HELHP RecName: Full=UvrABC system protein C;         Short=...   170   4e-44
UVRC_DESDG RecName: Full=UvrABC system protein C;         Short=...   169   6e-44
UVRC_UREU1 RecName: Full=UvrABC system protein C;         Short=...   168   1e-43
UVRC_AQUAE RecName: Full=UvrABC system protein C;         Short=...   168   1e-43
UVRC_AYWBP RecName: Full=UvrABC system protein C;         Short=...   164   2e-42
UVRC_TREPS RecName: Full=UvrABC system protein C;         Short=...   148   1e-37
UVRC_TREPA RecName: Full=UvrABC system protein C;         Short=...   148   1e-37
UVRC_MYCMS RecName: Full=UvrABC system protein C;         Short=...   145   7e-37
UVRC_MYCGA RecName: Full=UvrABC system protein C;         Short=...   139   5e-35
UVRC_MYCCT RecName: Full=UvrABC system protein C;         Short=...   136   5e-34
UVRC_MYCPN RecName: Full=UvrABC system protein C;         Short=...   133   5e-33
UVRC_MYCGE RecName: Full=UvrABC system protein C;         Short=...   131   1e-32
UVRC_MYCBV RecName: Full=UvrABC system protein C;         Short=...   121   2e-29
UVRC_MYCAP RecName: Full=UvrABC system protein C;         Short=...   118   1e-28
CHO_ECOLI RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    66   8e-13
CHO_ECO57 RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    66   1e-12
CHO_SHIFL RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    65   2e-12
CHO_ECOL6 RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    64   5e-12
Y2191_MYCTU RecName: Full=Uncharacterized protein Rv2191/MT2247;       63   6e-12
CHO_SALTY RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    59   2e-10
CHO_SALTI RecName: Full=Excinuclease cho;         EC=3.1.25.-;Al...    57   6e-10
DNLJ_COPPD RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    47   4e-07
DNLJ_CORJK RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    41   3e-05
DNLJ_PROAC RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    39   1e-04
DNLJ_HERA2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    39   1e-04
FAP24_MOUSE RecName: Full=Fanconi anemia-associated protein of 2...    38   2e-04
Y1505_METJA RecName: Full=Putative ATP-dependent RNA helicase MJ...    38   3e-04
DNLJ_THERP RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    37   4e-04
CHLN_SYNE7 RecName: Full=Light-independent protochlorophyllide r...    37   4e-04
DNLJ_FERNB RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    37   5e-04
DISA_PROAC RecName: Full=DNA integrity scanning protein disA;          37   5e-04
CHLN_SYNP6 RecName: Full=Light-independent protochlorophyllide r...    37   5e-04
YURQ_BACSU RecName: Full=Uncharacterized protein yurQ;                 37   6e-04
RUVA_BURCJ RecName: Full=Holliday junction ATP-dependent DNA hel...    37   6e-04
FAP24_HUMAN RecName: Full=Fanconi anemia-associated protein of 2...    37   6e-04
YEGI_ECOLI RecName: Full=Uncharacterized protein yegI;                 36   8e-04
YEGI_ECO57 RecName: Full=Uncharacterized protein yegI;                 36   8e-04
RUVA_DESMR RecName: Full=Holliday junction ATP-dependent DNA hel...    36   8e-04
HELS_PYRCJ RecName: Full=Putative ski2-type helicase;         EC...    36   8e-04
FAP24_BOVIN RecName: Full=Fanconi anemia-associated protein of 2...    36   8e-04
DNLJ_MICAN RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:...    36   8e-04

>UVRC_THEFY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 656

 Score = 1216 bits (3146), Expect = 0.0
 Identities = 656/656 (100%), Positives = 656/656 (100%)

Query: 1   MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM 60
           MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM
Sbjct: 1   MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM 60

Query: 61  ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM 120
           ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM
Sbjct: 61  ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM 120

Query: 121 RGARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCS 180
           RGARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCS
Sbjct: 121 RGARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCS 180

Query: 181 APCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQAL 240
           APCVGRIGVEEYRALAEDFCAFMAGETGRFLR                    IRDDIQAL
Sbjct: 181 APCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQAL 240

Query: 241 RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
           RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL
Sbjct: 241 RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
           VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR
Sbjct: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
           ALMETVLKNAEQTLARHKSQRASDLTTRSK              PLRIECFDISTLQGEH
Sbjct: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL
Sbjct: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540
           GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW
Sbjct: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
           LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA
Sbjct: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKADE 656
           ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKADE
Sbjct: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKADE 656


>UVRC_BEUC1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 693

 Score =  791 bits (2043), Expect = 0.0
 Identities = 420/661 (63%), Positives = 490/661 (74%), Gaps = 17/661 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP+PG IP  PGVYRFRD HGRV+YVGKAK+LR+RLSSYFQD SALHPRTQ M++TA+
Sbjct: 6   TYRPRPGEIPDAPGVYRFRDPHGRVVYVGKAKSLRSRLSSYFQDLSALHPRTQQMVTTAS 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEYSWIKE+ PRFNV+YRDDKSYPYLAVT+ EE PRVQVMRGA+R
Sbjct: 66  SVEWTVVGTEVEALQLEYSWIKEFDPRFNVKYRDDKSYPYLAVTMGEEVPRVQVMRGAKR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +G RYFGPY +AWAIR+TVDLLLRVFPVRTCS+GV+KRA +SGRPCLLGYIDKCSAPCVG
Sbjct: 126 KGTRYFGPYGHAWAIRETVDLLLRVFPVRTCSSGVYKRAAASGRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           RI VE++R LAEDFC+FMAGE+G FLR                    +RDDI ALR V+E
Sbjct: 186 RISVEDHRDLAEDFCSFMAGESGVFLRRLXXXXXXXXXXLDFERAARVRDDINALRRVVE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           K AVVL D TD DV A+A D+LE +                WV ++VED+  G LVE+ L
Sbjct: 246 KNAVVLADGTDADVFALAADELEVSXXXXXXXXXXXXXXXXWVTERVEDLDDGALVERLL 305

Query: 306 AQTYGGADDEE----STTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
            Q YG    E+      T +PREVLV A P D   +  WLS  RG+ V +R+PQRG+KRA
Sbjct: 306 QQVYGPYATEKGPDGGATGVPREVLVPALPDDAVELAEWLSTLRGSRVSLRIPQRGEKRA 365

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L ETV  NA+Q LA HK++RA DLT+RS+              PLRIEC+DISTLQG H 
Sbjct: 366 LAETVRTNAQQALALHKTRRAGDLTSRSRALSELQEELGLAESPLRIECYDISTLQGTHQ 425

Query: 422 VASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQ------R 473
           V SMVVFEDGLARKSEYR+F +RGA  +GA  D  AM+EVI+RRF RYL +         
Sbjct: 426 VGSMVVFEDGLARKSEYRQFVVRGADGQGARDDTEAMHEVITRRFRRYLAQRDVGVAGGG 485

Query: 474 VGELDTLGESG----APQGAERKAP-RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVA 528
            GE+    + G     P   E   P RFAYPPNLVVVDGG PQVAAAQRALD+LG+ DVA
Sbjct: 486 SGEVPAEDDDGVAIAGPVDPETGRPARFAYPPNLVVVDGGPPQVAAAQRALDELGVSDVA 545

Query: 529 VCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVL 588
           + GLAKRLEEVWLPGEE P++LPR SEGLYLLQRVRDEAHRFAI++HR++R K++T S L
Sbjct: 546 LVGLAKRLEEVWLPGEEYPLVLPRASEGLYLLQRVRDEAHRFAITHHRKRRGKSMTRSTL 605

Query: 589 DDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQ 648
           DD+PGLGP R+AALL+ FGSVRR+  AT  EIA VPG G RTA+ +   L        T+
Sbjct: 606 DDVPGLGPSRQAALLQAFGSVRRIRAATPEEIAAVPGFGRRTAEQVLAALAPSPDDATTE 665

Query: 649 P 649
           P
Sbjct: 666 P 666


>UVRC_STRAW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 681

 Score =  751 bits (1938), Expect = 0.0
 Identities = 387/628 (61%), Positives = 452/628 (71%), Gaps = 6/628 (0%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RPKPG IP  PGVY+FRDEH RVIYVGKAK+LR RL+SYFQD + LHPRT+TM++TAA  
Sbjct: 8   RPKPGEIPDSPGVYKFRDEHHRVIYVGKAKSLRQRLASYFQDLAGLHPRTRTMVTTAAXX 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
                     ALQLEYSWIKEY PRFNV+YRDDKSYPYLAVT+NEEFPRVQVMRG +R+G
Sbjct: 68  XXXXXXXXXXALQLEYSWIKEYDPRFNVKYRDDKSYPYLAVTMNEEFPRVQVMRGHKRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY +AWAIRDTVDLLLRVFPVRTCSAGVFK A  +GRPCLLGYI KCSAPCV R+
Sbjct: 128 VRYFGPYGHAWAIRDTVDLLLRVFPVRTCSAGVFKNAARTGRPCLLGYIGKCSAPCVERV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R LAE+FC FMAG TG ++R                    +RDDI AL+  MEK 
Sbjct: 188 SAEEHRELAEEFCDFMAGRTGTYIRRLERQMTDAAEEMEYEKAARLRDDIGALKKAMEKN 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
                           ED+LEAAVQ+F+           WV DKVE V+T  LVE  L Q
Sbjct: 248 XXXXXXXXXXXXXXXXEDELEAAVQIFHXXXXXXXXXXXWVTDKVEAVTTADLVEHALQQ 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG    EE+  ++P+EVLV A P   + V  WL+ RRG+ V +R+PQRGDK++LMETV 
Sbjct: 308 LYG----EETGDSVPKEVLVPALPDPVEPVQEWLTGRRGSIVSLRIPQRGDKKSLMETVQ 363

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+Q+LA HK++RASDLTTRS+              PLRIEC+DIS LQG+  VASMVV
Sbjct: 364 RNAQQSLALHKTKRASDLTTRSRALEEIAEALDLDSAPLRIECYDISHLQGDDVVASMVV 423

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           FEDGL RKSEYRRF I+  EG D DV +M+EVI+RRF RYL E +R GE           
Sbjct: 424 FEDGLQRKSEYRRFQIKSFEGQD-DVRSMHEVITRRFRRYLSEKERTGEWAXXXXXXXXX 482

Query: 488 GAERKAP-RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEED 546
                 P RFAYPP LVVVDGG+PQVAAA+RALD+LGI+D+AVCGLAKRLEEVWLP + D
Sbjct: 483 XXXXXRPKRFAYPPQLVVVDGGQPQVAAAKRALDELGIDDIAVCGLAKRLEEVWLPDDGD 542

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P++LPRTSEGLYLLQRVRDEAHRFAI+Y R KRAK   AS LDD+ GLG  R+ AL+KHF
Sbjct: 543 PVVLPRTSEGLYLLQRVRDEAHRFAITYQRTKRAKRFRASPLDDVAGLGETRKQALIKHF 602

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTI 634
           GSV++L  AT  +I EVPGIG +TA+TI
Sbjct: 603 GSVKKLRSATIDQICEVPGIGRKTAETI 630


>UVRC_RENSM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 655

 Score =  744 bits (1920), Expect = 0.0
 Identities = 392/637 (61%), Positives = 474/637 (74%), Gaps = 6/637 (0%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RPK G IPTDPGVYRFRDEHGRVIYVGKAKNLR+RL+SYF +   L P+T  M+ TA  V
Sbjct: 8   RPKTGEIPTDPGVYRFRDEHGRVIYVGKAKNLRSRLTSYFANPVTLLPKTFAMVHTATSV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
            WT+V +E+EALQLEY+WIKE++PR+N+ +RDDKSYPYLAVT+ EEFPRVQVMRG RR+G
Sbjct: 68  QWTIVGSELEALQLEYTWIKEFAPRYNLAFRDDKSYPYLAVTMGEEFPRVQVMRGERRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGP++ A AIR+TVD LLRVFPVRTCS   FKRA+ SGRPCLLGYIDKC+ PCVGR+
Sbjct: 128 TRYFGPFT-AGAIRETVDTLLRVFPVRTCSPSTFKRAQQSGRPCLLGYIDKCAVPCVGRV 186

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R LA++FCAFM GE  RF+                     +RDD+ ALR V E+ 
Sbjct: 187 SAEEHRTLADEFCAFMGGEAKRFIGTLEKQMAEAVAELDYERAARLRDDVIALRKVFERN 246

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL + T  D+ A+ +D+LEAAVQVF VR GRIRG+RGWVV+KVED+   +L+E  L Q
Sbjct: 247 AVVLAEDTSADIFAVHQDELEAAVQVFNVRSGRIRGQRGWVVEKVEDLVPAELIEHLLQQ 306

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG  D+      IPR++LV   PA+ + +  WLS  RGA V+++VPQRGDK ALMETV 
Sbjct: 307 VYG--DERADEDRIPRQILVPELPANVEQLTEWLSGLRGAKVEIKVPQRGDKAALMETVA 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
            NAEQ +  HKS+RA DLT RS                 RIEC+DIS +QG + VASMVV
Sbjct: 365 LNAEQAMKLHKSKRAGDLTQRSLALREXXXXXXXXXXXXRIECYDISHVQGTNVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
            EDG+A+KSEYRRFSI G + A  D A+MY+VI+RRF  YL+E Q   E  T        
Sbjct: 425 VEDGIAKKSEYRRFSITG-DAARDDTASMYDVITRRFRNYLQEQQDRAEALTRPVEFEIS 483

Query: 488 GAERKAPR--FAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
            A   AP+  FAYPPNLVVVDGG PQVAA  RAL DLGI DVAV GLAKRLEEVWLP ++
Sbjct: 484 DAAETAPKSKFAYPPNLVVVDGGPPQVAATSRALADLGITDVAVIGLAKRLEEVWLPEDD 543

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+ILPRTS+GLYLLQR+RDEAHRFAIS+HR+KR K++TAS+LD +PGLG  ++ ALLKH
Sbjct: 544 FPVILPRTSQGLYLLQRIRDEAHRFAISFHRQKRGKSMTASLLDGVPGLGESKQKALLKH 603

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           FGSV++L  A  ++I+EV GIG   A+ +   L SV+
Sbjct: 604 FGSVKKLQSADVSQISEVKGIGPVLAEAVRSALESVD 640


>UVRC_ARTCA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 674

 Score =  734 bits (1894), Expect = 0.0
 Identities = 393/649 (60%), Positives = 469/649 (72%), Gaps = 21/649 (3%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP+ G IPT+PGVYRFRD HGRVIYVGKAK+LR+RL+SYF + + L P+T  M+  A+ V
Sbjct: 8   RPRTGEIPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPAGLLPKTYAMVHAASSV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           +WTVV +E+E+LQLEY+WIKE+ PRFNV +RDDK+YPYLAVTL E++PRVQVMRG +R+G
Sbjct: 68  EWTVVGSELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTLGEKYPRVQVMRGDKRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGPY+ A AIR+T+D LLRVFPVR+CSAGVFKRA SSGRPCLLGYIDKCSAPCVGRI
Sbjct: 128 TRYFGPYT-AGAIRETMDTLLRVFPVRSCSAGVFKRAESSGRPCLLGYIDKCSAPCVGRI 186

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             E++RALAEDFCAFM GE  RF                      IRDDI ALR V E+ 
Sbjct: 187 SPEDHRALAEDFCAFMGGEAKRFTNKLEKQMAAAVARLDYEQAARIRDDITALRKVFERN 246

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL + TD DV A+ ED+LEAAVQVF+VRGGRIRG+RGWVV+KVED +T  LVE  L Q
Sbjct: 247 AVVLAEDTDADVFALHEDELEAAVQVFHVRGGRIRGQRGWVVEKVEDFTTPDLVEHLLQQ 306

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG  +D E+   +PREVLV   P++ + +  WLS  RGA VDVRVPQRGDK ALM TV 
Sbjct: 307 VYG--EDGETHGRLPREVLVPVAPSNAEELTEWLSGIRGARVDVRVPQRGDKAALMSTVR 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NAE  L  HK++RA DLT RS                LRIECFD+S +QG + VASMVV
Sbjct: 365 ENAEHALKLHKTRRAGDLTVRSXXXXXXXXXXDLPVPLLRIECFDVSHVQGTNVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
            EDGL +KS+YR+FSI G   +D D AAM++V++RRF  YL++     + D L       
Sbjct: 425 VEDGLPKKSDYRKFSITGPAASD-DTAAMHDVLTRRFRHYLQDKSAQVDEDVLXXXXXXX 483

Query: 488 GAER-----------------KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVC 530
                                   +FAYPPNLVVVDGG+PQV AA RAL DLGI+DV V 
Sbjct: 484 XXXXXXXXXXXXXXXXXXXPIPKTKFAYPPNLVVVDGGQPQVNAAARALADLGIDDVYVV 543

Query: 531 GLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDD 590
           GLAKRLEEVWLP  + P+ILPRTS+GLYLLQR+RDEAHRFAIS+HR+KR KA+T S LD 
Sbjct: 544 GLAKRLEEVWLPDSDFPVILPRTSQGLYLLQRIRDEAHRFAISFHRQKRGKAMTVSALDG 603

Query: 591 IPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
           +PGLG  +R ALL HFGSV+ +  AT  E+A+  GIG   A  I    T
Sbjct: 604 VPGLGASKRKALLAHFGSVKGVKAATPEELAQAKGIGPALAAAIVSHFT 652


>UVRC_STRCO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 728

 Score =  733 bits (1893), Expect = 0.0
 Identities = 405/671 (60%), Positives = 474/671 (70%), Gaps = 51/671 (7%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP+PG IP  PGVYRFRDEH RVIYVGKAK+LR RL++YFQD + LHPRT+TM++TAA  
Sbjct: 8   RPRPGEIPDSPGVYRFRDEHRRVIYVGKAKSLRQRLANYFQDLAHLHPRTRTMVTTAAXX 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
                     ALQLEYSWIKEY PRFNV+YRDDKSYPYLAVT+NEEFPRVQVMRG +++G
Sbjct: 68  XXXXXXXXXXALQLEYSWIKEYDPRFNVKYRDDKSYPYLAVTMNEEFPRVQVMRGQKKKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY +AWAIRDTVDLLLRVFPVRTCSAGVFK A  +GRPCLLGYI KCSAPCVGRI
Sbjct: 128 VRYFGPYGHAWAIRDTVDLLLRVFPVRTCSAGVFKNAARTGRPCLLGYIGKCSAPCVGRI 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             +++  LA++FC FMAG TG +                        DDI AL+  MEK 
Sbjct: 188 TPDDHWDLADEFCDFMAGRTGTYXXXXXXXXXXXXXXXXXXXXXXXXDDIGALKKAMEKS 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
                           ED+LEAAVQ+F+           WV DKVE+++TG LVE  L Q
Sbjct: 248 XXXXXXXXXXXXXXXXEDELEAAVQIFHXXXXXXXXXXXWVTDKVEEITTGALVEHALQQ 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG    EE   A+P+EVLV A P   + V  WL++RRG+ V +R+PQRGDK+ALMETV 
Sbjct: 308 LYG----EEKGDAVPKEVLVPALPDPVEPVQQWLAERRGSGVSLRIPQRGDKKALMETVQ 363

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+Q L  HK++RASDLTTRS+              PLRIEC+DIS LQG+  VASMVV
Sbjct: 364 RNAQQALVLHKTKRASDLTTRSRALEEIAEALDLDSAPLRIECYDISHLQGDDVVASMVV 423

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGEL---------- 477
           FEDGLARKSEYRRF I+G EG D DV +M+EVI+RRF RYL E +R GE           
Sbjct: 424 FEDGLARKSEYRRFQIKGFEGQD-DVRSMHEVITRRFRRYLAEKERTGEWADGEGLVDDA 482

Query: 478 ------------------------------------DTLGESGAPQGAERKAPRFAYPPN 501
                                                 L +  A +  + +  RFAYPP 
Sbjct: 483 RHXXXXXXXXXXXXXXXXXXXXXXXXRTDGRGLTDGQELTDGPALKDDDGRPKRFAYPPQ 542

Query: 502 LVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQ 561
           LVVVDGG+PQVAAAQRALD+LGI+D+AVCGLAKRLEEVWLP E+DP++LPRTSEGLYLLQ
Sbjct: 543 LVVVDGGQPQVAAAQRALDELGIDDIAVCGLAKRLEEVWLPREDDPVVLPRTSEGLYLLQ 602

Query: 562 RVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIA 621
           RVRDEAHRFAI+Y R KRAK   A  LDD+PGLG  R+ AL+KHFGSV++L  AT  +I 
Sbjct: 603 RVRDEAHRFAITYQRAKRAKRFRAGPLDDVPGLGETRKQALIKHFGSVKKLRSATIDQIC 662

Query: 622 EVPGIGERTAQ 632
           EVPGIG +TA+
Sbjct: 663 EVPGIGRKTAE 673


>UVRC_NOCFA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 673

 Score =  732 bits (1890), Expect = 0.0
 Identities = 398/666 (59%), Positives = 476/666 (71%), Gaps = 34/666 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IP +PGVY+FRD +GRVIYVGKAK+LR+RL+SYF D ++LHPRT+ M++TAA
Sbjct: 6   TYRPAPGTIPVEPGVYKFRDSYGRVIYVGKAKSLRSRLNSYFADVASLHPRTKQMVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTLNEE+PR+ V RGAR+
Sbjct: 66  XXXXXXXXXXXXALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLFVYRGARK 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPY++AWAIR+T+DLLLRVFP RTCS GVFKR    GRPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYAHAWAIRETLDLLLRVFPARTCSTGVFKRHNQIGRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+RA+ EDFC F+AG T + +R                    +RDD+QALR  +E
Sbjct: 186 RVSAEEHRAIVEDFCDFLAGRTDKMVRELERRMHAAAEDLDFETAARLRDDVQALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV--------ST 297
           KQAVVLG  TD DVIA A D+LE AVQ+F+VR GR+RG+RGWVVDK  D          T
Sbjct: 246 KQAVVLGTGTDADVIAFATDELEVAVQIFHVRDGRVRGQRGWVVDKSGDAVDSGTGDDET 305

Query: 298 GKLVEQFLAQTYG-------GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVD 350
           G LVEQFL Q YG          DE+  T +PREVLV   PA  + +  WLS+ RG+AV 
Sbjct: 306 GALVEQFLTQFYGEQVAYADQTPDEQPATVVPREVLVPQLPAGHEQLQEWLSRLRGSAVR 365

Query: 351 VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIEC 410
           +RVPQRGDK+AL ETV +NA++ LA+HK +RA DLT+R                PLRIEC
Sbjct: 366 LRVPQRGDKKALAETVERNAKEALAQHKLKRAGDLTSRXXXXXXXXXXXXXXXXPLRIEC 425

Query: 411 FDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYL 468
            DIS +QG   VAS+VVFEDGL RKS+YR ++I+ A  EG   DV ++ EV  RRF R  
Sbjct: 426 VDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIKEAAGEGRSDDVGSIAEVTRRRFYRLR 485

Query: 469 EESQRV--GELDTLGESGAPQGAERKAP--------------RFAYPPNLVVVDGGRPQV 512
           +E       ELD    +GAP   + + P              +FAYPPNL VVDGG PQV
Sbjct: 486 KERDEAERDELDGTA-AGAPLVDDDETPTSRPGIDPTTGRPRKFAYPPNLYVVDGGAPQV 544

Query: 513 AAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAI 572
           AAA   LD+LGI DVAV GLAKRLEEVW+PGE DP+ILPR SE L+LLQRVRDEAHRFAI
Sbjct: 545 AAAAEVLDELGITDVAVIGLAKRLEEVWVPGEPDPVILPRNSEALFLLQRVRDEAHRFAI 604

Query: 573 SYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQ 632
           ++HR KR++ +TAS LD + GLG  RR AL+ HFGSV +L +AT  EI EVPGIG  TA+
Sbjct: 605 TFHRSKRSRRMTASALDSVRGLGAARRTALVTHFGSVAKLKEATVEEITEVPGIGVATAK 664

Query: 633 TIYERL 638
            +   L
Sbjct: 665 AVLAAL 670


>UVRC_MYCPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 647

 Score =  728 bits (1880), Expect = 0.0
 Identities = 394/659 (59%), Positives = 469/659 (71%), Gaps = 29/659 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D + LHPRT+ M++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADVANLHPRTRQMVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTLNEEFPR+ V RG RR
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR +   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHKQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R + +DFC F++G+T RF R                      DD+ AL+  ME
Sbjct: 186 RVSAEQHRQIVDDFCDFLSGKTDRFARELEQQMNXXXXXXXXXXXXXXXDDLGALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG---KLVE 302
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  D       +LVE
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKSADPGDSGEEQLVE 305

Query: 303 QFLAQTYG-----GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           QFL Q YG     G   +ES   +PREVLV   P++ D + +WLS  RG+ V +RVP+RG
Sbjct: 306 QFLTQFYGEQAELGGAADESVNPVPREVLVPCLPSNADELTSWLSGLRGSRVALRVPRRG 365

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
           DKRAL ETV +NA++ L +HK +RA D   RS               PLRIEC DIS +Q
Sbjct: 366 DKRALAETVQRNAKEALQQHKLKRAGDFNARSAALQNIQEALGLSEAPLRIECVDISHVQ 425

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVG 475
           G   V S+VVFEDGL RKS+YR F+IR A  +G   DVA++ EV  RRF R+L E     
Sbjct: 426 GTDVVGSLVVFEDGLPRKSDYRHFAIREAAGQGRSDDVASIAEVTRRRFARHLSEQNDPN 485

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR 535
            L       +P+G   K+ RFAYPPNL VVDGG PQV AA   L++LGI DVAV GLAKR
Sbjct: 486 ML-------SPEG---KSRRFAYPPNLYVVDGGAPQVNAASAVLEELGITDVAVIGLAKR 535

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LEEVW+P E DP+I+PR SEGLYLLQRVRDEAHRFAI+YHR KR+K +TASVLD +PGLG
Sbjct: 536 LEEVWVPSEPDPVIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRMTASVLDSVPGLG 595

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKA 654
             RR AL+ HFGS+ RL +AT  +I  VPGIG  TA  + E L         +P+ SKA
Sbjct: 596 EHRRKALVSHFGSIARLKEATVDQITAVPGIGVATATAVLEAL---------RPDESKA 645


>UVRC_FRASN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 692

 Score =  721 bits (1862), Expect = 0.0
 Identities = 405/669 (60%), Positives = 467/669 (69%), Gaps = 30/669 (4%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PGSIP  PGVYRFRDEHGRVIYVGKAK+LRARL++YF D   LHPRTQ M++TA   
Sbjct: 8   RPPPGSIPETPGVYRFRDEHGRVIYVGKAKSLRARLANYFADIHTLHPRTQHMVTTAGXX 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
                     ALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+QVMRG +RRG
Sbjct: 68  XXXXXXXXXXALQLEYTWIKEFDPRFNVRYRDDKSYPSLAVTLYEEFPRLQVMRGPKRRG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY++AWAIR+T+DLLLRVFP RTCS+GVFKRA   GRPCLLGYID+CSAPCVGR+
Sbjct: 128 VRYFGPYAHAWAIRETLDLLLRVFPARTCSSGVFKRAGQVGRPCLLGYIDRCSAPCVGRV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             + +R + +DFC FM+G+TG                          DDI ALR  +EKQ
Sbjct: 188 DADAHRQIVDDFCDFMSGQTGXXXXXXXXXXXXXXXXXXXXXXXXXXDDIGALRRAVEKQ 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL D TD DVIA A+D+LEAAVQ+FY              DK+EDV+T  LVEQFL Q
Sbjct: 248 AVVLPDGTDADVIAFAQDELEAAVQIFYXXXXXXXXXXXXXXDKLEDVTTADLVEQFLTQ 307

Query: 308 TY------------------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAV 349
            Y                             IPRE+LV   P D                
Sbjct: 308 EYLDGVRXXXXXXXXXXXXXXXXXXXXXXXQIPREILVPELPPDXXXXXXXXXXXXXXXX 367

Query: 350 DVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
           D+RVP+RGDKR LMETV +NA+Q    H+++RA DLT RS+              PLRIE
Sbjct: 368 DLRVPRRGDKRTLMETVERNAKQAFTLHRTKRAGDLTARSRALADLQEALELPDAPLRIE 427

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLE 469
           CFD+S  QG   VASMVVFEDGL RKSEYRRFSIRG +G D DVA+M E + RRF+RYL 
Sbjct: 428 CFDVSNTQGTDVVASMVVFEDGLPRKSEYRRFSIRGVDGQD-DVASMRETVHRRFSRYLA 486

Query: 470 ESQRVGELDTLGESGAPQGAER-----KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI 524
           E  R GEL+     GAP G +      +  RFAYPPNLVVVDGG PQVAAA RALD+LGI
Sbjct: 487 ERARTGELEEY--PGAPTGDDEAPETGRPRRFAYPPNLVVVDGGPPQVAAAARALDELGI 544

Query: 525 ED----VAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRA 580
           E     VA+CGLAKRLEEVWLP +++P+ILPRTSE LYLLQRVRDEAHRFAI+YHR+KR+
Sbjct: 545 ESGPGGVALCGLAKRLEEVWLPDQDEPVILPRTSEALYLLQRVRDEAHRFAITYHRQKRS 604

Query: 581 KALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            ++ AS LDD+PGLG  RR ALL+HFGSV ++  A A EIA+VPGIG RTA+ I   L  
Sbjct: 605 TSMVASALDDVPGLGETRRKALLRHFGSVAKVRAAGAEEIAQVPGIGPRTAEAIVAALAR 664

Query: 641 VEGGQRTQP 649
              G    P
Sbjct: 665 SAPGTDAAP 673


>UVRC_MYCTU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  716 bits (1847), Expect = 0.0
 Identities = 373/648 (57%), Positives = 448/648 (69%), Gaps = 19/648 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD+HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ +++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR R   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   ++R +  DFC F++G+T RF R                    +RDD+ AL+  ME
Sbjct: 186 RVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQ 303
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  +      +LVEQ
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKPGEPGDSGIQLVEQ 305

Query: 304 FLAQTYG---GADD--EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGD 358
           FL Q YG     DD  +ES   +PREVLV   P++ + + +WLS  RG+ V +RVP+RGD
Sbjct: 306 FLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRVPRRGD 365

Query: 359 KRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           KRAL ETV +NAE  L +HK +RASD   RS               PLRIEC D+S +QG
Sbjct: 366 KRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDVSHVQG 425

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGE 476
              V S+VVFEDGL RKS+YR F IR A  +G   DVA + EV  RRF R+L +     +
Sbjct: 426 TDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ---SD 482

Query: 477 LDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
            D L         ERK+ RFAYPPNL VVDGG PQV AA   +D+LG+ DVAV GLAKRL
Sbjct: 483 PDLL-------SPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRL 535

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+  +TAS LD +PGLG 
Sbjct: 536 EEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGE 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
            RR AL+ HFGS+ RL +AT  EI  VPGIG  TA  +++ L     G
Sbjct: 596 HRRKALVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSG 643


>UVRC_MYCTA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  716 bits (1847), Expect = 0.0
 Identities = 373/648 (57%), Positives = 448/648 (69%), Gaps = 19/648 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD+HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ +++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR R   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   ++R +  DFC F++G+T RF R                    +RDD+ AL+  ME
Sbjct: 186 RVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQ 303
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  +      +LVEQ
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKPGEPGDSGIQLVEQ 305

Query: 304 FLAQTYG---GADD--EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGD 358
           FL Q YG     DD  +ES   +PREVLV   P++ + + +WLS  RG+ V +RVP+RGD
Sbjct: 306 FLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRVPRRGD 365

Query: 359 KRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           KRAL ETV +NAE  L +HK +RASD   RS               PLRIEC D+S +QG
Sbjct: 366 KRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDVSHVQG 425

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGE 476
              V S+VVFEDGL RKS+YR F IR A  +G   DVA + EV  RRF R+L +     +
Sbjct: 426 TDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ---SD 482

Query: 477 LDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
            D L         ERK+ RFAYPPNL VVDGG PQV AA   +D+LG+ DVAV GLAKRL
Sbjct: 483 PDLL-------SPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRL 535

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+  +TAS LD +PGLG 
Sbjct: 536 EEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGE 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
            RR AL+ HFGS+ RL +AT  EI  VPGIG  TA  +++ L     G
Sbjct: 596 HRRKALVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSG 643


>UVRC_MYCBT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  716 bits (1847), Expect = 0.0
 Identities = 373/648 (57%), Positives = 448/648 (69%), Gaps = 19/648 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD+HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ +++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR R   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   ++R +  DFC F++G+T RF R                    +RDD+ AL+  ME
Sbjct: 186 RVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQ 303
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  +      +LVEQ
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKPGEPGDSGIQLVEQ 305

Query: 304 FLAQTYG---GADD--EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGD 358
           FL Q YG     DD  +ES   +PREVLV   P++ + + +WLS  RG+ V +RVP+RGD
Sbjct: 306 FLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRVPRRGD 365

Query: 359 KRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           KRAL ETV +NAE  L +HK +RASD   RS               PLRIEC D+S +QG
Sbjct: 366 KRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDVSHVQG 425

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGE 476
              V S+VVFEDGL RKS+YR F IR A  +G   DVA + EV  RRF R+L +     +
Sbjct: 426 TDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ---SD 482

Query: 477 LDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
            D L         ERK+ RFAYPPNL VVDGG PQV AA   +D+LG+ DVAV GLAKRL
Sbjct: 483 PDLL-------SPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRL 535

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+  +TAS LD +PGLG 
Sbjct: 536 EEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGE 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
            RR AL+ HFGS+ RL +AT  EI  VPGIG  TA  +++ L     G
Sbjct: 596 HRRKALVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSG 643


>UVRC_MYCBP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  716 bits (1847), Expect = 0.0
 Identities = 373/648 (57%), Positives = 448/648 (69%), Gaps = 19/648 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD+HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ +++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR R   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   ++R +  DFC F++G+T RF R                    +RDD+ AL+  ME
Sbjct: 186 RVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQ 303
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  +      +LVEQ
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKPGEPGDSGIQLVEQ 305

Query: 304 FLAQTYG---GADD--EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGD 358
           FL Q YG     DD  +ES   +PREVLV   P++ + + +WLS  RG+ V +RVP+RGD
Sbjct: 306 FLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRVPRRGD 365

Query: 359 KRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           KRAL ETV +NAE  L +HK +RASD   RS               PLRIEC D+S +QG
Sbjct: 366 KRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDVSHVQG 425

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGE 476
              V S+VVFEDGL RKS+YR F IR A  +G   DVA + EV  RRF R+L +     +
Sbjct: 426 TDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ---SD 482

Query: 477 LDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
            D L         ERK+ RFAYPPNL VVDGG PQV AA   +D+LG+ DVAV GLAKRL
Sbjct: 483 PDLL-------SPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRL 535

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+  +TAS LD +PGLG 
Sbjct: 536 EEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGE 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
            RR AL+ HFGS+ RL +AT  EI  VPGIG  TA  +++ L     G
Sbjct: 596 HRRKALVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSG 643


>UVRC_MYCBO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  716 bits (1847), Expect = 0.0
 Identities = 373/648 (57%), Positives = 448/648 (69%), Gaps = 19/648 (2%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD+HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ +++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQLVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR R   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   ++R +  DFC F++G+T RF R                    +RDD+ AL+  ME
Sbjct: 186 RVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQ 303
           KQAVVLGD TD DV+A A+D+LEAA                W+V+K  +      +LVEQ
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWIVEKPGEPGDSGIQLVEQ 305

Query: 304 FLAQTYG---GADD--EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGD 358
           FL Q YG     DD  +ES   +PREVLV   P++ + + +WLS  RG+ V +RVP+RGD
Sbjct: 306 FLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRVPRRGD 365

Query: 359 KRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           KRAL ETV +NAE  L +HK +RASD   RS               PLRIEC D+S +QG
Sbjct: 366 KRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDVSHVQG 425

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGE 476
              V S+VVFEDGL RKS+YR F IR A  +G   DVA + EV  RRF R+L +     +
Sbjct: 426 TDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ---SD 482

Query: 477 LDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
            D L         ERK+ RFAYPPNL VVDGG PQV AA   +D+LG+ DVAV GLAKRL
Sbjct: 483 PDLL-------SPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRL 535

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+  +TAS LD +PGLG 
Sbjct: 536 EEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGE 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
            RR AL+ HFGS+ RL +AT  EI  VPGIG  TA  +++ L     G
Sbjct: 596 HRRKALVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSG 643


>UVRC_PROAC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 672

 Score =  709 bits (1831), Expect = 0.0
 Identities = 367/641 (57%), Positives = 454/641 (70%), Gaps = 10/641 (1%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PG+IPT PGVYRF D HG+VIYVGKAKNLR RL+SYFQD SALHPRTQ M++TAA V
Sbjct: 8   RPAPGTIPTQPGVYRFSDAHGQVIYVGKAKNLRNRLNSYFQDISALHPRTQRMVTTAAHV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
            WTVV  EVE+LQLEY+WIKE+ PRFNV YRDDKSYP+L  T  +E+PRV V RGA  +G
Sbjct: 68  QWTVVQNEVESLQLEYTWIKEFDPRFNVMYRDDKSYPWLCFTWTDEYPRVFVGRGAHHKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RY+GP+  AWAIRDTV+ LLRVFP+R+CS GVF RA++ GRPCLLGYI KCSAPCV RI
Sbjct: 128 WRYYGPFGQAWAIRDTVETLLRVFPMRSCSTGVFNRAKNQGRPCLLGYIGKCSAPCVERI 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             E +R +A++FC FMAG T + ++                    IRD + AL   +E+ 
Sbjct: 188 TSEAHREIADEFCDFMAGRTTKIVKRLESQMAEASENLEFERAAVIRDSLGALSKTLERN 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVLGD TD DVI++A D LE  V++F+VRGGRIRGERGWV           L+E FL Q
Sbjct: 248 AVVLGDGTDADVISMALDPLEVGVKIFHVRGGRIRGERGWVXXXXXXXXXXXLMETFLTQ 307

Query: 308 TY------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
            Y      G   D+    A+P  VLVSAEP + D +   LS  RG+ V++RVP+RGDK  
Sbjct: 308 LYGVNASDGQVRDDGHGNAVPPLVLVSAEPTNPDVMSTILSSERGSHVEIRVPRRGDKAT 367

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           LM+TV +NA++TLA+HK +RASDL TR++              PLR+E +DIS +QG + 
Sbjct: 368 LMDTVTRNAQETLAQHKLKRASDLATRTRALEEIQESLGLDRAPLRMESYDISHIQGTNV 427

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL- 480
           V SMVVFEDG+ RKSEYRRFSI+G EG+D D AAM+EV+SRR  R +E+   +    T  
Sbjct: 428 VGSMVVFEDGMPRKSEYRRFSIKGFEGSD-DFAAMHEVLSRRLRRLIEDRDAMAAAQTPD 486

Query: 481 GESGAPQGAERKAPR-FAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLEE 538
           G+ G+       +PR FAY P+L+VVDGG PQV AAQ+ L++ G+ED +A+CGLAKRLEE
Sbjct: 487 GDVGSLIDPTTGSPRKFAYAPHLIVVDGGAPQVHAAQQVLEEFGLEDEIALCGLAKRLEE 546

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           VWLP EE P+ILPRTSEGLYLLQR+RDEAHRFAI++HR KR+KA+  SVLD + GLG  R
Sbjct: 547 VWLPDEEWPVILPRTSEGLYLLQRLRDEAHRFAITFHRSKRSKAMVESVLDGVSGLGETR 606

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
           R AL+ HFGSVR L +AT  +I EVPG G + A  +   L+
Sbjct: 607 RKALVSHFGSVRSLRKATVDDIVEVPGFGPKLAGEVVAALS 647


>UVRC_SALTO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 665

 Score =  706 bits (1822), Expect = 0.0
 Identities = 382/671 (56%), Positives = 450/671 (67%), Gaps = 39/671 (5%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PG+IP  PGVYRFRD  GRVIYVGKA+NLR RL+SYF D   LH RT+ M+ TA  V
Sbjct: 8   RPAPGTIPESPGVYRFRDGTGRVIYVGKARNLRNRLNSYFADPVNLHQRTRQMVFTAESV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           DW  V TEVEALQ E++ IK+Y PRFNVRYRDDKSYPYLAVT++EEFPR+QVMRGA+R+G
Sbjct: 68  DWISVATEVEALQQEFTEIKQYDPRFNVRYRDDKSYPYLAVTVSEEFPRLQVMRGAKRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPYS+AWAIR+T+DLLLRVFP RTCS+GVFKRA   GRPCLLGYIDKC+APCVG +
Sbjct: 128 VRYFGPYSHAWAIRETLDLLLRVFPARTCSSGVFKRAGQVGRPCLLGYIDKCAAPCVGSV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+RA+ E FC FMAG T   +R                               MEKQ
Sbjct: 188 SAEEHRAIVEGFCDFMAGRTDLMVRRLEREMADASAELEFEXXXXXXXXXXXXXXXMEKQ 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            VV GD TD DV+A A+D LEAAVQVF+VR GRIRG+RGWVV+K E+++ G LV  F  Q
Sbjct: 248 TVVFGDGTDADVVAFADDPLEAAVQVFHVRDGRIRGQRGWVVEKTEELTIGDLVHHFCTQ 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YGG   E+    +PRE+LV   PAD +A+  WLS  RG+ V +RVPQRGDKRAL+ETV 
Sbjct: 308 VYGG---EQGEADVPRELLVPELPADVEALADWLSDHRGSRVTLRVPQRGDKRALLETVA 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA   LARHK +RA DLTTRSK              PLRIEC+DIS +QG   VASMVV
Sbjct: 365 RNATDALARHKLKRAGDLTTRSKALDEIAETLGLQTAPLRIECYDISQIQGTDVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDT-------- 479
           FEDGL RKSEYRRF IR   GA  D++AM EV+ RRF RYL+     GE           
Sbjct: 425 FEDGLPRKSEYRRFIIR---GATDDLSAMSEVLRRRFARYLDARAETGEAGVEXXXXXXX 481

Query: 480 ----------------LGESGAP-QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDL 522
                           +G    P  G  RK   FAYPP L                    
Sbjct: 482 XXXXXXXXXXVPDEPRVGTLVDPTTGRPRK---FAYPPQLXXXXXXXXXXXXXXXXXXXX 538

Query: 523 GIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKA 582
              DVA+CGLAKRLEEVWLP ++ P ILPRTSEGLYLLQRVRDEAHRFAI++HR++R++ 
Sbjct: 539 XXXDVALCGLAKRLEEVWLPDDDFPAILPRTSEGLYLLQRVRDEAHRFAITFHRQRRSRR 598

Query: 583 LTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           +T S LD +PGLG VRR ALL+HFGS++RL+ A+  EI EVPG+G+RTA+ I   L    
Sbjct: 599 MTESALDRVPGLGEVRRKALLRHFGSLKRLSAASVEEITEVPGVGQRTAEAILAAL---- 654

Query: 643 GGQRTQPENSK 653
            G  TQP+  +
Sbjct: 655 -GDSTQPDEPR 664


>UVRC_ACIC1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 641

 Score =  706 bits (1821), Expect = 0.0
 Identities = 380/637 (59%), Positives = 460/637 (72%), Gaps = 7/637 (1%)

Query: 5   PTLR-PKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           P LR P  G IP  PGVYRF D H RVIYVGKAKNLRARL+SYF D + LHPRT+ M++ 
Sbjct: 4   PQLRKPAAGEIPESPGVYRFWDAHDRVIYVGKAKNLRARLTSYFADPALLHPRTRAMVTA 63

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
           AA +DW +V TEVEALQLEY+WIK+Y PRFN++YRDDKSYPYLAVTL E  PR+ V RG 
Sbjct: 64  AARLDWVIVRTEVEALQLEYNWIKQYEPRFNIKYRDDKSYPYLAVTLAEPVPRLMVYRGK 123

Query: 124 RRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           R++G RYFGP+++AWAIRDT+DLLLRVFP RTCSAGV++RA+  GRPCLLGYI KCSAPC
Sbjct: 124 RKKGNRYFGPFAHAWAIRDTLDLLLRVFPARTCSAGVYRRAQRIGRPCLLGYIGKCSAPC 183

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTV 243
           VG +  E++R +  DFC  M G    +LR                               
Sbjct: 184 VGWVSEEQHRQIVLDFCDVMGGRATEYLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243

Query: 244 MEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
             KQ VVL ++T                 VF+VR GR+RG+RGWVV+KVE + T  LV+ 
Sbjct: 244 XXKQTVVLPENTXXXXXXXXXXXXXXXXHVFFVRDGRVRGQRGWVVEKVEALDTADLVQH 303

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
           FLAQ YG    E +   +PRE+LV   P+D + +  WLS RRG  V +RVPQRGDK+AL+
Sbjct: 304 FLAQLYGETGAESAD--VPREILVPVAPSDTETLERWLSSRRGGRVTIRVPQRGDKKALL 361

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           ETV +NA Q L  HK +RA DLT R +              PLRIEC+D+STLQG   VA
Sbjct: 362 ETVAQNAAQALHLHKVRRAGDLTARGRALREIQEALNLPDAPLRIECYDVSTLQGTDVVA 421

Query: 424 SMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGEL--DTLG 481
           SMVVFEDGL RKSEYRRF++RG  G   DV A++EVISRRF RYL+E  +      D  G
Sbjct: 422 SMVVFEDGLPRKSEYRRFALRGVGG--GDVGAIHEVISRRFRRYLDERMQTDSPIDDGTG 479

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWL 541
                  A     +F+YPP+LV+VDGG PQVAAA++ALD+LGI+DVA+ GLAKRLEE+WL
Sbjct: 480 PDQPRVDAAAHHRKFSYPPSLVIVDGGAPQVAAAKKALDELGIDDVALAGLAKRLEEIWL 539

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
           P  E+P+ILPR SEGLYLLQR+RDEAHRFAISYHR KR+ ++T SVL+ IPG+G  RR A
Sbjct: 540 PDREEPVILPRASEGLYLLQRLRDEAHRFAISYHRAKRSTSMTRSVLEGIPGIGETRRKA 599

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            L+HFGSV+R+ QAT AE+A VPG+G RTA+ ++  L
Sbjct: 600 FLRHFGSVQRMRQATVAELAAVPGVGRRTAEVVFAAL 636


>UVRC_SALAI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 660

 Score =  704 bits (1816), Expect = 0.0
 Identities = 381/656 (58%), Positives = 442/656 (67%), Gaps = 29/656 (4%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PG+IP  PGVYRFRD  GRVIYVGKA+NLR+RL+SYF D   LH RT+ M+ TA  V
Sbjct: 8   RPAPGTIPESPGVYRFRDGTGRVIYVGKARNLRSRLNSYFADPVNLHQRTRQMVFTAESV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           DW  V TEVEALQ E++ IK+Y PRFNVRYRDDKSYPYLAVT++EEFPR+QVMRGA+RRG
Sbjct: 68  DWISVATEVEALQQEFTEIKQYDPRFNVRYRDDKSYPYLAVTVDEEFPRLQVMRGAKRRG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPYS+AWAIR+T+DLLLRVFP RTCS+GVFKRA   GRPCLLGYI KCSAPCVG +
Sbjct: 128 VRYFGPYSHAWAIRETLDLLLRVFPARTCSSGVFKRAGQVGRPCLLGYIGKCSAPCVGSV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R +   FC FMAG T   +R                               MEKQ
Sbjct: 188 SAEEHRDIVNGFCDFMAGRTDAMVRRLEREMAEASAELEFEXXXXXXXXXXXXXXXMEKQ 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            VV GD TD DV+A A+D LEAAVQVF+VR GRIRG+RGWVV+K ED++ G LV  F  Q
Sbjct: 248 TVVFGDGTDADVVAFADDPLEAAVQVFHVRDGRIRGQRGWVVEKTEDLTAGDLVHHFCTQ 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YGG   E     +PRE+LV   PAD +A+  WLS+ RG+ V +RVPQRGDKRAL+ETV 
Sbjct: 308 VYGG---EHGEAHVPRELLVPELPADVEALADWLSEHRGSRVTLRVPQRGDKRALLETVA 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA   LARHK +RA DLTTRSK              PLRIECFDIS +QG   VASMVV
Sbjct: 365 RNATDALARHKLKRAGDLTTRSKALDEIADTLGMRTAPLRIECFDISQIQGTDVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDT-------- 479
           FEDGL RKSEYRRF IR   GA  D++AM EV+ RRF RYL+     GE           
Sbjct: 425 FEDGLPRKSEYRRFIIR---GATDDLSAMSEVLRRRFARYLDARAETGEAGVESXXXXXX 481

Query: 480 -----------LGESGAP-QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDV 527
                      +G    P  G  RK   FAYPP L                       DV
Sbjct: 482 XXXXXXXXEPRVGTLVDPTTGRPRK---FAYPPQLXXXXXXXXXXXXXXXXXXXXXXXDV 538

Query: 528 AVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASV 587
           A+CGLAKRLEEVWLP ++ P ILPRTSEGLYLLQRVRDEAHRFAI++HR++R++ +T S 
Sbjct: 539 ALCGLAKRLEEVWLPDDDFPAILPRTSEGLYLLQRVRDEAHRFAITFHRQRRSRRMTESA 598

Query: 588 LDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEG 643
           LD + GLG VRR ALL+HFGS++RLA A+  EI EVPGIG+RTA+ I   L    G
Sbjct: 599 LDRVSGLGEVRRKALLRHFGSLKRLAAASVEEITEVPGIGKRTAEAILAALADPTG 654


>UVRC_FRASC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 705

 Score =  702 bits (1812), Expect = 0.0
 Identities = 410/680 (60%), Positives = 481/680 (70%), Gaps = 38/680 (5%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PGSIP  PGVYRFRDEHGRV+YVGKAKNLRARL++YF +   LHPRTQ M+S+A+ V
Sbjct: 8   RPAPGSIPETPGVYRFRDEHGRVLYVGKAKNLRARLANYFAELHTLHPRTQHMVSSASSV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           DWTVV+TEVEALQLEY+WIK++ PRFNVRYRDDKSYP LAVTL+EEFPR+QVMRG +R+G
Sbjct: 68  DWTVVSTEVEALQLEYTWIKQFDPRFNVRYRDDKSYPSLAVTLHEEFPRLQVMRGPKRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY++AWAIR+T+DLLLRVFP RTCS GVFKRA   GRPCLLGYID+CSAPCVGR+
Sbjct: 128 VRYFGPYAHAWAIRETLDLLLRVFPARTCSGGVFKRAAQVGRPCLLGYIDRCSAPCVGRV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
               +R + EDFC FM+G+TGR+L                       DDI ALR  +EKQ
Sbjct: 188 DAATHREIVEDFCDFMSGQTGRYLXXXXXXXXXXXXXXXXXXXXXXXDDIGALRRAVEKQ 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL D TD DVIA AED+LEAAV VFY              DK+++V+T  LVEQFL Q
Sbjct: 248 AVVLPDGTDADVIAFAEDELEAAVAVFYXXXXXXXXXXXXXXDKLDEVTTADLVEQFLTQ 307

Query: 308 TY----------------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDV 351
            Y                           IPRE+LV A P D +AV   L   RG+ V+V
Sbjct: 308 EYLDXXXXXXXXXXXXXXXXXXXXXQGEGIPREILVPALPPDVEAVTELLGAARGSRVEV 367

Query: 352 RVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECF 411
           RVP+RGDKR L+ETV +NA+Q  A H+++RASDLT RS+                RIECF
Sbjct: 368 RVPRRGDKRTLLETVERNAKQAFALHRTKRASDLTARSRXXXXXXXXXXXXXXXXRIECF 427

Query: 412 DISTLQGEHTVASMVVFEDGLARKSEY--------RRFSIRGAEGADSDVAAMYEVISRR 463
           D+S  QG + VASMVVFEDGL RKSEY                     DVA+MYE I RR
Sbjct: 428 DVSNTQGTNVVASMVVFEDGLPRKSEYXXXXXXXXXXXXXXXXXXXXDDVASMYETIHRR 487

Query: 464 FTRYLEESQRVGELDTLGE----SGAPQGAERKAP------RFAYPPNLVVVDGGRPQVA 513
           F+RYL E  R+ ++  + E    +GAP  A+   P      RFAYPPNL           
Sbjct: 488 FSRYLAERSRIADIADIAELGDIAGAPGAAQPIDPGTGRPRRFAYPPNLXXXXXXXXXXX 547

Query: 514 AAQRALDDLGIE----DVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHR 569
                LD+LGI+     VA+CGLAKRLEEVWLP   DP+ILPRTSE LYLLQRVRDEAHR
Sbjct: 548 XXXXXLDELGIDAGPGGVALCGLAKRLEEVWLPDTADPVILPRTSEALYLLQRVRDEAHR 607

Query: 570 FAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGER 629
           FAI+YHR+KR+ A+ AS LD++PGLG  RR ALL+HFGSV ++  A+A +IA+V GIG R
Sbjct: 608 FAIAYHRQKRSTAMVASALDEVPGLGDTRRKALLRHFGSVAKIRAASAEQIAQVSGIGPR 667

Query: 630 TAQTIYERLTSVEGGQRTQP 649
           TA  I   L     G+   P
Sbjct: 668 TAAAIVTALARSAPGRADAP 687


>UVRC_COREF RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 681

 Score =  702 bits (1811), Expect = 0.0
 Identities = 366/672 (54%), Positives = 451/672 (67%), Gaps = 39/672 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IPT+PGVY+FRD+  RVIYVGKAKNLRARLS+YFQD + LHPRT+ M+  A+
Sbjct: 6   TYRPAPGTIPTEPGVYKFRDDARRVIYVGKAKNLRARLSNYFQDVTQLHPRTRQMVFAAS 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV +EVEALQLEY+WIK + PRFNV+YRDDKSYP LAV+  E FPR    RG RR
Sbjct: 66  SVEWTVVGSEVEALQLEYTWIKRFDPRFNVKYRDDKSYPMLAVSTGERFPRAFFYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRY+GPYS+AWA+R+T+DLL+RVFP+RTCS GVF R  + GRPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYYGPYSHAWAVRETLDLLIRVFPMRTCSKGVFNRHENLGRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+R + E FC+FM+G T +  R                    +RDD+ A+  VME
Sbjct: 186 RVSEEEHREIVEGFCSFMSGHTDKVTRELTAEMMAASEELDFERAARLRDDLGAINKVME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKV------------- 292
           KQAVVLGD TD D+IA A D+LEAAVQ+F+VRGGRIRG+RGWVV+K              
Sbjct: 246 KQAVVLGDGTDADIIAFATDELEAAVQIFHVRGGRIRGQRGWVVEKTGDWDLPDDSDAEG 305

Query: 293 EDVSTGKLVEQFLAQTYG--------------------GADD--EESTTAIPREVLVSAE 330
            D +   L++ FL Q YG                    G D   E +   +PRE+LV  E
Sbjct: 306 PDPALPHLMQHFLVQFYGDXXXXXXXXXXXXXXHIERRGVDQYREATPAVVPREILVQVE 365

Query: 331 PADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSK 390
           P +       L + RGA VD+RVPQRGDKR+LMETV KNA + L +HK +R  DLT RS 
Sbjct: 366 PHEAQETRKVLEELRGAGVDLRVPQRGDKRSLMETVEKNAREQLKQHKIKRVGDLTARSA 425

Query: 391 XXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EG 448
                         PLRIEC DIS +QG   VAS+VVFEDGL RKS+YRR+ I+ A  +G
Sbjct: 426 ALQDIQEALDMEQAPLRIECTDISHIQGTDVVASLVVFEDGLPRKSDYRRYRIKEAAGDG 485

Query: 449 ADSDVAAMYEVISRRFTRYLEESQRVGEL--DTLGESGAPQGAERKAPRFAYPPNLVVVD 506
             +DVA++ EV  RRF R+  +   V E   D        +       RFAYPP L +VD
Sbjct: 486 HSNDVASIAEVTRRRFLRHHRDKLAVPEELDDATFSDEKVEEMSTDNRRFAYPPQLFIVD 545

Query: 507 GGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDE 566
           GG PQVAAAQ   D+LGI DV + GLAKRLEE+WLPG+ DP+ILPR S  L+LLQ+VRDE
Sbjct: 546 GGAPQVAAAQEVFDELGIVDVTLVGLAKRLEEIWLPGDPDPVILPRNSPALFLLQQVRDE 605

Query: 567 AHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGI 626
           AHRFAI+YHR++R+K +  S LDDI GLG  RR  L+KHFGSV RL +AT  +IA V G 
Sbjct: 606 AHRFAITYHRQQRSKRMRVSELDDIRGLGQARRTELVKHFGSVARLREATVGDIAGVRGF 665

Query: 627 GERTAQTIYERL 638
           G + AQ+++E L
Sbjct: 666 GPKLAQSVFEAL 677


>UVRC_MYCA9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 671

 Score =  701 bits (1808), Expect = 0.0
 Identities = 364/649 (56%), Positives = 443/649 (68%), Gaps = 22/649 (3%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D + LHPRT+ M++TA 
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITGLHPRTRQMVTTAG 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTLNEE+PR+ V RG RR
Sbjct: 66  SVEWTVVGTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLFVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCS GVFKR +   RPCLLGYI+KCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSNGVFKRHKQIDRPCLLGYIEKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  +E+R +  DFC F++G+T R  R                    +RD+I AL+  +E
Sbjct: 186 RVSAQEHREIVLDFCDFLSGKTDRLARDMEREMNQAAQELNFERAARLRDNISALQRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGK---LVE 302
           +Q VV GD TD DV+A ++D+LEAA                W+V+K  D        LVE
Sbjct: 246 RQTVVFGDGTDADVVAFSDDELEAAXXXXXXXXXXXXXXXXWIVEKTGDPGDSDLQGLVE 305

Query: 303 QFLAQTYG-------GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQ 355
           QFL Q YG        AD E                 D + + +WL+  RG+ V +RVPQ
Sbjct: 306 QFLTQFYGDQADLVYAADTEADVAXXXXXXXXXXXXXDAEGMTSWLTGLRGSRVSLRVPQ 365

Query: 356 RGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDIST 415
           RGDK+AL ETV +NA++ LA+HK +RA DLTTRS               PLRIEC DIS 
Sbjct: 366 RGDKKALAETVERNAKEALAQHKLKRAGDLTTRSAALQELQDALGLEQAPLRIECIDISH 425

Query: 416 LQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQR 473
           +QG   VAS+VVFEDGL+R+S+YR +SIR A  +G   DVA++ EV  RRF R++++ Q 
Sbjct: 426 VQGTDVVASLVVFEDGLSRRSDYRHYSIREAAGDGRSDDVASIAEVTRRRFARHVQDQQA 485

Query: 474 VGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLA 533
           V E        A +G  RK   FAYPPNL VVDGG PQV AA   L +LG+ DVAV GLA
Sbjct: 486 VTEY-------AAEGHSRK---FAYPPNLFVVDGGAPQVNAAAAELSELGVTDVAVIGLA 535

Query: 534 KRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
           KRLEEVW+PGE DP+ILPRTSE LYLLQRVRDEAHRFAI++HR KR++ +TASVLD IPG
Sbjct: 536 KRLEEVWVPGEPDPVILPRTSEALYLLQRVRDEAHRFAITFHRSKRSRRMTASVLDGIPG 595

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           LG  RRAAL+ HFGSV +L +A+  EI  VPGIG  TA  + E L   +
Sbjct: 596 LGEARRAALVSHFGSVAQLKKASVEEITAVPGIGAATAVAVREALIETD 644


>UVRC_MYCLE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 647

 Score =  699 bits (1805), Expect = 0.0
 Identities = 370/661 (55%), Positives = 452/661 (68%), Gaps = 29/661 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP  GSIP +PGVYRFRD +GRVIYVGKAK+LR+RL+SYF D + LHPRT+ M++ AA
Sbjct: 6   TYRPATGSIPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHPRTRQMVTIAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCS GVFKR +   RPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSPGVFKRHKQIDRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+G E++  +  DFC F++G+T R+ R                    +RDD+ AL+  ME
Sbjct: 186 RVGAEQHSQIVADFCDFLSGKTDRYARDLERKMSAAAEQLDFERAARLRDDLFALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV-STG--KLVE 302
           KQAVV GD TD DV+A A D+LE A                W+V+K +D   TG  +LVE
Sbjct: 246 KQAVVFGDGTDADVVAFAYDELEVAXXXXXXXXXXXXXXXXWIVEKSDDPGDTGEEQLVE 305

Query: 303 QFLAQTYGGADD-----EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           QFLAQ YG   +     +ES   +PREVLV   P++ D + +WLS  RG+ V +RVP+RG
Sbjct: 306 QFLAQFYGEQAELDFVADESANPVPREVLVPCLPSNADELASWLSGLRGSRVALRVPRRG 365

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
           DKRAL ETV +NA++ L +HK +RASD  +RS               PLRIEC DIS +Q
Sbjct: 366 DKRALAETVQRNAKEELQQHKLKRASDFNSRSAALQNIQDTLGLSYAPLRIECVDISHVQ 425

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVG 475
           G   V S+VVFEDGL RKS+YR F IR A   G   DVA++ EV  RRF ++L +     
Sbjct: 426 GTDVVGSLVVFEDGLPRKSDYRHFGIRKAAGNGRSDDVASIAEVTRRRFLQHLHDQNDTN 485

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR 535
            L       +P+G   K+ RFAYPPNL VVDGG PQV AA   L++LGI DVAV GLAKR
Sbjct: 486 LL-------SPEG---KSHRFAYPPNLYVVDGGAPQVNAASTVLEELGIIDVAVIGLAKR 535

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LEEVW+P E  P+I+PR SE L+LLQRVRDEAHRFAI+YHR KR+K +TAS LD +PGLG
Sbjct: 536 LEEVWVPFEPYPVIMPRNSEALFLLQRVRDEAHRFAITYHRSKRSKRMTASALDSVPGLG 595

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKAD 655
             RR AL+ HFGS+ RL  AT  +I  VPGIG  TA  + E L         +P++S+A 
Sbjct: 596 AHRRKALVTHFGSIARLKDATVEQITAVPGIGVATATAVLEAL---------RPDSSEAS 646

Query: 656 E 656
           E
Sbjct: 647 E 647


>UVRC_MYCLB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 647

 Score =  699 bits (1805), Expect = 0.0
 Identities = 370/661 (55%), Positives = 452/661 (68%), Gaps = 29/661 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP  GSIP +PGVYRFRD +GRVIYVGKAK+LR+RL+SYF D + LHPRT+ M++ AA
Sbjct: 6   TYRPATGSIPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHPRTRQMVTIAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTL EEFPR+ V RG RR
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLGEEFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCS GVFKR +   RPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSPGVFKRHKQIDRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+G E++  +  DFC F++G+T R+ R                    +RDD+ AL+  ME
Sbjct: 186 RVGAEQHSQIVADFCDFLSGKTDRYARDLERKMSAAAEQLDFERAARLRDDLFALKRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV-STG--KLVE 302
           KQAVV GD TD DV+A A D+LE A                W+V+K +D   TG  +LVE
Sbjct: 246 KQAVVFGDGTDADVVAFAYDELEVAXXXXXXXXXXXXXXXXWIVEKSDDPGDTGEEQLVE 305

Query: 303 QFLAQTYGGADD-----EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           QFLAQ YG   +     +ES   +PREVLV   P++ D + +WLS  RG+ V +RVP+RG
Sbjct: 306 QFLAQFYGEQAELDFVADESANPVPREVLVPCLPSNADELASWLSGLRGSRVALRVPRRG 365

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
           DKRAL ETV +NA++ L +HK +RASD  +RS               PLRIEC DIS +Q
Sbjct: 366 DKRALAETVQRNAKEELQQHKLKRASDFNSRSAALQNIQDTLGLSYAPLRIECVDISHVQ 425

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVG 475
           G   V S+VVFEDGL RKS+YR F IR A   G   DVA++ EV  RRF ++L +     
Sbjct: 426 GTDVVGSLVVFEDGLPRKSDYRHFGIRKAAGNGRSDDVASIAEVTRRRFLQHLHDQNDTN 485

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR 535
            L       +P+G   K+ RFAYPPNL VVDGG PQV AA   L++LGI DVAV GLAKR
Sbjct: 486 LL-------SPEG---KSHRFAYPPNLYVVDGGAPQVNAASTVLEELGIIDVAVIGLAKR 535

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LEEVW+P E  P+I+PR SE L+LLQRVRDEAHRFAI+YHR KR+K +TAS LD +PGLG
Sbjct: 536 LEEVWVPFEPYPVIMPRNSEALFLLQRVRDEAHRFAITYHRSKRSKRMTASALDSVPGLG 595

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKAD 655
             RR AL+ HFGS+ RL  AT  +I  VPGIG  TA  + E L         +P++S+A 
Sbjct: 596 AHRRKALVTHFGSIARLKDATVEQITAVPGIGVATATAVLEAL---------RPDSSEAS 646

Query: 656 E 656
           E
Sbjct: 647 E 647


>UVRC_MYCMM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 647

 Score =  696 bits (1796), Expect = 0.0
 Identities = 376/649 (57%), Positives = 445/649 (68%), Gaps = 20/649 (3%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D + L PRT+ M++TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADIAHLQPRTRQMVTTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTLNE+FPR+ V RG RR
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEDFPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+TVDLL RVFP RTCS GVFKR +   RPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYFGPYSHAWAIRETVDLLTRVFPARTCSMGVFKRHKQIDRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R + +DFC F++G+T R+ R                               ME
Sbjct: 186 RVSKEQHRQIVDDFCDFLSGKTDRYARELEQQMNAAAENLDFEXXXXXXXXXXXXXXXME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK--VEDVST-GKLVE 302
           KQAVVLGD TD DV+A A+D+LEAAVQVF+              +K    DVS   +LVE
Sbjct: 246 KQAVVLGDGTDADVVAFADDELEAAVQVFHXXXXXXXXXXXXXXEKPSAPDVSVEEQLVE 305

Query: 303 QFLAQTYG-----GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           QFLAQ YG     G   +ES   +PREVLV   P++ D             V +RVP+RG
Sbjct: 306 QFLAQFYGDQAELGGAADESVNPVPREVLVPCLPSNADQXXXXXXXXXXXXVTLRVPRRG 365

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
           DKRAL ETV +NA++ L +HK +RA D   RS               PLRIEC DIS +Q
Sbjct: 366 DKRALAETVQRNAKEALQQHKLKRAGDFNARSAALQNIQEALGLADAPLRIECVDISHVQ 425

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVG 475
           G   VAS+VVFEDGL RKS+YR F+IR A  +G   DVA++ EV  RRF R+L E     
Sbjct: 426 GTDVVASLVVFEDGLPRKSDYRHFAIREAAGQGRSDDVASIAEVTRRRFQRHLSEQNDPN 485

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR 535
            L       +P+G   K+ RFAYPPNL VVDGG PQV AA   L++LGI DVAV GLAKR
Sbjct: 486 LL-------SPEG---KSRRFAYPPNLYVVDGGAPQVNAASAVLEELGIVDVAVIGLAKR 535

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LEEVW+P E DPII+PR SEGLYLLQRVRDEAHRFAI+YHR KR+K +TAS LD +PGLG
Sbjct: 536 LEEVWVPSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRMTASALDAVPGLG 595

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
             RR AL+ HFGS+ RL +AT  +I  VPGIG  TA  + E L   + G
Sbjct: 596 EHRRKALVTHFGSIARLKEATVDQITAVPGIGVATATAVLEALRPDQPG 644


>UVRC_ARTAT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 671

 Score =  694 bits (1791), Expect = 0.0
 Identities = 378/664 (56%), Positives = 464/664 (69%), Gaps = 19/664 (2%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP+ G IPT PGVYRFRD HGRVIYVGKAKNLR+RL+SYF + + L P+T  M+  A+ V
Sbjct: 8   RPQTGEIPTTPGVYRFRDPHGRVIYVGKAKNLRSRLNSYFANPAGLLPKTHAMVHAASSV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           +WTVV +E+E+LQLEY+WIKE+ PRFNV +RDDK+YPYLAVT+ E++PRVQVMRG RR+G
Sbjct: 68  EWTVVGSELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTMGEKYPRVQVMRGERRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGPY+ A AIR+T+D LLRVFPVR+CSAGVFKRA SSGRPCLLGYIDKCSAPCVGR+
Sbjct: 128 TRYFGPYT-AGAIRETMDTLLRVFPVRSCSAGVFKRAESSGRPCLLGYIDKCSAPCVGRV 186

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             +E+R LAEDFC+FM GE  RF+                     +RDDI ALR V E+ 
Sbjct: 187 TPDEHRGLAEDFCSFMGGEAKRFISRLEKDMAAAVAELDYERAAGLRDDIIALRKVFERN 246

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL + TD DV A+ ED+LEA+VQVF+              +KVED +T +L+E  L Q
Sbjct: 247 AVVLAEDTDADVFALHEDELEASVQVFHXXXXXXXXXXXXXXEKVEDATTPELIEHLLQQ 306

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG  +D E    IPREVLV   P++   ++ WL   RGA VD+RVPQRGDK ALM TV 
Sbjct: 307 VYG--EDSEVQGRIPREVLVPENPSNHAELMEWLGGLRGARVDIRVPQRGDKAALMSTVR 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NAEQ L  HK++RA D+T RS                LRIECFDIS +QG + VASMVV
Sbjct: 365 ENAEQALKLHKTRRAGDITVRSXXXXXXXXXXXIPVPLLRIECFDISHVQGTNVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQR-----VGELDTLGE 482
            EDGL +KS+YR+FSI G          M++V++RRF  YL +         GE+     
Sbjct: 425 VEDGLPKKSDYRKFSITG-XXXXXXXXXMHDVLTRRFRHYLTDKAAQVPIVSGEIVNPTR 483

Query: 483 SGAPQGAER-------KAP--RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLA 533
           +GA  G E         AP  +FAYPPNLVVVDGG+PQV AA RAL +LGI+DV V GLA
Sbjct: 484 AGAKSGTELPPSDLDVPAPKAKFAYPPNLVVVDGGQPQVNAAARALAELGIDDVYVVGLA 543

Query: 534 KRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
           KRLEEVWLP  + P+ILPRTS+GLYLLQR+RDEAHRFAI++HR+KR KA+T SVLD +PG
Sbjct: 544 KRLEEVWLPDSDFPVILPRTSQGLYLLQRIRDEAHRFAITFHRQKRGKAMTVSVLDGVPG 603

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE-GGQRTQPENS 652
           LG  +R AL+ HFGS++++  A+  E+    GIG   A  + + L S E  G+R    N 
Sbjct: 604 LGEAKRKALVAHFGSLKKIKAASVEELTSAKGIGPALAAAVVQHLGSTEDAGERAPAVNM 663

Query: 653 KADE 656
              E
Sbjct: 664 TTGE 667


>UVRC_MYCGI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 678

 Score =  692 bits (1785), Expect = 0.0
 Identities = 369/649 (56%), Positives = 434/649 (66%), Gaps = 28/649 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D S L PRT+ M+ TA+
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADISGLAPRTRQMVMTAS 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV TEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTLNEE+PR++V RG RR
Sbjct: 66  SVEWTVVGTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEYPRLKVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+TVDLL RVFP RTCS GVFKR     RPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETVDLLTRVFPARTCSNGVFKRHSQIDRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R + +DFC F+AG+T R +R                    +RD+I A+R  ME
Sbjct: 186 RVSAEQHRQIVQDFCDFLAGKTDRLIREMEQQMTAAAEDLDFERAARLRDNIGAMRRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGK---LVE 302
           KQ VVLGD TD DV+A A+D+LEAA                WV++K  +        LVE
Sbjct: 246 KQTVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWVIEKSGEPGESTLEYLVE 305

Query: 303 QFLAQTYGGADDEESTTAIPREVLVS---------AEPADRDAVVAWLSKRRGAAVDVRV 353
           QFL Q YG                 +               D +  WLS+ RG+ V +RV
Sbjct: 306 QFLTQFYGDQXXXXXXXXXXXXXXXNXXXXXXXXXXXXETTDELETWLSQLRGSRVALRV 365

Query: 354 PQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDI 413
           PQRGDKRAL ETV +NAE  L +HK +RA D T RS               PLRIEC DI
Sbjct: 366 PQRGDKRALAETVKRNAEGALNQHKLKRAGDFTARSAALQSIQENLGLQDAPLRIECIDI 425

Query: 414 STLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEES 471
           S +QG   VAS+VVFEDGL RKS+YR F+IR A  +G   DVA++ EV  RRF R+L + 
Sbjct: 426 SHVQGTDVVASLVVFEDGLPRKSDYRHFAIREAAGDGRSDDVASIAEVTRRRFHRHLRDM 485

Query: 472 QRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCG 531
           Q  GE+           AE ++ RFAYPPNL VVDGG PQV AAQ  LDDLGI DVAV G
Sbjct: 486 QEPGEM----------VAEGRSRRFAYPPNLFVVDGGAPQVNAAQAVLDDLGISDVAVIG 535

Query: 532 LAKRLEEVWLPGEE----DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASV 587
           LAKRLEEVW+P  +    DPII PR S+GLYLLQRVRDEAHRFAISYHR KR+K +TAS 
Sbjct: 536 LAKRLEEVWVPNLDGTAPDPIIFPRNSDGLYLLQRVRDEAHRFAISYHRSKRSKRMTASA 595

Query: 588 LDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           LD + GLG  RR AL+ HFGS+ RL QAT  EI EVPGIG  TA+ + +
Sbjct: 596 LDSVRGLGEHRRKALVTHFGSLARLKQATVEEITEVPGIGAATARAVLD 644


>UVRC_ARTS2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 669

 Score =  692 bits (1785), Expect = 0.0
 Identities = 377/644 (58%), Positives = 456/644 (70%), Gaps = 15/644 (2%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP+ G IPT+PGVYRFRD HGRVIYVGKAK+LR+RL+SYF +   L P+T  M+  A+ V
Sbjct: 8   RPQTGEIPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPGGLLPKTYAMVHAASSV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           +WTVV +E+E+LQLEY+WIKE+ PRFNV +RDDK+YPYLAVT+ E+FPRVQV+RG RR+G
Sbjct: 68  EWTVVASELESLQLEYTWIKEFKPRFNVVFRDDKTYPYLAVTMGEKFPRVQVLRGERRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGPY+ A AIR+T+D LLRVFPVR+CS GV KRA++SGRPCLLGYIDKC+APCVGR+
Sbjct: 128 TRYFGPYT-AGAIRETMDTLLRVFPVRSCSPGVLKRAQASGRPCLLGYIDKCAAPCVGRV 186

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+RALAEDFC+FM GE  RF+                     +RDDI ALR V E+ 
Sbjct: 187 TPEEHRALAEDFCSFMGGEAKRFIGRLEKDMAAAVAELDYERAARVRDDIIALRKVFERN 246

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL + TD DV A+ ED+LEAAVQVF+              +KVED +T  LVE  L Q
Sbjct: 247 AVVLAEDTDADVFALHEDELEAAVQVFHXXXXXXXXXXXXXXEKVEDFTTPDLVEHLLQQ 306

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG  ++ E+   +PREVLV  EP++   +  WL+  RGA VD+RVP+RGDK ALM TV 
Sbjct: 307 VYG--EEGETQGRLPREVLVPEEPSNAAELAQWLAGLRGAKVDIRVPRRGDKAALMSTVR 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NAE  L  HKS+RA DLT RS                LRIECFDIS +QG + VASMVV
Sbjct: 365 ENAEHALKLHKSRRAGDLTNRSXXXXXXXXXXDLPVALLRIECFDISHVQGTNVVASMVV 424

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL-GESGA- 485
            EDGL +KS+YR+FSI GA   D D AAM++V++RRF  YL           L G   A 
Sbjct: 425 VEDGLPKKSDYRKFSITGAAAVD-DTAAMHDVLTRRFRNYLXXXXXXXXXXXLPGHQAAL 483

Query: 486 -------PQGAERKAPR--FAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL 536
                   Q     APR  FAYPPNLVVVDGG+PQV AA RAL +LGI+DV V GLAKRL
Sbjct: 484 EAMAVASMQDTTTPAPRAKFAYPPNLVVVDGGKPQVNAAARALAELGIDDVYVVGLAKRL 543

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           EEVWLP  + P+ILPRTSEGLYLLQR+RDEAHRFAI++HR+KR KA+T S LD +PGLG 
Sbjct: 544 EEVWLPDSDFPVILPRTSEGLYLLQRIRDEAHRFAITFHRQKRGKAMTVSALDSVPGLGE 603

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            +R ALL  FGSV+ +  A+AAE+A   GIG   A  I    ++
Sbjct: 604 AKRKALLAQFGSVKSIRTASAAELATAKGIGPSLADAIVSHFSN 647


>UVRC_RHOE4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 730

 Score =  690 bits (1780), Expect = 0.0
 Identities = 364/650 (56%), Positives = 438/650 (67%), Gaps = 27/650 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP  G+IP  PGVY+FRD HGRVIYVGKAK+LR+RL+SYF D + LHPRT+ M++TA 
Sbjct: 6   TYRPATGTIPAAPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVTTLHPRTRQMVTTAG 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFNVRYRDDK+YP LAVTLNEEFPR+ V RG RR
Sbjct: 66  XXXXXXXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEFPRLFVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLLLRVFP RTCS+GVFKR    GRPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLLRVFPARTCSSGVFKRHNQIGRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+R + EDFC F+AG T + ++                    +RDDI ALR  +E
Sbjct: 186 RVSAEEHRQIVEDFCDFLAGRTDKLVKDLEKRMQQASEDLDFETAARLRDDIGALRKALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV---------- 295
           KQAVVLGD TD D++A A D LEAAVQVF+              +K  D           
Sbjct: 246 KQAVVLGDGTDADLVAFATDDLEAAVQVFHXXXXXXXXXXXXXXEKAGDAIDWAALDAES 305

Query: 296 STGKLVEQFLAQTYG-------GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAA 348
               LVEQFL Q YG       GA  E   +A+P+EVLV   PA+   + AWLSK RG+ 
Sbjct: 306 DLPILVEQFLTQFYGEQAALDPGAGSEAGISAVPKEVLVPVLPANATEIQAWLSKLRGSQ 365

Query: 349 VDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRI 408
           V +RVPQRGDK+ L ETV +NA++ LA+HK +RA D T+RS               PLRI
Sbjct: 366 VQLRVPQRGDKKDLAETVQRNAKEALAQHKLKRAGDFTSRSAALQGIQEALDLDSAPLRI 425

Query: 409 ECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTR 466
           EC DIS +QG   VAS+VVFEDGL RKS+YR ++I+ A  +G   DVA++ E+  RRF R
Sbjct: 426 ECIDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIKEAAGDGHSDDVASIAEITRRRFIR 485

Query: 467 YLEE----SQRVGELDTLGESGAPQGAERKAP----RFAYPPNLVVVDGGRPQVAAAQRA 518
           +  +    +     +D  G   AP+ A   A     RFAYPPNL VVDGG PQV AA   
Sbjct: 486 HNRDLGILAASASTMDADGGDLAPEAAIDPATGRPRRFAYPPNLFVVDGGAPQVTAAAAV 545

Query: 519 LDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRK 578
           LD+LG+ DVAV GLAKRLEEVW+PGEEDP+ILPRTSE LYLLQR+RDEAHRFAI++HR K
Sbjct: 546 LDELGVTDVAVVGLAKRLEEVWVPGEEDPVILPRTSESLYLLQRIRDEAHRFAITFHRSK 605

Query: 579 RAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGE 628
           R++ +TAS LD + GLG  RR AL+ HFGSV +L  AT  EI +VPGIGE
Sbjct: 606 RSRRMTASALDSVKGLGETRRTALVAHFGSVAKLKTATVEEIMQVPGIGE 655


>UVRC_MYCSS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 676

 Score =  685 bits (1767), Expect = 0.0
 Identities = 366/655 (55%), Positives = 434/655 (66%), Gaps = 32/655 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D S L PRT+ M+ TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTLNEEFPR++V RG R+
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRK 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+TVDLL RVFP RTCSAGVFKR     RPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETVDLLTRVFPARTCSAGVFKRHNQIDRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R +  DFC F+AG+T R +R                    +RDDI ALR  +E
Sbjct: 186 RVSAEQHRQIVLDFCDFLAGKTDRLVRDLERKMTAAAEDLDFERAARLRDDIGALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVV---DKVEDVSTGKLVE 302
           KQ VV GD T                               W+V            +LVE
Sbjct: 246 KQTVVFGDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIVXXXXXXXXXXXXQLVE 305

Query: 303 QFLAQTY-------------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAV 349
           QFL Q Y             G +  +E+T  +PR+VLV   P + D +  WLS+ RG+ V
Sbjct: 306 QFLTQFYGDQAELGSAGDNAGDSGQDEATNPVPRQVLVPCLPDNADELTEWLSQLRGSRV 365

Query: 350 DVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
            +RVPQRGDK+AL ETV +NA++ LA+HK +RA D T R+               PLRIE
Sbjct: 366 ALRVPQRGDKKALFETVQRNAKEALAQHKLKRAGDFTARTAALQSIQDTLGLADAPLRIE 425

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRY 467
           C DIS +QG   VAS+VVFEDGL RKS+YR ++IR A  +G   DVA++ EV  RRF R+
Sbjct: 426 CIDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIREAAGDGRSDDVASIAEVTRRRFYRH 485

Query: 468 LEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDV 527
           L ++Q   EL           AE K+ +FAYPPNL VVDGG PQV AAQ  LD+LGI DV
Sbjct: 486 LHDTQHPTEL----------SAEGKSRKFAYPPNLFVVDGGAPQVNAAQAVLDELGISDV 535

Query: 528 AVCGLAKRLEEVWLPGEED----PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKAL 583
           AV GLAKRLEEVW+P   D    PIILPR SEGLYLLQRVRDEAHRFAI+YHR KR+K +
Sbjct: 536 AVIGLAKRLEEVWVPSGSDLGPEPIILPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRM 595

Query: 584 TASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           TAS LD + GLG  RR AL+ HFGSV RL +A+  EI  VPGIG  TA+ + E L
Sbjct: 596 TASALDSVRGLGEHRRKALVTHFGSVARLKEASVEEITAVPGIGVTTARAVLEAL 650


>UVRC_MYCSK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 676

 Score =  685 bits (1767), Expect = 0.0
 Identities = 366/655 (55%), Positives = 434/655 (66%), Gaps = 32/655 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D S L PRT+ M+ TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTLNEEFPR++V RG R+
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRK 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+TVDLL RVFP RTCSAGVFKR     RPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETVDLLTRVFPARTCSAGVFKRHNQIDRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R +  DFC F+AG+T R +R                    +RDDI ALR  +E
Sbjct: 186 RVSAEQHRQIVLDFCDFLAGKTDRLVRDLERKMTAAAEDLDFERAARLRDDIGALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVV---DKVEDVSTGKLVE 302
           KQ VV GD T                               W+V            +LVE
Sbjct: 246 KQTVVFGDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIVXXXXXXXXXXXXQLVE 305

Query: 303 QFLAQTY-------------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAV 349
           QFL Q Y             G +  +E+T  +PR+VLV   P + D +  WLS+ RG+ V
Sbjct: 306 QFLTQFYGDQAELGSAGDNAGDSGQDEATNPVPRQVLVPCLPDNADELTEWLSQLRGSRV 365

Query: 350 DVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
            +RVPQRGDK+AL ETV +NA++ LA+HK +RA D T R+               PLRIE
Sbjct: 366 ALRVPQRGDKKALFETVQRNAKEALAQHKLKRAGDFTARTAALQSIQDTLGLADAPLRIE 425

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRY 467
           C DIS +QG   VAS+VVFEDGL RKS+YR ++IR A  +G   DVA++ EV  RRF R+
Sbjct: 426 CIDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIREAAGDGRSDDVASIAEVTRRRFYRH 485

Query: 468 LEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDV 527
           L ++Q   EL           AE K+ +FAYPPNL VVDGG PQV AAQ  LD+LGI DV
Sbjct: 486 LHDTQHPTEL----------SAEGKSRKFAYPPNLFVVDGGAPQVNAAQAVLDELGISDV 535

Query: 528 AVCGLAKRLEEVWLPGEED----PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKAL 583
           AV GLAKRLEEVW+P   D    PIILPR SEGLYLLQRVRDEAHRFAI+YHR KR+K +
Sbjct: 536 AVIGLAKRLEEVWVPSGSDLGPEPIILPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRM 595

Query: 584 TASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           TAS LD + GLG  RR AL+ HFGSV RL +A+  EI  VPGIG  TA+ + E L
Sbjct: 596 TASALDSVRGLGEHRRKALVTHFGSVARLKEASVEEITAVPGIGVTTARAVLEAL 650


>UVRC_MYCSJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 676

 Score =  685 bits (1767), Expect = 0.0
 Identities = 366/655 (55%), Positives = 434/655 (66%), Gaps = 32/655 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D S L PRT+ M+ TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVVNTEVEALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTLNEEFPR++V RG R+
Sbjct: 66  KVEWTVVNTEVEALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEFPRLKVYRGPRK 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+TVDLL RVFP RTCSAGVFKR     RPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETVDLLTRVFPARTCSAGVFKRHNQIDRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R +  DFC F+AG+T R +R                    +RDDI ALR  +E
Sbjct: 186 RVSAEQHRQIVLDFCDFLAGKTDRLVRDLERKMTAAAEDLDFERAARLRDDIGALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVV---DKVEDVSTGKLVE 302
           KQ VV GD T                               W+V            +LVE
Sbjct: 246 KQTVVFGDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIVXXXXXXXXXXXXQLVE 305

Query: 303 QFLAQTY-------------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAV 349
           QFL Q Y             G +  +E+T  +PR+VLV   P + D +  WLS+ RG+ V
Sbjct: 306 QFLTQFYGDQAELGSAGDNAGDSGQDEATNPVPRQVLVPCLPDNADELTEWLSQLRGSRV 365

Query: 350 DVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
            +RVPQRGDK+AL ETV +NA++ LA+HK +RA D T R+               PLRIE
Sbjct: 366 ALRVPQRGDKKALFETVQRNAKEALAQHKLKRAGDFTARTAALQSIQDTLGLADAPLRIE 425

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRY 467
           C DIS +QG   VAS+VVFEDGL RKS+YR ++IR A  +G   DVA++ EV  RRF R+
Sbjct: 426 CIDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIREAAGDGRSDDVASIAEVTRRRFYRH 485

Query: 468 LEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDV 527
           L ++Q   EL           AE K+ +FAYPPNL VVDGG PQV AAQ  LD+LGI DV
Sbjct: 486 LHDTQHPTEL----------SAEGKSRKFAYPPNLFVVDGGAPQVNAAQAVLDELGISDV 535

Query: 528 AVCGLAKRLEEVWLPGEED----PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKAL 583
           AV GLAKRLEEVW+P   D    PIILPR SEGLYLLQRVRDEAHRFAI+YHR KR+K +
Sbjct: 536 AVIGLAKRLEEVWVPSGSDLGPEPIILPRNSEGLYLLQRVRDEAHRFAITYHRSKRSKRM 595

Query: 584 TASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           TAS LD + GLG  RR AL+ HFGSV RL +A+  EI  VPGIG  TA+ + E L
Sbjct: 596 TASALDSVRGLGEHRRKALVTHFGSVARLKEASVEEITAVPGIGVTTARAVLEAL 650


>UVRC_SACEN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 717

 Score =  684 bits (1766), Expect = 0.0
 Identities = 383/713 (53%), Positives = 456/713 (63%), Gaps = 66/713 (9%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IP  PGVYRF D  GRVIYVGKAK+LR+RLSSYF D S LHPRT+ M++TA 
Sbjct: 6   TYRPAPGTIPDAPGVYRFHDAEGRVIYVGKAKSLRSRLSSYFADLSGLHPRTRQMVTTAT 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V WTVV TEVEALQLEYSWIKEY PRFNVRYRDDKSYP LAVTL+E+FPR+ V RG RR
Sbjct: 66  GVRWTVVGTEVEALQLEYSWIKEYDPRFNVRYRDDKSYPVLAVTLHEDFPRLYVTRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPY++AWAIR+T+D+LLRVFP RTCSAGVFKR    GRPCLLGYI KCSAPCVG
Sbjct: 126 KGVRYFGPYAHAWAIRETLDMLLRVFPARTCSAGVFKRHSQIGRPCLLGYIGKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  +E+R + EDFC F AG T   +R                               ME
Sbjct: 186 RVDADEHRRIVEDFCDFFAGRTDTLIRKLDREMRQASXXXXXXXXXXXXXXXXXXXXXME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQAVVLGD TD DVIA A+D+L AAVQVF++          WV+DKVE+  T  L E+FL
Sbjct: 246 KQAVVLGDGTDADVIAFADDELAAAVQVFHIXXXXXXXXXXWVIDKVEETGTAALAERFL 305

Query: 306 AQTYG-----GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
            Q YG         +   T               +A+  WLS  RG  V VRVPQRGDKR
Sbjct: 306 TQFYGEQAALAEQADAGGTXXXXXXXXXXXXXXCEAITEWLSGLRGGRVAVRVPQRGDKR 365

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
           ALMETV +NA++   ++K +RA DLT RS               PLRIEC D+S +QG  
Sbjct: 366 ALMETVERNAKEAFTQYKLRRAGDLTARSAALQELQDALGLDTAPLRIECIDVSHVQGTD 425

Query: 421 TVASMVVFEDGLARKSEYRRFSIR-GAEGADSDVAAMYEVISRRFTRYLEESQ------- 472
            VAS+VVFEDG+ RKSEYRRF++R GAEG   DV ++ EV+ RRF RYL+E+        
Sbjct: 426 VVASLVVFEDGVPRKSEYRRFAVREGAEG--GDVGSIAEVVRRRFARYLKETAPPQEGGN 483

Query: 473 ---------RVGELDTLGESGA---------------------------------PQGAE 490
                      G  DT+  +G+                                 PQ AE
Sbjct: 484 GSAGATAAVENGSTDTVAANGSVGTAAGNGSAHTAAGNGLADTAAGEPEADVAVTPQEAE 543

Query: 491 R--------KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLP 542
           R        +  +FAYPPNL+V+DGG          L +LGI DVAV G+AKRLEEVWLP
Sbjct: 544 RTGIDPETGRPRKFAYPPNLLVIDGGXXXXXXXXXXLTELGITDVAVIGIAKRLEEVWLP 603

Query: 543 GEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAAL 602
            E +P+ILPRTSE LYLLQRVRD AH FAI YHR+KR+K + +S LD IPGLG  RR AL
Sbjct: 604 DEAEPVILPRTSEALYLLQRVRDAAHDFAIRYHRQKRSKRMKSSTLDSIPGLGEARRTAL 663

Query: 603 LKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENSKAD 655
           LKHFGS+RRL QAT  EI+ VPG G+RTA+T++  L +  GG     +N++ +
Sbjct: 664 LKHFGSLRRLRQATVEEISAVPGFGQRTAETVHAAL-AAGGGTGESRDNAEGE 715


>UVRC_KOCRD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 689

 Score =  679 bits (1753), Expect = 0.0
 Identities = 360/672 (53%), Positives = 436/672 (64%), Gaps = 31/672 (4%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           +P    IPT+PGVYRFRDEHGRVIYVGKAKNLR R+SSYF     L P+T+         
Sbjct: 8   KPARQDIPTNPGVYRFRDEHGRVIYVGKAKNLRNRVSSYFAPLHQLAPKTRXXXXXXXXX 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
                 +E E+LQLEY+WIKE++PRFN+ YRDDKSYPYLAVT++E+ PR  V RG ++ G
Sbjct: 68  XXXXXGSEFESLQLEYTWIKEFAPRFNIAYRDDKSYPYLAVTMSEDVPRAMVTRGEKKPG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGPYS AWAIRDT+D LLRVFPVRTC+ GV++RA  SGRPCLLGYIDKCSAPCVG I
Sbjct: 128 NRYFGPYSQAWAIRDTLDALLRVFPVRTCTTGVYQRAERSGRPCLLGYIDKCSAPCVGNI 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R LA+D C FMAG    ++R                     RDD+ AL  V E+ 
Sbjct: 188 SQEEHRELADDLCRFMAGHAKPYIRELTRQMNEAAECMDFETAAARRDDVGALERVFERN 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            VVL DSTD D  AIAED+LEAAVQVF+V          W+ +KVEDV+T +L+   L Q
Sbjct: 248 TVVLTDSTDADFFAIAEDELEAAVQVFHVXXXXXXXXXXWITEKVEDVTTAQLMTNLLQQ 307

Query: 308 TYGGADDEESTTA------------------------------IPREVLVSAEPADRDAV 337
            YG A    +  A                              IPR V VS  P + D +
Sbjct: 308 VYGEAQSGLAPAASGRRRTARHGSEDVVGQHRRTSELAYRQDTIPRAVHVSVLPDEADEI 367

Query: 338 VAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXX 397
            AWLS+ RG+ V V+ PQRGDK  L+ETV +NA Q L  HKS+RA DLTTRS        
Sbjct: 368 RAWLSELRGSQVTVQRPQRGDKAQLLETVAENARQALTLHKSRRAGDLTTRSASLQQLQE 427

Query: 398 XXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMY 457
                   +RIEC+DIS +QG + VASMVVFEDGL RKSEYR+FSI G + A  D A+MY
Sbjct: 428 ALGLPDALMRIECYDISHVQGTNVVASMVVFEDGLPRKSEYRKFSITG-DAARDDTASMY 486

Query: 458 EVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQR 517
           +VI RRF+R++E+ +R  E        A    E     FAYPPNLV+VDGG PQVAAAQR
Sbjct: 487 DVIHRRFSRHVEQQRRAAEKGVSTGEVAADDDEGTTRAFAYPPNLVIVDGGPPQVAAAQR 546

Query: 518 ALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRR 577
           ALDDL + DV V GLAKRLEEVW+P +E P+ILPR SEGL+L+QRVRDEAHRFAI++HR+
Sbjct: 547 ALDDLRVTDVHVVGLAKRLEEVWVPDDEFPVILPRASEGLFLMQRVRDEAHRFAITFHRQ 606

Query: 578 KRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYER 637
           KR+KA+T S LD++PGLGP ++ ALLKHFGSV++L  ATA +I EV G G   A  + + 
Sbjct: 607 KRSKAMTVSALDEVPGLGPAKQKALLKHFGSVKKLRAATAEQILEVKGFGPALAVKVAQA 666

Query: 638 LTSVEGGQRTQP 649
           L        T P
Sbjct: 667 LGGEAAASSTAP 678


>UVRC_CORJK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 690

 Score =  679 bits (1752), Expect = 0.0
 Identities = 352/686 (51%), Positives = 451/686 (65%), Gaps = 56/686 (8%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP+PGSIPTDPGVY FRD H RVIYVGKAKNLRARLS+YFQD   LHPRT+ M+ +A  V
Sbjct: 7   RPEPGSIPTDPGVYTFRDAHERVIYVGKAKNLRARLSNYFQDLDQLHPRTRAMVQSANHV 66

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
            WTVV++E+EAL LEY+WIK ++PRFNV YRDDK+YP LA+++ E+ PR  + RG RR+G
Sbjct: 67  QWTVVSSELEALNLEYTWIKRFNPRFNVMYRDDKTYPMLAISVKEQIPRAFMYRGPRRKG 126

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY  AWAIR+T++ L RVFP+RTCSAGV++R  + GRPCLLGYID+CSAPCVG+I
Sbjct: 127 VRYFGPYPKAWAIRETLESLTRVFPIRTCSAGVYRRHEALGRPCLLGYIDRCSAPCVGKI 186

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             E++RAL + F +F+AG T   LR                    +RD +QA++  ME+Q
Sbjct: 187 TPEDHRALVDQFSSFLAGNTEPVLRRVRKEMEQASENLDFERAASLRDQLQAMQKSMERQ 246

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVV  D+TD D+IA   D+LEAAVQ+F+VRGGRI G+RGWVV++ ED+S  KLV  F+ Q
Sbjct: 247 AVVFSDNTDADLIAFVADELEAAVQIFHVRGGRIHGQRGWVVER-EDLSEEKLVADFITQ 305

Query: 308 TY--------------GGADDEE------------------------STTAIPREVLVSA 329
            Y              GGA   E                          T +PRE+LV A
Sbjct: 306 FYGETAELAKATETQVGGASGPEVDRDLARAINPAAAQDLGDLVGDVQVTPVPREILVHA 365

Query: 330 EPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRS 389
            P D D + AWL+  RG+ + +RVPQRGDK+ALM T   NA Q LA+HK +RA D+T RS
Sbjct: 366 MPDDADDLAAWLTSLRGSNMQIRVPQRGDKKALMTTAETNATQALAQHKLKRAGDITARS 425

Query: 390 KXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--E 447
                          PLRIEC DIS +QG   VAS+VVFEDGL +K++YRR+ IR A  +
Sbjct: 426 AALKELQEALWMDESPLRIECTDISHIQGTDVVASLVVFEDGLPKKADYRRYKIRDAAGD 485

Query: 448 GADSDVAAMYEVISRRFTRYLEESQRVGELDTL-------------GESGAPQGAERKAP 494
           G   DVA++ EV+ RRF RY ++   V                      G     E++  
Sbjct: 486 GHSDDVASIAEVVRRRFKRYQQDKSAVPXXXXXXXXXXXXXXXXXNSAEGTDPATEKR-- 543

Query: 495 RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTS 554
           +FAYPP L +VDGG PQV AAQ  LD+LG+ DV + G+AKRLEE+W+PGEE PII+PR S
Sbjct: 544 KFAYPPQLFIVDGGLPQVNAAQEVLDELGVNDVTLVGIAKRLEEIWVPGEEYPIIVPRNS 603

Query: 555 EGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQ 614
             LYL+Q +RDEAHRFAI++HR++R+  +  S LDDIPGLGP RR  L+K FGSV R+ +
Sbjct: 604 PALYLVQNLRDEAHRFAITFHRQQRSARMRRSKLDDIPGLGPKRRKQLVKEFGSVARVKE 663

Query: 615 ATAAEIAEVPGIGERTAQTIYERLTS 640
           A+  +IA +PG G + AQ I++ L +
Sbjct: 664 ASVEDIAALPGFGPKLAQLIHDALNA 689


>UVRC_RHOSR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 727

 Score =  678 bits (1750), Expect = 0.0
 Identities = 371/672 (55%), Positives = 441/672 (65%), Gaps = 35/672 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP  G+IP DPGVY+FRD HGRVIYVGKAK+LR+RL+SYF D S LHPRT+ M++TA 
Sbjct: 6   TYRPATGTIPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHPRTRQMVTTAG 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFNVRYRDDK+YP LAVTLNEE+PR+ V RG RR
Sbjct: 66  XXXXXXXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEYPRLFVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLLLRVFP RTCSAGVFKR    GRPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLLRVFPARTCSAGVFKRHNQIGRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   E+R + EDFC F++G T R +R                    +RDD+ ALR  +E
Sbjct: 186 RVSAAEHRKIVEDFCDFLSGRTDRLVRQLEARMQEASEELDFETAARLRDDVGALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV---------- 295
           KQAVVLGD TD DV A A D+LEAAVQVF+              +K  DV          
Sbjct: 246 KQAVVLGDGTDADVAAFATDELEAAVQVFHXXXXXXXXXXXXXXEKAGDVIDWASVDSEA 305

Query: 296 --STGKLVEQFLAQTYG------GADDEES-TTAIPREVLVSAEPADRDAVVAWLSKRRG 346
                 LVEQFL Q YG      GA D+E+ T+             D + V  WLS  RG
Sbjct: 306 GSDLPLLVEQFLTQFYGEQAALSGATDQEAGTSGXXXXXXXXXXXXDAEQVQEWLSGLRG 365

Query: 347 AAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL 406
           +AV +RVPQRGDK+AL ETV +NA + L +HK +RA D T+RS               PL
Sbjct: 366 SAVRLRVPQRGDKKALAETVQRNATEALQQHKLRRAGDFTSRSAALQGIQEALDLDSAPL 425

Query: 407 RIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRF 464
           RIEC DIS +QG   VAS+VVFEDGL RKS+YR ++I+ A  +G   DVA++ EV  RRF
Sbjct: 426 RIECVDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIKEAAGDGRSDDVASIAEVTRRRF 485

Query: 465 TRY------LEESQRVGELDTL--GESG--APQGA----ERKAPRFAYPPNLVVVDGGRP 510
            R+      L       + D +  G+ G  AP+ A      +  RFAYPPNL VVDGG P
Sbjct: 486 LRHNRDVGVLRAEAAGADADQVSGGDGGDLAPEAAIDPQTGRPRRFAYPPNLFVVDGGAP 545

Query: 511 QVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRF 570
           QVAAA   LD+LGI DVAV GLAKRLEEVW+PGEEDP+ILPRTSE LYLLQRVRDEAHRF
Sbjct: 546 QVAAASAVLDELGITDVAVIGLAKRLEEVWVPGEEDPVILPRTSESLYLLQRVRDEAHRF 605

Query: 571 AISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT 630
           AI++HR KR++ +TAS LD + GLG  RR AL+ HFGSV RL QA+  EI  VPGIG  T
Sbjct: 606 AITFHRSKRSRRMTASALDSVRGLGETRRKALVTHFGSVARLKQASVEEITAVPGIGTAT 665

Query: 631 AQTIYERLTSVE 642
           A+ +   L + E
Sbjct: 666 AKAVLTALGAEE 677


>UVRC_RHOOB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 743

 Score =  669 bits (1727), Expect = 0.0
 Identities = 370/691 (53%), Positives = 442/691 (63%), Gaps = 57/691 (8%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP  G+IP DPGVY+FRD HGRVIYVGKAK+LR+RL+SYF D S LHPRT+ M++TA 
Sbjct: 6   TYRPATGTIPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHPRTRQMVTTAG 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFNVRYRDDK+YP LAVTLNEE+PR+ V RG RR
Sbjct: 66  XXXXXXXXXXXXALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEYPRLFVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLLLRVFP RTCSAGVFKR    GRPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLLRVFPARTCSAGVFKRHNQIGRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   E+R + EDFC F++G T + +R                    +RDD+ ALR  +E
Sbjct: 186 RVSAAEHRKIVEDFCDFLSGRTDKLVRQLEARMQQASEELDFETAARLRDDVGALRRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV--------ST 297
           KQAVVLGD TD DV A A D+LEAAVQVF+              +K  DV        + 
Sbjct: 246 KQAVVLGDGTDADVAAFATDELEAAVQVFHXXXXXXXXXXXXXXEKAGDVIDWAAVDSAA 305

Query: 298 GK----LVEQFLAQTY-------GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRG 346
           G     LVEQFL Q Y       G AD E  ++             D + V  WLS  RG
Sbjct: 306 GSDLPLLVEQFLTQFYGEQAALSGAADQEAGSSGXXXXXXXXXXXXDAEQVQEWLSGLRG 365

Query: 347 AAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL 406
           +AV +RVPQRGDK+AL ETV +NA + L +HK +RA D T+RS               PL
Sbjct: 366 SAVRLRVPQRGDKKALAETVQRNAMEALQQHKLRRAGDFTSRSAALQGIQEALDLDSAPL 425

Query: 407 RIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRF 464
           RIEC DIS +QG   VAS+VVFEDGL RKS+YR ++I+ A  +G   DVA++ EV  RRF
Sbjct: 426 RIECVDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIKEAAGDGRSDDVASIAEVTRRRF 485

Query: 465 TRYLEESQRVGEL-------------DTLGESG----------------APQGA----ER 491
            R+   ++ VG L             DT G+                  AP+ A      
Sbjct: 486 LRH---NRDVGVLRAEAAGADGDQASDTDGDQXXXXXXXXXXXXXXXXLAPEAAIDPQTG 542

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILP 551
           +  RFAYPPNL VVDGG PQVAAA   LD+LGI DVAV GLAKRLEEVW+PGEEDP+ILP
Sbjct: 543 RPRRFAYPPNLYVVDGGAPQVAAASAVLDELGITDVAVIGLAKRLEEVWVPGEEDPVILP 602

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
           RTSE LYLLQRVRDEAHRFAI++HR KR++ +TAS LD + GLG  RR AL+ HFGSV +
Sbjct: 603 RTSESLYLLQRVRDEAHRFAITFHRSKRSRRMTASALDSVRGLGETRRKALVTHFGSVAK 662

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           L QA+  EI  VPGIG  TA+ +   L + E
Sbjct: 663 LKQASVEEITAVPGIGTATAKAVLTALGAEE 693


>UVRC_MYCVP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 678

 Score =  669 bits (1726), Expect = 0.0
 Identities = 374/670 (55%), Positives = 447/670 (66%), Gaps = 22/670 (3%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D S L PRT+ M+ TAA
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLAPRTRQMVMTAA 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFN+RYRDDKSYP LAVTLNEE+PR++V RG RR
Sbjct: 66  XXXXXXXXXXXXALQLEYNWIKEFDPRFNIRYRDDKSYPVLAVTLNEEYPRLKVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCS GVFKR     RPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSNGVFKRHSQIDRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+R +  DFC F+AG+T R +R                    +RD+I A+R  ME
Sbjct: 186 RVSAEEHRRIVLDFCDFLAGKTDRLIRXXXXXXXXXXXXLDFERAARLRDNIGAMRRAME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK---VEDVSTGKLVE 302
           KQ VVLGD TD DV+A A+D+LEAA                WV++K     + +   LVE
Sbjct: 246 KQTVVLGDGTDADVVAFADDELEAAXXXXXXXXXXXXXXXXWVIEKSGEPGESTPAYLVE 305

Query: 303 QFLAQTYG-----GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           QFL Q YG     G   +E+T                + +  WLS+ RG+ V +RVPQRG
Sbjct: 306 QFLTQFYGDQAELGGAADEATNXXXXXXXXXXXXDTTEELETWLSQLRGSRVSLRVPQRG 365

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
           DKRAL ETV +NAEQ L +HK +RA D T RS               PLRIEC DIS +Q
Sbjct: 366 DKRALAETVKRNAEQALTQHKLKRAGDFTARSAALQSIQEALGLADAPLRIECVDISHVQ 425

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRV- 474
           G   VAS+VVFEDGL RKS+YR F+IR A  +G   DVA++ EV  RRF R+L +++   
Sbjct: 426 GTDVVASLVVFEDGLPRKSDYRHFAIREAAGDGRSDDVASIAEVTRRRFHRHLRDAEAAP 485

Query: 475 ------GELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVA 528
                 G   +      P+ + R A RFAYPPNL VVDGG PQV AA   LD+LGI DVA
Sbjct: 486 EGRPEQGPRASARPEQGPRASARPA-RFAYPPNLFVVDGGAPQVNAAAAVLDELGISDVA 544

Query: 529 VCGLAKRLEEVWLPGEE----DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALT 584
           V GLAKRLEEVW+P  +    DP+I PR S+GLYLLQRVRDEAHRFAISYHR KR+K +T
Sbjct: 545 VIGLAKRLEEVWVPNLDGTAPDPVIFPRNSDGLYLLQRVRDEAHRFAISYHRSKRSKRMT 604

Query: 585 ASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
           AS LD + GLG  RR AL+ HFGS+ RL QA+  EI  VPGIG  TA+ + E L +  G 
Sbjct: 605 ASALDSVRGLGEHRRKALVTHFGSLARLKQASVDEITAVPGIGAATARAVLEALGADSGA 664

Query: 645 QRTQPENSKA 654
             T   N ++
Sbjct: 665 APTDIGNDQS 674


>UVRC_CORDI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 687

 Score =  656 bits (1693), Expect = 0.0
 Identities = 340/672 (50%), Positives = 438/672 (65%), Gaps = 39/672 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IPT+PGVY+FRD  GRVIYVGKA NLR+RLS+YFQD S LHPRT+ M++TA 
Sbjct: 6   TYRPAPGTIPTEPGVYKFRDPEGRVIYVGKAINLRSRLSNYFQDLSVLHPRTRQMVTTAT 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            V+WTVV +EVEALQLEY+WIK++ P FNV+YRDDK+YP LAV++ E FPR    RG +R
Sbjct: 66  SVEWTVVASEVEALQLEYTWIKKFDPHFNVKYRDDKTYPVLAVSVGERFPRAYFYRGPQR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRY+GPYS+AWA+R+T+DLL RVFP+RTC+  VF R  S GRPCLLGYIDKCSAPC+G
Sbjct: 126 KGVRYYGPYSHAWAVRETLDLLTRVFPIRTCTKAVFNRHESLGRPCLLGYIDKCSAPCIG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+   E+R + + FC+FMAG T   +R                     RDD+ A+R + E
Sbjct: 186 RVSESEHRIIVDGFCSFMAGNTDSVVRRLTNEMISASEALDFEKAARKRDDLNAVRKITE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVED----------- 294
           +QAVVLGD T           LEA++Q+F+VR G+IRG+RGW+V++ ++           
Sbjct: 246 QQAVVLGDGTXXXXXXXXXXXLEASIQLFHVRSGKIRGQRGWIVERTDNXXXXXXXXXXX 305

Query: 295 ----------VSTGKLVEQFLAQTYGGADDEE----------STTAIPREVLVSAEPADR 334
                         ++ ++ L     G D +           +T+ +P+EVLV   PA+ 
Sbjct: 306 XXIRFYSDEVAHEDQVSDKELTVARRGVDKQSHESDLANRRINTSVVPKEVLVHKAPANV 365

Query: 335 DAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXX 394
           +   A L   R + VDVRVPQRGDKRAL +TV  NA++ L +HK +R SDLTTRS     
Sbjct: 366 EQTTAVLRSLRHSNVDVRVPQRGDKRALADTVFANAQEALRQHKIKRVSDLTTRSAALQE 425

Query: 395 XXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSD 452
                     PLRIEC DIS +QG   VAS+VVFEDGL +KS+YRR+ I+ A  EG  +D
Sbjct: 426 IHEALGLDEPPLRIECTDISHIQGTDVVASLVVFEDGLPKKSDYRRYKIKEAAGEGKSND 485

Query: 453 VAAMYEVISRRFTRYLEESQRVGELDTL------GESGAPQGAERKAPRFAYPPNLVVVD 506
           V ++ EV+ RRF RY  + + V + D         ES A +       RFAY P L +VD
Sbjct: 486 VGSIAEVVRRRFARYKNDCRMVPQEDEFDGSRFEDESLAGENTVAAKQRFAYSPQLFIVD 545

Query: 507 GGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDE 566
           GG PQVAAAQ  LD+LGI DVA+ G+AKRLEE+WLPGEEDP+ILPR S+GLYL+Q++RDE
Sbjct: 546 GGAPQVAAAQDVLDELGITDVALIGIAKRLEEIWLPGEEDPLILPRNSQGLYLIQQLRDE 605

Query: 567 AHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGI 626
           AHRFAI++H           +LDDI GLGP RR  L+ HFGSV+ L +A+ +EI  V GI
Sbjct: 606 AHRFAITFHXXXXXXXXXXXILDDIKGLGPARRKVLVAHFGSVKELKKASESEIMMVNGI 665

Query: 627 GERTAQTIYERL 638
           G   A +IY  L
Sbjct: 666 GPALAHSIYVAL 677


>UVRC_MYCS2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 706

 Score =  647 bits (1669), Expect = 0.0
 Identities = 353/673 (52%), Positives = 422/673 (62%), Gaps = 35/673 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PGSIP +PGVYRFRD HGRVIYVGKAK+LR+RL+SYF D ++L PRT+ M+ TA 
Sbjct: 6   TYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITSLAPRTRQMVMTAG 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                       ALQLEY+WIKE+ PRFNVRYRDDKSYP LAVTLNEE+PR+ V RG RR
Sbjct: 66  SXXXXXXXXXXXALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEYPRLMVYRGPRR 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWAIR+T+DLL RVFP RTCSAGVFKR +   RPCLLGYIDKCSAPCVG
Sbjct: 126 KGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHKQIDRPCLLGYIDKCSAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  E++R +  DFC F+ G+T R  +                    +RDDI AL+  +E
Sbjct: 186 RVSAEQHRQIVLDFCDFLGGKTDRLAKDMEQQMTAAAEQLDFERAARLRDDISALKRALE 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK-VEDVSTG------ 298
           KQAVV GD T                               W+V+K  E  +TG      
Sbjct: 246 KQAVVFGDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIVEKSSEPAATGDADLGQ 305

Query: 299 ----KLVEQFLAQTY------GGADD---EESTTAIPREVLVSAEPADRDAVVAWLSKRR 345
               +LVEQFL Q Y      G A D   +E+T              + D +  WLS  R
Sbjct: 306 SGQEQLVEQFLTQFYGEQAELGSASDTGGDEATNXXXXXXXXXXXXXNADELATWLSGLR 365

Query: 346 GAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXP 405
           G+ V +RVP RGDKRAL ETV +NA++ LA+HK +RA D   RS+              P
Sbjct: 366 GSRVSLRVPVRGDKRALAETVQRNAQEALAQHKLKRAGDFNARSEALQSIQEALGLADAP 425

Query: 406 LRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EGADSDVAAMYEVISRR 463
           LRIEC DIS +QG   VAS+VVFEDGL RKS+YR ++IR A  +G   DVA++ EV  RR
Sbjct: 426 LRIECVDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIREAAGDGRSDDVASIAEVTRRR 485

Query: 464 FTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG 523
           F R+  +SQ                AE++  RFAYPPNL VVDGG PQV AA   L+DLG
Sbjct: 486 FLRHTSDSQ------------PDPSAEQRPRRFAYPPNLFVVDGGAPQVNAAAAVLEDLG 533

Query: 524 IEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKAL 583
           ++DVAV GLAKRLEEVW+P E DP+ILPR SEGLYLLQRVRDEAHRFAISYHR KR+K +
Sbjct: 534 VDDVAVIGLAKRLEEVWVPSEPDPVILPRNSEGLYLLQRVRDEAHRFAISYHRSKRSKRM 593

Query: 584 TASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL-TSVE 642
           TAS LD + GLG  RR AL+ HFGSV RL +AT  EI  VPGIG  TA+ + E L  + +
Sbjct: 594 TASALDSVRGLGEHRRKALVAHFGSVARLKEATVDEITAVPGIGVATARAVQEALGVAPQ 653

Query: 643 GGQRTQPENSKAD 655
            G    P     D
Sbjct: 654 NGTAPDPAPGTGD 666


>UVRC_CORA7 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 684

 Score =  637 bits (1642), Expect = 0.0
 Identities = 355/674 (52%), Positives = 443/674 (65%), Gaps = 43/674 (6%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RP PGSIPTDPGVY+FRDE+ RVIYVGKAKNLRARLS+YFQD + LHPRT+ M+ TAA V
Sbjct: 8   RPAPGSIPTDPGVYKFRDENRRVIYVGKAKNLRARLSNYFQDITQLHPRTRQMVLTAASV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           +WTVV +EVEALQLEY+WIK + PRFNV YRDDK+YP LAV++ E  PR    RG RR+G
Sbjct: 68  EWTVVASEVEALQLEYTWIKRFDPRFNVMYRDDKTYPMLAVSVGESIPRAFFYRGPRRKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPYS+AWA+R+++DLL R+FP+RTC+ GVF R    GRPCLLGYI KC APC+GR+
Sbjct: 128 VRYFGPYSHAWAVRESLDLLTRIFPMRTCAKGVFNRHERLGRPCLLGYIGKCDAPCIGRV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R       +FM G T    +                      DD+ A+  +ME+Q
Sbjct: 188 SPEEHRETVNQLISFMNGNTAPVRKRVTQXXXXXXXXXXXXXXXXXXDDLGAIDKLMEQQ 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ---- 303
           AVVL D TD D+IA + D+LEAAVQ+F+VR GRIRG+RGWVV++  D +T  +VE+    
Sbjct: 248 AVVLPDGTDADLIAFSSDELEAAVQIFHVRTGRIRGQRGWVVERSGDQATTDVVEEGQAD 307

Query: 304 ---------FLAQTYG-------------------GADDEEST-----TAIPREVLVSAE 330
                    FL Q Y                    G D E         AIPRE+LV A 
Sbjct: 308 PGLPALIQNFLIQFYSDAVERQRQEAAEDAKLERRGVDQESHAEPRQGNAIPREILVQAL 367

Query: 331 PADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSK 390
           P             RGA +DVRVPQRGDKRAL+ETV +NA++ L +HK +R  DLT RS 
Sbjct: 368 PXXXXXXXXXXXXXRGAQIDVRVPQRGDKRALLETVERNAKEQLKQHKLKRVGDLTARSA 427

Query: 391 XXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGA--EG 448
                         PLRIEC DIS +QG   VAS+VVFEDGL RKS+YRR+ I+ A  +G
Sbjct: 428 ALQELQEALGMDSAPLRIECTDISHIQGTDVVASLVVFEDGLPRKSDYRRYRIKEAAGDG 487

Query: 449 ADSDVAAMYEVISRRFTRYLEESQRVG----ELDTLGESGAPQGAERKAPRFAYPPNLVV 504
             +DV ++ EV              V     E  T  E    + A  +  R +YPP L +
Sbjct: 488 RSNDVGSIAEVTXXXXXXXXXXXXAVPDEELENTTFAEEMVREEAASQTKRSSYPPQLFI 547

Query: 505 VDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVR 564
           VD             D+LGI DV + GLAKRLEEVW+PG+++P+ILPR S+ L+LLQ +R
Sbjct: 548 VDXXXXXXXXXXXXFDELGIVDVTLIGLAKRLEEVWVPGDDEPVILPRNSQALFLLQHLR 607

Query: 565 DEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVP 624
           DEAHR AISYHR++R+K + +SVLD +PGLGP RR  L+KHFGSV++L +A+  EIAEV 
Sbjct: 608 DEAHRVAISYHRQQRSKRMRSSVLDAVPGLGPQRRTDLVKHFGSVKKLKEASVEEIAEVK 667

Query: 625 GIGERTAQTIYERL 638
           G G + AQT+++ L
Sbjct: 668 GFGPKLAQTVFDHL 681


>UVRC_CORGB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 696

 Score =  625 bits (1613), Expect = 0.0
 Identities = 336/687 (48%), Positives = 428/687 (62%), Gaps = 54/687 (7%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IPT+PGVY+FRDE+ RVIYVGKAKNLR+RLS+YFQD + LHPRT+ M+    
Sbjct: 6   TYRPAPGTIPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHPRTRQMVFXXX 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                        LQLEY+WIK + PRFNV+YRDDK+YP LAV+  E             
Sbjct: 66  XXXXXXXXXXXXXLQLEYTWIKRFDPRFNVKYRDDKTYPMLAVSTGEXXXXXXXXXXXXX 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWA+R+T+DLL RVFP+RTCS GVF R  S GRPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYFGPYSHAWAVRETLDLLTRVFPMRTCSKGVFNRHESLGRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+R + + F +FMAG T +  R                    +RDD++A+  VME
Sbjct: 186 RVSEEEHREIVDGFTSFMAGHTDKVTRKLNADMMAAAEELDFERAARLRDDLEAIDKVME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK-------VEDVSTG 298
           KQAVVLGD TD D+IA A DQLEAAVQVF            WVVDK       + D +T 
Sbjct: 246 KQAVVLGDGTDADIIAFATDQLEAAVQVFNXXXXXXXXXXXWVVDKPGDYAGLLVDATTQ 305

Query: 299 K-------------LVEQFLAQTYGGADDEESTTA------------------------- 320
                         L++ FL Q YG A +   T A                         
Sbjct: 306 PEGDAPETDPALPFLMQDFLVQFYGDAVERAETEAKEDAAVIERRGVDKHSFEEAAPVTR 365

Query: 321 ---IPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +PRE+LV   P + +  +  L + RGA VD RVPQRGDKRALMETV +NA++ L +H
Sbjct: 366 ASVVPREILVQVAPNEAEQTLKVLEELRGAGVDARVPQRGDKRALMETVERNAKELLKQH 425

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
           K +R  DLT RS               PLRIEC DIS +QG   VAS+VVFEDGL RKS+
Sbjct: 426 KLKRVGDLTARSAALQELQEALDMEQAPLRIECTDISHIQGTDVVASLVVFEDGLPRKSD 485

Query: 438 YRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGELDTL-GESGAPQGAER--- 491
           YRR+ ++ A  +G  +DVA++ E+  RRF R+ ++   V E +   G + + +  E    
Sbjct: 486 YRRYRVKEAAGDGHSNDVASIAEITRRRFLRHNQDKLAVPEAEEFDGSTFSDEKVEEMST 545

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILP 551
            A RFAYPP + +VDGG PQVAAAQ   D+LGI DV + GLAKRLEE+WLPG+ DP+ILP
Sbjct: 546 DARRFAYPPQIFIVDGGAPQVAAAQEVFDELGIVDVVLIGLAKRLEEIWLPGDPDPVILP 605

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
           R S+ L+LLQ++RDEAHRFAI+YHR++R+K +  S LD I GLG  RR  L+KHFGSV +
Sbjct: 606 RNSQALFLLQQIRDEAHRFAITYHRQQRSKRMRVSELDSIKGLGQSRRTELVKHFGSVAK 665

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERL 638
           L +A+  +I++V G G + A+ +YE L
Sbjct: 666 LKEASVEDISQVKGFGPKLAEAVYEGL 692


>UVRC_CORGL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 696

 Score =  624 bits (1609), Expect = 0.0
 Identities = 335/687 (48%), Positives = 428/687 (62%), Gaps = 54/687 (7%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T RP PG+IPT+PGVY+FRDE+ RVIYVGKAKNLR+RLS+YFQD + LHPRT+ M+    
Sbjct: 6   TYRPAPGTIPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHPRTRQMVFXXX 65

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
                        LQLEY+WIK + PRFNV+YRDDK+YP LAV+  E             
Sbjct: 66  XXXXXXXXXXXXXLQLEYTWIKRFDPRFNVKYRDDKTYPMLAVSTGEXXXXXXXXXXXXX 125

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
           +GVRYFGPYS+AWA+R+T+DLL RVFP+RTCS GVF R  S GRPCLLGYIDKC+APCVG
Sbjct: 126 KGVRYFGPYSHAWAVRETLDLLTRVFPMRTCSKGVFNRHESLGRPCLLGYIDKCAAPCVG 185

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           R+  EE+R + + F +FMAG T +  R                    +RDD++A+  VME
Sbjct: 186 RVSEEEHREIVDGFTSFMAGHTDKVTRKLNADMMAAAEELDFERAARLRDDLEAIDKVME 245

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK-------VEDVSTG 298
           KQAVVLGD TD D+IA A DQLEAAVQVF            WVV+K       + D +T 
Sbjct: 246 KQAVVLGDGTDADIIAFATDQLEAAVQVFNXXXXXXXXXXXWVVEKPGDYAGLLVDATTQ 305

Query: 299 K-------------LVEQFLAQTYGGADDEESTTA------------------------- 320
                         L++ FL Q YG A +   T A                         
Sbjct: 306 PEGDAPETDPALPFLMQDFLVQFYGDAVERAETEAKEDAAVIERRGVDKHSFEEAAPVTR 365

Query: 321 ---IPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +PRE+LV   P + +  +  L + RGA VD RVPQRGDKRALMETV +NA++ L +H
Sbjct: 366 ASVVPREILVQVAPNEAEQTLKVLEELRGAGVDARVPQRGDKRALMETVERNAKELLKQH 425

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
           K +R  DLT RS               PLRIEC DIS +QG   VAS+VVFEDGL RKS+
Sbjct: 426 KLKRVGDLTARSAALQELQEALDMEQAPLRIECTDISHIQGTDVVASLVVFEDGLPRKSD 485

Query: 438 YRRFSIRGA--EGADSDVAAMYEVISRRFTRYLEESQRVGELDTL-GESGAPQGAER--- 491
           YRR+ ++ A  +G  +DVA++ E+  RRF R+ ++   V E +   G + + +  E    
Sbjct: 486 YRRYRVKEAAGDGHSNDVASIAEITRRRFLRHNQDKLAVPEAEEFDGSTFSDEKVEEMST 545

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILP 551
            A RFAYPP + +VDGG PQVAAAQ   D+LGI DV + GLAKRLEE+WLPG+ DP+ILP
Sbjct: 546 DARRFAYPPQIFIVDGGAPQVAAAQEVFDELGIVDVVLIGLAKRLEEIWLPGDPDPVILP 605

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
           R S+ L+LLQ++RDEAHRFAI+YHR++R+K +  S LD I GLG  RR  L+KHFGSV +
Sbjct: 606 RNSQALFLLQQIRDEAHRFAITYHRQQRSKRMRVSELDSIKGLGQSRRTELVKHFGSVAK 665

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERL 638
           L +A+  +I++V G G + A+ +YE L
Sbjct: 666 LKEASVEDISQVKGFGPKLAEAVYEGL 692


>UVRC_LEIXX RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 656

 Score =  614 bits (1584), Expect = e-178
 Identities = 336/657 (51%), Positives = 419/657 (63%), Gaps = 37/657 (5%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RPK G IPT PGVYRFRD+  RV+YVGKAKNLRARLS+YFQ   +LH RT+ M++TAA V
Sbjct: 8   RPKAGEIPTQPGVYRFRDKTRRVLYVGKAKNLRARLSNYFQPLRSLHERTRRMVTTAASV 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           +WTVV +E EALQLEY+WIKEY+P FNV++RDDKSYPYLAVTL E  PRV V R    +G
Sbjct: 68  EWTVVGSEFEALQLEYTWIKEYNPPFNVQFRDDKSYPYLAVTLGERIPRVLVTRNRIAKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            RYFGPY+  WAIRDTVDL+L+ FPVR+CS GV++RA  +GRPCLLG I KC+ PCVGR+
Sbjct: 128 ARYFGPYTKVWAIRDTVDLMLKAFPVRSCSDGVYRRAELTGRPCLLGDIGKCAGPCVGRV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R LAEDF +FMAG+  + +R                     RD IQAL   M K 
Sbjct: 188 TPEEHRRLAEDFVSFMAGDDSKHIRDLTEKMKQAAGTMDYEAAARHRDAIQALEAAMGKS 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
           AVVL D+ D D   I  D+L AAVQ F            WVVDK  DV  G+L+E  +  
Sbjct: 248 AVVLQDNVDLDAFGIGHDELAAAVQQFXXXXXXXXXXXSWVVDKELDVELGELIETVMQN 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRR------------------GAAV 349
            Y GAD      A PRE+LV   P D   +  WL+ RR                     V
Sbjct: 308 AYEGAD------APPREILVPVLPDDAAELGQWLTGRRHENSGGGVSDPAATRGRLSGRV 361

Query: 350 DVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
           +++V QRGDK AL +T   NA+  L  +K++R+SD   RSK              PLR+E
Sbjct: 362 ELKVAQRGDKAALAQTAEMNAKNALILYKTRRSSDFVARSKAFSDIQDALGMEDAPLRME 421

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLE 469
           C+D+S L   + VASMVVFEDGL RK +YRRFSI   E AD D  ++Y+VISRR   YL 
Sbjct: 422 CYDVSHLSRTNIVASMVVFEDGLPRKDQYRRFSI--PESAD-DTESIYQVISRRLA-YLR 477

Query: 470 ESQRV--------GELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDD 521
           +   V         +L T  +            +FAYPPNL++VDGG+PQVAAA+RAL++
Sbjct: 478 KEPPVEALTPANGHDLATDLDXXXXXXXXXXXKKFAYPPNLLIVDGGQPQVAAARRALEE 537

Query: 522 LGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAK 581
            G+  V + G+AKRLEEVWLPG + P+ILPR S+ L+L+QR+RDEAHRFAI+Y R +R +
Sbjct: 538 SGVSGVHLAGIAKRLEEVWLPGSDFPVILPRNSDALFLIQRIRDEAHRFAITYQRSRRKR 597

Query: 582 ALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            +T +VL +IPGLGP R   LLKHFGSV +L +A   EIAEV G+G R A  ++ERL
Sbjct: 598 DIT-TVLGEIPGLGPARVKELLKHFGSVAQLRKAAPEEIAEVRGVGLRLAAAVFERL 653


>UVRC_BIFLO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 746

 Score =  548 bits (1413), Expect = e-158
 Identities = 319/738 (43%), Positives = 409/738 (55%), Gaps = 103/738 (13%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           R   RPK   IP  PGVY++RD  GRVIYVGKAKNLR RL++YFQ    LHPRTQTM+ T
Sbjct: 6   RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYFQPLYLLHPRTQTMVLT 65

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
           A  ++WTVV TE+E+L LEY+WIKE+ PRFNV++RDDK+YPYLAV+  E  PRV V R  
Sbjct: 66  ARSLEWTVVATELESLTLEYTWIKEFDPRFNVQFRDDKTYPYLAVSTGERIPRVWVTRSR 125

Query: 124 RRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           +RR  RYFGPY+  W +R ++D LLR FPVRTC+  VF +A+ +GRPCL   I KCSAPC
Sbjct: 126 KRRDTRYFGPYAKVWELRHSLDRLLRTFPVRTCTTNVFHKAQLTGRPCLFASIGKCSAPC 185

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGR-FLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           V RI  +E+R L E     M G  GR ++                     +RD IQ L T
Sbjct: 186 VNRIEADEHRRLCEQLVGVMTGRLGRPYIAQLTRDMKEASAELEFEKAARLRDQIQMLET 245

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
                                 D+LEA+V  FYVR G IRGER W V++VE         
Sbjct: 246 XXXXXXXXXXXXXXXXXXXXXSDELEASVHAFYVRAGSIRGERNWSVERVEXXXXXXXXX 305

Query: 303 QFLAQTYGGADDEE-----STTAIPREVLVSAEP-------------------------A 332
               Q Y  A  +      +T +  RE + S +                          A
Sbjct: 306 XXXVQVYSDAAGDNHPQSAATISTNREAIGSTQTITATDAVARAQATRERNTRQETTGRA 365

Query: 333 D--------------------RDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D                    R+ +  WL+  RG AV +RV  RGDK+ LM+   +NA Q
Sbjct: 366 DLLXXXXXXXXXXXXXXXXXRREELEGWLTNLRGGAVTIRVASRGDKKQLMDRANENASQ 425

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDIS-TLQGEHTVASMVVFEDG 431
            L R K  R SD+  R++              PLRIEC+DIS T+ G   VASMVVFED 
Sbjct: 426 ALQRSKMSRISDMGARTQAMNDVAKALGLAEAPLRIECYDISNTVGGAFQVASMVVFEDA 485

Query: 432 LARKSEYRRFSIRG--AEGADSDVAAMYEVISRRFT---------RYLEESQRV----GE 476
           +A+KSEYRRF+IRG   +GA  D++A+YE ++RRF            ++  QRV    G+
Sbjct: 486 IAKKSEYRRFAIRGKDGKGAVDDLSALYETLTRRFKHGNIAGDSGESIDAEQRVASAAGK 545

Query: 477 LDTL-------------GESGA---------PQGAE---RKAP-----------RFAYPP 500
           + T              GE G+         P G +   R++P            FAY P
Sbjct: 546 MTTAVAAETIAANGNDNGEGGSDISGKGHAVPVGVQNDARESPPDIVQQNTNRHHFAYKP 605

Query: 501 NLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL 560
           NLVVVDGG+PQV AA +AL+D G+ DVAVCGLAKRLEEVW+P ++ PIIL R SEG+YLL
Sbjct: 606 NLVVVDGGKPQVMAAAKALEDCGVNDVAVCGLAKRLEEVWVPDDDYPIILKRQSEGMYLL 665

Query: 561 QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEI 620
           QRVRDE+HRFAI+YHR++R K    S LD+IPG+G   +  LL HFGSV+ + +A+  + 
Sbjct: 666 QRVRDESHRFAITYHRQQRRKGALRSALDEIPGIGESYQKRLLNHFGSVKAMREASVEDF 725

Query: 621 AEVPGIGERTAQTIYERL 638
            +V GIG   A+ +Y  L
Sbjct: 726 EKVKGIGHAKAEALYNAL 743


>UVRC_BIFLD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 746

 Score =  548 bits (1412), Expect = e-158
 Identities = 319/738 (43%), Positives = 409/738 (55%), Gaps = 103/738 (13%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           R   RPK   IP  PGVY++RD  GRVIYVGKAKNLR RL++YFQ    LHPRTQTM+ T
Sbjct: 6   RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYFQPLYLLHPRTQTMVLT 65

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
           A  ++WTVV TE+E+L LEY+WIKE+ PRFNV++RDDK+YPYLAV+  E  PRV V R  
Sbjct: 66  ARSLEWTVVATELESLTLEYTWIKEFDPRFNVQFRDDKTYPYLAVSTGERIPRVWVTRSR 125

Query: 124 RRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           +RR  RYFGPY+  W +R ++D LLR FPVRTC+  VF +A+ +GRPCL   I KCSAPC
Sbjct: 126 KRRDTRYFGPYAKVWELRHSLDRLLRTFPVRTCTTNVFHKAQLTGRPCLFASIGKCSAPC 185

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGR-FLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           V RI  +E+R L E     M G  GR ++                     +RD IQ L T
Sbjct: 186 VNRIEADEHRRLCEQLVGVMTGRLGRPYIAQLTRDMKEASAELEFEKAARLRDQIQMLET 245

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
                                 D+LEA+V  FYVR G IRGER W V++VE         
Sbjct: 246 XXXXXXXXXXXXXXXXXXXXXSDELEASVHAFYVRAGSIRGERNWSVERVEXXXXXXXXX 305

Query: 303 QFLAQTYGGADDEE-----STTAIPREVLVSAEP-------------------------A 332
               Q Y  A  +      +T +  RE + S +                          A
Sbjct: 306 XXXVQVYSDAAGDNHPQSAATISTNREAIGSTQTITATDAVARAQATRERNTRQETTGRA 365

Query: 333 D--------------------RDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D                    R+ +  WL+  RG AV +RV  RGDK+ LM+   +NA Q
Sbjct: 366 DLLXXXXXXXXXXXXXXXXXRREELEGWLTNLRGGAVTIRVASRGDKKQLMDRANENASQ 425

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDIS-TLQGEHTVASMVVFEDG 431
            L R K  R SD+  R++              PLRIEC+DIS T+ G   VASMVVFED 
Sbjct: 426 ALQRSKMSRISDMGARTQAMNDVAKALGLAEAPLRIECYDISNTVGGAFQVASMVVFEDA 485

Query: 432 LARKSEYRRFSIRG--AEGADSDVAAMYEVISRRFT---------RYLEESQRV----GE 476
           +A+KSEYRRF+IRG   +GA  D++A+YE ++RRF            ++  QRV    G+
Sbjct: 486 IAKKSEYRRFAIRGKDGKGAVDDLSALYETLTRRFKHGNIAGDSGESIDAEQRVASAAGK 545

Query: 477 LDTL-------------GESGA---------PQGAE---RKAP-----------RFAYPP 500
           + T              GE G+         P G +   R++P            FAY P
Sbjct: 546 MTTAVAAETIAANGNDNGEGGSDISGKGHAVPVGVQNDARESPPDIVQQNTNRHHFAYKP 605

Query: 501 NLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL 560
           NLVVVDGG+PQV AA +AL+D G+ DVAVCGLAKRLEEVW+P ++ PIIL R SEG+YLL
Sbjct: 606 NLVVVDGGKPQVMAAAKALEDCGVNDVAVCGLAKRLEEVWVPDDDYPIILKRQSEGMYLL 665

Query: 561 QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEI 620
           QRVRDE+HRFAI+YHR++R K    S LD+IPG+G   +  LL HFGSV+ + +A+  + 
Sbjct: 666 QRVRDESHRFAITYHRQQRRKGALRSALDEIPGIGESYQKRLLNHFGSVKAMREASVEDF 725

Query: 621 AEVPGIGERTAQTIYERL 638
            +V GIG   A+ +Y  L
Sbjct: 726 EKVKGIGHAKAEALYTAL 743


>UVRC_STRGG RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 717

 Score =  530 bits (1365), Expect = e-152
 Identities = 289/466 (62%), Positives = 335/466 (71%), Gaps = 5/466 (1%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           RPKPG IP  PGVY+FRDEH RVIYVGKAKNLR R+++YFQD + LHPRT+TM++TAA  
Sbjct: 8   RPKPGQIPDSPGVYKFRDEHRRVIYVGKAKNLRQRVANYFQDLANLHPRTRTMVTTAAXX 67

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
                     ALQLEYSWIKE+ PRFNV+YRDDKSYPYLAVTLNEEFPRVQVMRGA+++G
Sbjct: 68  XXXXXXXXXXALQLEYSWIKEFDPRFNVKYRDDKSYPYLAVTLNEEFPRVQVMRGAKKKG 127

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           VRYFGPY +AWAIR+TVDL+LRVFPVRTCSAGVFK A  +GRPCLLGYI KCSAPCVGR+
Sbjct: 128 VRYFGPYGHAWAIRETVDLMLRVFPVRTCSAGVFKNAARTGRPCLLGYIGKCSAPCVGRV 187

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EE+R LAEDFC FMAG TG ++R                               MEK 
Sbjct: 188 TPEEHRELAEDFCDFMAGRTGTYIRRLEKDXXXXXXXXXXXXXXXXXXXXXXXXXXMEKS 247

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
                           ED+LEAA+Q+F+           WV DKVE V T  LVE  L Q
Sbjct: 248 XXXXXXXXXXXXXXXXEDELEAALQIFHXXXXXXXXXXXWVTDKVEAVDTSGLVEHALQQ 307

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            YG    EE   A+P+EVLV A P D +AV  WL+ RRG+ V +R+PQRGDK+ LM TV 
Sbjct: 308 LYG----EERGDAVPKEVLVPALPEDPEAVSQWLADRRGSQVSLRIPQRGDKKDLMATVQ 363

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+Q L  HK++RASDLTTRS+              PLRIEC+DIS LQG+  VASMVV
Sbjct: 364 RNAQQALGLHKTKRASDLTTRSRALEEIAEALGLDTAPLRIECYDISHLQGDDVVASMVV 423

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQR 473
           FEDGLARKSEYRRF I+G EG D DV +M+EVI RRF RYL++ +R
Sbjct: 424 FEDGLARKSEYRRFQIKGFEGQD-DVRSMHEVIGRRFKRYLQDKER 468



 Score =  181 bits (459), Expect = 2e-47
 Identities = 91/138 (65%), Positives = 107/138 (77%)

Query: 496 FAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSE 555
           FAYPP LVVVDGG+PQVAAA+RALD+LGI+D+AVCGLAKR                R+SE
Sbjct: 549 FAYPPQLVVVDGGQPQVAAARRALDELGIDDIAVCGLAKRXXXXXXXXXXXXXXXXRSSE 608

Query: 556 GLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQA 615
           GLYLLQRVRDEAHRFAI+Y R KRAK + +S LDD+ GLG  R+ AL+KHFGSV++L QA
Sbjct: 609 GLYLLQRVRDEAHRFAITYQRAKRAKRIRSSPLDDVTGLGETRKQALIKHFGSVKKLRQA 668

Query: 616 TAAEIAEVPGIGERTAQT 633
           T  EI EVPGIG RTA++
Sbjct: 669 TIDEICEVPGIGRRTAES 686


>UVRC_SYMTH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 629

 Score =  441 bits (1133), Expect = e-125
 Identities = 256/628 (40%), Positives = 374/628 (59%), Gaps = 16/628 (2%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PG Y F+D  GR+IYVGKA+NL+ R+  YFQ    L  +   M+    +++  V +
Sbjct: 10  LPDRPGCYLFKDASGRIIYVGKARNLKNRVRQYFQSSRNLTAKVLAMVGQIVEIEHIVTD 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           TE EAL LE + IK++ P++N+R RDDK YPYL +TL E++PR+ V R  ++ G RYFGP
Sbjct: 70  TETEALVLESNLIKKHKPKYNIRLRDDKHYPYLRLTLTEQWPRLVVARSMKKDGSRYFGP 129

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIG-VEEY 192
           Y+ + A+ +T+ L  R+FP+RTC+           R CL  +I +C  PC+       EY
Sbjct: 130 YTSSQAMWETMKLARRLFPLRTCN-----DPSRYPRGCLQYHIGRCLGPCLPDFDRHREY 184

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
                D  AF+ G T   L                       D I+A+  V EKQ ++  
Sbjct: 185 AEAVRDLQAFLEGRTQEVLERLRARMEQXXXXXXXXXXXXXXDQIRAIEKVTEKQKIIAH 244

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D DVIA A    EA VQVF+VR G++ G   +++   ++++ G+++  F+ Q Y   
Sbjct: 245 TMVDLDVIAYARLYDEAGVQVFFVRQGKLVGRDQFLMSGADEMTGGEILAAFIQQHY--- 301

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  +P+E+LVS +  D D +  WLS +RG+ V +R P+RG+KRAL+E V +NA++
Sbjct: 302 ---SQTDFVPKEILVSEDLPDADVIAEWLSAKRGSRVALRCPKRGEKRALVEMVAQNAQE 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +   + QR  +L                   P RIECFD+S +QG   VASMVVFE G 
Sbjct: 359 AMTERRQQRELELAATEGVLRELQAYLDLPRLPHRIECFDVSHVQGAEVVASMVVFEGGR 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEE--SQRVGELDTLGESGAPQGAE 490
            +KS+YRRF ++  +  ++D A M E + RRF R L E  +Q  G +  L E    +G  
Sbjct: 419 PKKSDYRRFKMKVDQ--NNDFANMAEAVGRRFRRGLAERAAQVEGRVRDLEEGRVAEGGA 476

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIIL 550
               +FA  P+L+++DGG+ Q++ A+  + +LG++ +   GLAK  E +      D I L
Sbjct: 477 EYGGKFADFPDLLIIDGGKGQLSYARAVMRELGVDHIPTFGLAKENELLCTEDRPDWIEL 536

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
           PR S+ L+LLQR+RDEAHRFAI+YHR+   +A T S LDD+PG+GP R+ ALL+HFGS++
Sbjct: 537 PRGSQALFLLQRIRDEAHRFAITYHRKLHRRASTHSRLDDVPGIGPKRKKALLQHFGSLK 596

Query: 611 RLAQATAAEIAEVPGIGERTAQTIYERL 638
            + +A+  E+A+VPGI    A+ + E L
Sbjct: 597 AIREASVEEVAQVPGITLELAERVKEAL 624


>UVRC_ALKOO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 621

 Score =  412 bits (1060), Expect = e-117
 Identities = 228/634 (35%), Positives = 355/634 (55%), Gaps = 20/634 (3%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K  ++P  PGVY  R++   +IYVGKA +L+ R+  YFQ      P+ + M+S    
Sbjct: 4   LKEKLRTLPEKPGVYMMRNDKNEIIYVGKAISLKNRVRQYFQSSKNHPPKVKAMVSHIVT 63

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V +TE+EAL LE + IKE  P++NV  RDDK+YPY+ +T NEE+PR+   R   + 
Sbjct: 64  FEYIVTDTELEALILECNLIKENRPKYNVLLRDDKTYPYIKITTNEEYPRILKTRKVIKD 123

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY+   A+ +T+D++  ++P+RTC+  + +   +  RPCL  +I KC  PC G 
Sbjct: 124 KAKYFGPYTNIGALNETLDVIHTIYPIRTCNKNIERMIANKERPCLNYHIKKCIGPCTGL 183

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  EEY  +  D   F+ G+    +R                     RD I AL  ++EK
Sbjct: 184 VTKEEYHQMIHDIILFLDGKEDELVRKIEEKMKAAAISMDFENAARYRDQIIALNNIVEK 243

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +V     D DVIA+A+++    +QVF++R G++     +++   ED S  +++  FL 
Sbjct: 244 QKIVSVAEQDQDVIAMAKNEGNTWIQVFFIRKGKLVQREHFILKDTEDDSNQEIIASFLK 303

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y GA      T +P+E+L+     D + +  WLS +RG  V ++VPQ+GDK+ L++ V
Sbjct: 304 QFYSGA------TFVPKEILIEESVEDLNVLEEWLSGKRGNKVSIKVPQKGDKKELLDMV 357

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            KNA  T+ +  +    +                    P RIE +DIS +QG  +V SMV
Sbjct: 358 KKNALMTMEQATTVIQLEKEKTEDTLIELAQLLDLEEVPYRIESYDISNIQGVESVGSMV 417

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VFE G ++  +YRRF I+  +G  +D A++ E+I+RRF R LEE+Q + E          
Sbjct: 418 VFEGGKSKNKDYRRFKIKTVKG-PNDYASLEEIITRRFKRGLEETQDIIE---------- 466

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGE 544
           Q  E    +FA  P+L++VDGG  QV + ++AL  L + ++ VCG+ K  R     L  E
Sbjct: 467 QSLEVSEGKFAIFPDLIMVDGGFGQVTSVKKALHSLNL-NIPVCGMIKDDRHRTKGLVYE 525

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            + + + +TS    L+ +++DE HRFAI+YHR  R K    S+L++IPG+G  RR AL+ 
Sbjct: 526 GEELSIEKTSHLFRLITKIQDEVHRFAITYHRSLRKKTTLQSILEEIPGVGEARRKALMI 585

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           HFGS+ ++  AT  E+ EV G+  + A+ I E L
Sbjct: 586 HFGSIDKIKNATVEELLEVQGMNRKVAENIVEYL 619


>UVRC_DEHE1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  403 bits (1035), Expect = e-114
 Identities = 233/633 (36%), Positives = 351/633 (55%), Gaps = 30/633 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL+ +  S+P +PGVY  ++  G +IYVGKA  L+ R+ SYF   S L P+T+ ++S   
Sbjct: 5   TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLEPKTRQLVSQIN 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           ++++ +  +E EAL LE + IK + P FNVR +DDK +PYL +TLNE++PR+ + R    
Sbjct: 65  ELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMAD 124

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G RYFGP++   ++R T+ +L  +F  R+C+           RPCL   I +C +PC G
Sbjct: 125 DGGRYFGPFASTRSVRHTLQVLKELFRFRSCNR---TEPEKRSRPCLEYDIHQCLSPCTG 181

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +I  ++Y  L      F+ G+  + L+                     RD I +++ V+E
Sbjct: 182 KISKQDYDHLISQAILFLEGKQDKVLKLLAKLMNEASARLDYETAALRRDQISSIKEVIE 241

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
            Q +    S + D IA A++   + VQVF++R G++ G   + +    +   G ++ +F+
Sbjct: 242 GQQLAARVSGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFSLQGTREEKPGDILSEFV 301

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y       S+T IP +++     +DR+ +  WLS+RRG  V +    RG  + L+  
Sbjct: 302 KQFY------HSSTQIPPKIVTQYPLSDREILEKWLSERRGGKVQITAGLRGQPKDLINI 355

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
           V +NA + L + + +  S   T +               P RIE +DIS +QG + V SM
Sbjct: 356 VAENAREQLKQARIKNLSSAATLTDALEELQTALGLPLPPQRIEGYDISNIQGTNAVGSM 415

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+G  +K+ YRRF I+  +GAD D + + EVISRRF R  +        D  GES  
Sbjct: 416 VVFENGKPQKAHYRRFRIKTVKGAD-DFSMLKEVISRRFGRLNK--------DNAGES-- 464

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                     FA  P+L+++DGG+ Q+++ +  LD LG+E  AV GLAK  EE++LPG+ 
Sbjct: 465 ----------FARRPSLMLIDGGKGQLSSVKETLDTLGLEGQAVIGLAKEFEEIYLPGKS 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           +PI L   S  L LLQRVRDEAHRFA+ YH   R K+   S LD IPG+GP RR  L+K 
Sbjct: 515 EPIRLMANSPALQLLQRVRDEAHRFALGYHLNIRHKSGLTSALDGIPGIGPSRRRLLIKT 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FGSV  + QA+  E+ +V GI +  A +I E L
Sbjct: 575 FGSVSGIRQASLDELLQVKGINQALALSIKELL 607


>UVRC_CARHZ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  396 bits (1017), Expect = e-112
 Identities = 248/635 (39%), Positives = 342/635 (53%), Gaps = 34/635 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL  K  ++P  PGVY ++DE G VIYVGKAKNL+ R+ SYFQ    L P+T+ M+  A 
Sbjct: 2   TLWEKVKNLPDSPGVYLYKDEKGEVIYVGKAKNLKNRVRSYFQPPEKLLPKTRVMMEKAR 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D++  + +TEVEAL LE + IK Y PR+N+  +DDKSYPYL +T  EEFPR+ + R    
Sbjct: 62  DIEVIITSTEVEALILEQNLIKRYRPRYNILLKDDKSYPYLKIT-GEEFPRLLITRRVVN 120

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G RYFGPY  A A+ +T  LL  +F  RTC+  +F + +   RPCL  +I KCSAPC G
Sbjct: 121 DGGRYFGPYPDAGALNETYKLLRSIFKFRTCTPTIFAQKK---RPCLNFHIKKCSAPCAG 177

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            I  EEY    E    F+ G     ++                    +RD I AL  ++ 
Sbjct: 178 EISREEYFKEIEMVVDFLEGRGENLIKKLKKEMAIASDNLEFERAAKLRDQILALEKILA 237

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQ +  G   + DV+ +A  +      +F +R G + G++  V     ++ TG+L+ Q L
Sbjct: 238 KQKISRG-QRNADVVVVANRENLGVGLIFVIRQGNLLGQK--VYTFTGEMETGELLNQVL 294

Query: 306 AQTYGGADDEESTTAIPREVLVSA-EPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALME 364
              YG A +      +P E+++S  E  D + + +W   + G      VP+RG+K  L++
Sbjct: 295 VTHYGEAKE------VPVEIILSTRENLDEEFLNSWFELKFGKKPKFTVPKRGEKFELLK 348

Query: 365 TVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
             L+N   TL                              P RIE +DIS L G  TVAS
Sbjct: 349 MALENVNFTLDXXXXXXXXXXXXXXXALMDLKEALNLPVVPRRIEGYDISHLAGTGTVAS 408

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           MVVF DG   K +YRRF+IR A  A+ D  AM+E + RRF +YL           L E G
Sbjct: 409 MVVFIDGEPVKGKYRRFAIRSA--ANDDYTAMFEAVLRRFKKYL----------ALQEEG 456

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG-IEDVAVCGLAKRLEEVWLPG 543
              G+      F   P+LV++DGG+ Q+ AA  AL +   +    V  LAK  EE++LPG
Sbjct: 457 GADGS------FEELPDLVLIDGGKGQLNAAMDALKETNLLGKFTVIALAKEQEEIFLPG 510

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           ++D ++L +  EGL LLQRVRDEAHRFA  Y  +KR K L AS+L+ + G+GP RR  LL
Sbjct: 511 KKDSLLLTQDREGLKLLQRVRDEAHRFARGYQEKKRVKTL-ASLLEQVEGIGPKRRKQLL 569

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
             FGS++ L +AT  EI  VPGI    A+ + E L
Sbjct: 570 NKFGSIKNLREATVEEITAVPGITREIAERLKELL 604


>UVRC_CLOAB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  394 bits (1013), Expect = e-112
 Identities = 217/624 (34%), Positives = 354/624 (56%), Gaps = 22/624 (3%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G VIYVGKAK L+ R+  YF++      + + M+   ++ ++ V 
Sbjct: 10  NLPDKPGVYIMKNSLGEVIYVGKAKILKNRVRQYFRNSKNHSEKVKAMVKNISEFEYIVT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y PR+N+  +DDK YP++ VT+NE+FPR+ V R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYKPRYNILLKDDKHYPFIKVTMNEDFPRIIVTRNMVKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+ +TVDL+ R+FP+RTC   + K    + RPCL  +I +C+APC G I  EEY
Sbjct: 130 PYPDVSAVHETVDLMRRIFPIRTCKKYI-KENGENIRPCLNYHIKRCNAPCAGLISKEEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             + +     ++G+    +R                    +RD + A + V EKQ +++G
Sbjct: 189 GEIIKKAVGLISGKNNDIIRELKEEMEKASMNLDFEKAADLRDKMLAAQKVTEKQKIIIG 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D+ ++ VQVF++R G+I G   ++V+     + G ++ +F+ + Y G 
Sbjct: 249 NFENEDYISLYSDEKDSCVQVFFLREGKIVGREHFIVENTAGENEGDIIGEFIKEFYSG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  +P+ +  SA   D + +  WL+ +RG+ V++++PQ+G+K+ ++E V +N++ 
Sbjct: 308 -----TAYVPKSIYASA-GEDLNLLENWLTMKRGSKVEIKIPQKGEKKDIIEMVKRNSKI 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL + K +  SD                    P RIE +DIS +QG  +V SM+VFE+G 
Sbjct: 362 TLEKFKIKLLSDKRLNENILIEMTEVIGLEEVPHRIEAYDISNIQGVDSVGSMIVFEEGK 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            + S+YRRF I+  +GA +D  +M E+++RRF   LEE   +            +     
Sbjct: 422 PKNSDYRRFKIKTVKGA-NDYDSMREILTRRFKHGLEEVNSI----------VNKNLSLS 470

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGEEDPIIL 550
           A +F   P+L+++DGG+ QV  A   L +  I D+ VCG+ K  R     +    + I +
Sbjct: 471 AGKFCVFPDLILMDGGKGQVNIALEVLKEFNI-DIPVCGMVKDDRHNTRGIIYNNNEIDI 529

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
               + +  + RV+DE HRFAI+YHR  R K +  SVLDDIP +G  RR ALLKHFGS+ 
Sbjct: 530 KSNRKIINFVTRVQDEVHRFAITYHRSLRDKRVLHSVLDDIPYIGEKRRKALLKHFGSIE 589

Query: 611 RLAQATAAEIAEVPGIGERTAQTI 634
            + +AT  E+ + P I ++ A++I
Sbjct: 590 NIKKATYEELMKTPSIDKKAAESI 613


>UVRC_CLOTE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 622

 Score =  392 bits (1008), Expect = e-111
 Identities = 222/628 (35%), Positives = 353/628 (56%), Gaps = 28/628 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  ++    VIYVGKAK L+ R+  YFQ       + + M+S  A+ ++ + +
Sbjct: 11  LPEKPGVYLMKNSSDEVIYVGKAKILKNRVKQYFQQSKNHSEKVRVMVSNIAEFEYIITD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+Y P++N+  +DDK YPY+ +T+NE+FPRV + R   + G RYFGP
Sbjct: 71  SEMEALILECNLIKKYRPKYNILLKDDKGYPYIKITINEDFPRVFISRTIAKDGSRYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+R+T++L+ ++FP+R+C   + +  +   RPCL  +I  CSAPC   I  + Y 
Sbjct: 131 YTDYSAVRETIELIKKIFPIRSCKRYI-RDGQKPTRPCLNYHIKLCSAPCGAHISKQGYA 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            +  D    ++G+    L                     +RD I A++ + EKQ +++G 
Sbjct: 190 LIINDIVQLLSGKDKDILDKLKNQMEEASNSLQFEKAASLRDKIFAVKKITEKQKIIMGS 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + D I IA+D+ ++ VQVF+VR G+I G   ++++   D    K++ +F+   YGGA 
Sbjct: 250 FQNEDYINIAKDEKDSCVQVFFVREGKIIGREHFILEYTSDEREYKIIAEFIKDFYGGAA 309

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  +P       +  D+  +  WL+ RRG+ V+++VP+RG+K  L+  V KNA+ T
Sbjct: 310 FVPKTVYVP-------DIEDKYLLEQWLTIRRGSKVEIKVPKRGEKIELLNLVKKNAKLT 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   D                    P RIE +DIS +QG  +V SMVVFE G +
Sbjct: 363 LEQFKIKYLQDKALYEVALAELSDILGFDDMPNRIEAYDISNIQGVDSVGSMVVFEKGRS 422

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           +KS+YRRF I+  EGA +D  +M E++ RRF R +EE Q++ + +    SG         
Sbjct: 423 KKSDYRRFKIKTVEGA-NDYHSMREILRRRFQRGIEEIQQIQKRNLEFSSG--------- 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEE-----VWLPGEEDPI 548
            +F+  P+L+++DGG+  V  A   L +L IE + V G+ K         ++   E+D  
Sbjct: 473 -KFSVFPDLILIDGGKGHVNIALEVLKELNIE-IPVAGMVKDDSHTTRGIIYNNIEKD-- 528

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
            +   S  + L+ R++DE HRFAISYHR  R K +  S+LDDIP +G +R+  LLK FGS
Sbjct: 529 -ISLDSNAMKLITRIQDEVHRFAISYHRTLRDKRVLKSILDDIPNIGTIRKKELLKKFGS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +A+  ++ E P I +R+A +I E
Sbjct: 588 IESIKKASIDQLLETPSIDKRSALSIKE 615


>UVRC_DEHSC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  392 bits (1007), Expect = e-111
 Identities = 230/633 (36%), Positives = 347/633 (54%), Gaps = 30/633 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL+ +  S+P +PGVY  ++  G +IYVGKA  L+ R+ SYF   S L P+T  ++S   
Sbjct: 5   TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQIN 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           ++++ +  +E EAL LE + IK + P FNVR +DDK +PYL +TLNE++PR+ + R    
Sbjct: 65  ELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMAD 124

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G RYFGP++   ++R T+ +L  +F  R+C+           RPCL   I +C +PC G
Sbjct: 125 DGGRYFGPFANTRSVRHTLQVLKELFRFRSCNR---TEPEKHSRPCLEYDIHQCLSPCTG 181

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +I   +Y  L      F+ G+  + L+                     RD I +++ V+E
Sbjct: 182 KISKSDYDHLISQAILFLEGKQDQVLKLLIRLMNEASARLDYETAALRRDQIASIKEVIE 241

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
            Q +    + + D IA A++   + VQVF++R G++ G   + +    +   G ++ +F 
Sbjct: 242 GQQLAARVTGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFCLQGTREEKPGDILSEFA 301

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y       S+T IP +++     +DR+ +  WLS+RRG  V +    RG  + L+  
Sbjct: 302 KQFY------HSSTQIPPKIVTQYPVSDREILEKWLSQRRGDKVHITAGLRGQPKELINI 355

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
           V +NA + L + + +  S   T +               P RIE +DIS +QG + V SM
Sbjct: 356 VAENAREQLKQARIKNLSSSVTLTDALAELQTALGLSLPPQRIEGYDISNIQGTNAVGSM 415

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+G  +K+ YRRF I+  +GAD D + + EVISRRF R   E          GES  
Sbjct: 416 VVFENGKPQKAHYRRFRIKTVKGAD-DFSMLKEVISRRFGRVHREDA--------GES-- 464

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                     FA  P+L+++DGG+ Q+++ +  LD LG+E  AV GLAK  EE++LP + 
Sbjct: 465 ----------FARLPSLMLIDGGKGQLSSVKETLDKLGLEGQAVIGLAKEFEEIYLPHKS 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           +PI L   S  L LLQRVRDEAHRFA+ YH   R K+   S LD IPG+GP RR  L+K 
Sbjct: 515 EPIRLAANSPALQLLQRVRDEAHRFALGYHLHIRQKSGLTSALDGIPGVGPSRRRLLIKT 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FGSV  + QA+  ++++V GI +  A +I E L
Sbjct: 575 FGSVAGIRQASFEKLSQVKGINQALALSIKELL 607


>UVRC_DEHSB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  392 bits (1007), Expect = e-111
 Identities = 230/633 (36%), Positives = 347/633 (54%), Gaps = 30/633 (4%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL+ +  S+P +PGVY  ++  G +IYVGKA  L+ R+ SYF   S L P+T  ++S   
Sbjct: 5   TLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTPKTCQLVSQIN 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           ++++ +  +E EAL LE + IK + P FNVR +DDK +PYL +TLNE++PR+ + R    
Sbjct: 65  ELEYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMAD 124

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G RYFGP++   ++R T+ +L  +F  R+C+           RPCL   I +C +PC G
Sbjct: 125 DGGRYFGPFANTRSVRHTLQVLKELFRFRSCNR---TEPEKRSRPCLEYDIHQCLSPCTG 181

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +I   +Y  L      F+ G+  + L+                     RD I +++ V+E
Sbjct: 182 KISKSDYDHLISQAILFLEGKQDQVLKLLIRLMNEASARLDYETAALRRDQIASIKEVIE 241

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
            Q +    + + D IA A++   + VQVF++R G++ G   + +    +   G ++ +F 
Sbjct: 242 GQQLAARVTGEQDAIAFAQEGDLSMVQVFFIRRGKLIGRESFCLQGTREEKPGDILSEFA 301

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y       S+T IP +++     +DR+ +  WLS+RRG  V +    RG  + L+  
Sbjct: 302 KQFY------HSSTQIPPKIVTQYPVSDREILEKWLSQRRGDKVHITAGLRGQPKELINI 355

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
           V +NA + L + + +  S   T +               P RIE +DIS +QG + V SM
Sbjct: 356 VAENAREQLKQARIKNLSSSVTLTDALAELQTALGLSLPPQRIEGYDISNIQGTNAVGSM 415

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+G  +K+ YRRF I+  +GAD D + + EVISRRF R   E          GES  
Sbjct: 416 VVFENGKPQKAHYRRFRIKTVKGAD-DFSMLKEVISRRFGRVHREDA--------GES-- 464

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                     FA  P+L+++DGG+ Q+++ +  LD LG+E  AV GLAK  EE++LP + 
Sbjct: 465 ----------FARLPSLMLIDGGKGQLSSVKETLDKLGLEGQAVIGLAKEFEEIYLPHKS 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           +PI L   S  L LLQRVRDEAHRFA+ YH   R K+   S LD IPG+GP RR  L+K 
Sbjct: 515 EPIRLAANSPALQLLQRVRDEAHRFALGYHLHIRQKSGLTSALDGIPGVGPSRRRLLIKT 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FGSV  + QA+  ++++V GI +  A +I E L
Sbjct: 575 FGSVAGIRQASFEKLSQVKGINQALALSIKELL 607


>UVRC_ALKMQ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 622

 Score =  392 bits (1006), Expect = e-111
 Identities = 232/627 (37%), Positives = 358/627 (57%), Gaps = 26/627 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  +++   +IYVGKA +L+ R+  YFQ  +  HP+ + M++     ++ V +
Sbjct: 11  LPDKPGVYLMKNKANEIIYVGKAISLKNRVRQYFQSSNNQHPKVRAMVTHINFFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IKE  P++NV  RDDK+YPY+ VT+NE FPRV   R   +   +YFGP
Sbjct: 71  SELEALILECNLIKENRPKYNVLLRDDKTYPYIKVTMNETFPRVLKTRKVLKDKAKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+ +T++++ +++P+R C   + K      RPCL  +I KC  PC G +  E Y+
Sbjct: 131 YTNISALNETLEVIHQMYPIRVCGKNIEKMIERQERPCLNYHIRKCIGPCTGMVNDETYQ 190

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            +  +   F+ G                            RD  QAL  ++E+Q VV  +
Sbjct: 191 QMIHEIILFLGGXXXXXXXXXXXXXXRAAEKMDFEGAAHYRDQRQALLDIIERQKVVSVN 250

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D+IA+A+ + E+ VQVF+VRGG++     +++   ED    +++  F+ Q YG   
Sbjct: 251 DIDQDIIAMAKGEQESCVQVFFVRGGKLVQREHYILTTREDEDEKEILSAFIKQFYG--- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP+EVLV  E  D++ +  WL+ +RG  V VR P RG+K+++++ V +NA  T
Sbjct: 308 ---ETNFIPKEVLVEREVEDQELMAQWLTNKRGNHVKVRAPLRGEKKSMIQLVKRNAALT 364

Query: 374 LA-RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           +  R ++QR S   T                   R+E FDIS  QG  +V SMVVFE G 
Sbjct: 365 MGQREETQRKSKEKTEGAMVVLQEALGLADAIH-RVEAFDISNTQGMESVGSMVVFEGGK 423

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            +  +YRRF I+  +GA +D  ++ E+I RR+ R ++E++ + E     + G        
Sbjct: 424 PKNKDYRRFKIKTIQGA-NDYGSIEEIIYRRYKRGVDETKAMIENTMTVQEG-------- 474

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L++VDGG  QV + ++ L  LGI  + VCG+ K    R   +   G+E PI
Sbjct: 475 --KFSLFPDLIMVDGGLGQVTSVKKGLAALGIL-IPVCGMVKDERHRTRGLVYEGKEIPI 531

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
              R S  L  + +V+DE HRFAI+YHR  R K++  SVL+DIPG+G  RR +L+KHF S
Sbjct: 532 --ERPSHLLRFITQVQDEVHRFAITYHRSLRTKSILHSVLEDIPGIGEKRRKSLMKHFES 589

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIY 635
           + ++ QAT  E+ EV G+  + A+ +Y
Sbjct: 590 IDKMKQATIEELIEVEGLNRKVAENMY 616


>UVRC_CLOTH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 625

 Score =  391 bits (1005), Expect = e-111
 Identities = 221/626 (35%), Positives = 345/626 (55%), Gaps = 20/626 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  +DE+G +IYVGKA  L+ R+  YFQ  S   P+ + M++   + ++ V +
Sbjct: 11  LPDKPGVYIMKDENGEIIYVGKAVVLKNRVRQYFQSLSNQTPKVRAMVAHIKEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           TE+EAL LE + IK++ P+FN+  +DDK+YPY+ VT+NE+FPR+ + R   + G +YFGP
Sbjct: 71  TELEALILECNLIKKHRPKFNILLKDDKNYPYIKVTMNEDFPRILMTRRVEKDGAKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+ A+A+R+T+DL+ ++FPV+TCS  V  R    GRPCL  +I +C  PC G +  EEYR
Sbjct: 131 YTSAYAVRETIDLVKKLFPVKTCSK-VLPRDIGKGRPCLNYHIYQCLGPCQGNVSKEEYR 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + +D C F+ G     ++                    IRD I +L+ + EKQ ++   
Sbjct: 190 FMMQDVCNFLGGRQEDIIKKLEKDMKEAADNLEFERAARIRDKINSLKHIAEKQKIISTA 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA A+ + ++ +QVF++RGG++ G   ++++   DVS  +L+  F+ Q Y    
Sbjct: 250 MEDQDVIAFAKSETDSCIQVFFIRGGKLIGREHFILEGTSDVSDSELMTAFVKQFY---- 305

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
              S   +P ++++  +  + + +  WLS +RG    ++VP+RG+K  L+E V KNA   
Sbjct: 306 --SSAAYVPGQIILQEDIDEMEIIEKWLSGKRGTKTYIKVPRRGEKLKLVEMVSKNALIE 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   +     +              P RIE +DIS       V SMVVFE+G  
Sbjct: 364 LNQFKERIKKEAALAKEGMEKLKELLNLDRLPRRIEAYDISNTGSTEIVGSMVVFENGSP 423

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           +KS+YRRF I+      +D  +M EVI RR  R  +E        T              
Sbjct: 424 KKSDYRRFKIKSI-NVQNDYQSMQEVIFRRLKRAQKEM-------TXXXXXXXXXXXXXX 475

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK---RLEEVWLPGEEDPIIL 550
                 P++++VDGG   V A +  L++L   ++ V G+ K         + GE +   L
Sbjct: 476 XXXXTLPDVLLVDGGTGHVNAVRSVLEELDF-NIPVYGMVKDDNHRTRGLVTGERE-FDL 533

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
            +    L  +  ++DEAHRFA+ Y+R+ RAK  + SVLD+I G+GP R+  L++HFGSV+
Sbjct: 534 SKDIVLLRFVTAIQDEAHRFALEYNRKLRAKRYSGSVLDNIEGVGPKRKKELIRHFGSVK 593

Query: 611 RLAQATAAEIAEVPGIGERTAQTIYE 636
            + +A   EIA+V GI    AQ IY+
Sbjct: 594 AIKEAEPGEIAKVKGISRDLAQKIYD 619


>UVRC_TROW8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  390 bits (1001), Expect = e-110
 Identities = 249/631 (39%), Positives = 364/631 (57%), Gaps = 38/631 (6%)

Query: 9   PKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVD 68
           P+   IP  PGVYRF DE+GR++YVGKAKNLR RL SYF + +    R   M+S +  V 
Sbjct: 4   PRRIEIPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTN-ARRGRRISYMLSISKKVG 62

Query: 69  WTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV 128
           WT V  ++EAL+LEYSWIKE++P  NV+ +DDK+YP+LAVT+ E+ PR+ + R  + +  
Sbjct: 63  WTCVADDIEALRLEYSWIKEFAPPCNVKLKDDKAYPFLAVTIGEQVPRLLITR-RKIQYA 121

Query: 129 RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIG 188
            +FGPY   + +R+TV LL ++F +RTCS   +KRA +SG PC  G I+KC  PC  +  
Sbjct: 122 THFGPYPKVFHLRETVSLLHKIFQIRTCSPTNYKRAIASGMPCFEGQINKCFGPCSLKTT 181

Query: 189 VEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQA 248
             +Y+   ++  AF                              +RD IQA +TV+ + A
Sbjct: 182 HLQYQKRIKNLMAFXXXXXXXXXXXXXXXXXXXXXXXXYEEAAILRDKIQAAQTVLSRSA 241

Query: 249 VVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQT 308
           V+L ++   D IA+  D   A+VQ F V  GRI+    W  ++ ED S  +L+ Q + Q 
Sbjct: 242 VLLDETVSADFIAVVSDNSIASVQCFRVIAGRIKSVYSWHFEQQEDQSASELLSQSIIQV 301

Query: 309 YGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKR---RGAAVDVRVPQRGDKRALMET 365
           Y          ++P+ +++  +P+   A+ A L+ +   R   +++       +R L+ET
Sbjct: 302 Y-------DKLSLPKRIVLFDKPSYLSALSAHLNDKNIDRSLEIEIVYHPNEQERRLLET 354

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
           V  NA             D T R +              P+RIECFDIS L G +T  SM
Sbjct: 355 VKDNAXXXXXXXXXXXXXDYTERHRSLFELQKYLNLNSLPVRIECFDISHLSGTNTSGSM 414

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+G  +KS YR F+I   +  ++D A+M+ +I RR  R LE                
Sbjct: 415 VVFENGEPKKSAYRHFNIHIDQ--NNDTASMFSLICRRL-RSLE---------------- 455

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                + +P +   P+L+++DGG+PQ++AA  AL ++G++ + V  L+KRLEE+W PG +
Sbjct: 456 --SVAQDSPDY---PHLMIIDGGKPQLSAAVGALQEVGLK-IPVFALSKRLEELWSPGVK 509

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             +ILP  SE L+LLQ++RDE+HRFA+    R+R   LT S L  IPGLG  +   LL+ 
Sbjct: 510 TSLILPPNSESLFLLQKIRDESHRFALKQQTRRREAYLT-SELFRIPGLGKQKVMQLLRR 568

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           F S   + QA+  +I+ +PG G +TA+ I E
Sbjct: 569 FSSFAEIRQASIEDISALPGFGVKTAEKIKE 599


>UVRC_TROWT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  389 bits (999), Expect = e-110
 Identities = 249/631 (39%), Positives = 364/631 (57%), Gaps = 38/631 (6%)

Query: 9   PKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVD 68
           P+   IP  PGVYRF DE+GR++YVGKAKNLR RL SYF + +    R   M+S +  V 
Sbjct: 4   PRRIEIPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTN-ARRGRRISYMLSISKKVG 62

Query: 69  WTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV 128
           WT V  ++EAL+LEYSWIKE++P  NV+ +DDK+YP+LAVT+ E+ PR+ + R  + +  
Sbjct: 63  WTCVADDIEALRLEYSWIKEFAPPCNVKLKDDKAYPFLAVTIGEQVPRLLITR-RKIQYA 121

Query: 129 RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIG 188
            +FGPY   + +R+TV LL ++F +RTCS   +KRA +SG PC  G I+KC  PC  +  
Sbjct: 122 THFGPYPKVFHLRETVSLLHKIFQIRTCSPTNYKRAIASGMPCFEGQINKCFGPCSLKTT 181

Query: 189 VEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQA 248
             +Y+   ++  AF                              +RD IQA +TV+ + A
Sbjct: 182 HLQYQKRIKNLMAFXXXXXXXXXXXXXXXXXXXXXXXXYEEAAILRDKIQAAQTVLSRSA 241

Query: 249 VVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQT 308
           V+L ++   D IA+  D   A+VQ F V  GRI+    W  ++ ED S  +L+ Q + Q 
Sbjct: 242 VLLDETVSADFIAVVSDNSIASVQCFRVIAGRIKSVYSWHFEQQEDQSASELLSQSIIQV 301

Query: 309 YGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKR---RGAAVDVRVPQRGDKRALMET 365
           Y          ++P+ +++  +P+   A+ A L+ +   R   +++       +R L+ET
Sbjct: 302 Y-------DKLSLPKRIVLFDKPSYLSALSAHLNDKNIDRSLEIEIVYHPNEQERRLLET 354

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
           V  NA             D T R +              P+RIECFDIS L G +T  SM
Sbjct: 355 VKDNAXXXXXXXXXXXXXDYTERHRSLFELQKYLNLNSLPVRIECFDISHLLGTNTSGSM 414

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+G  +KS YR F+I   +  ++D A+M+ +I RR  R LE                
Sbjct: 415 VVFENGEPKKSAYRHFNIHIDQ--NNDTASMFSLICRRL-RSLE---------------- 455

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                + +P +   P+L+++DGG+PQ++AA  AL ++G++ + V  L+KRLEE+W PG +
Sbjct: 456 --SVAQDSPDY---PHLMIIDGGKPQLSAAVGALQEVGLK-IPVFALSKRLEELWSPGVK 509

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             +ILP  SE L+LLQ++RDE+HRFA+    R+R   LT S L  IPGLG  +   LL+ 
Sbjct: 510 TSLILPPNSESLFLLQKIRDESHRFALKQQTRRREAYLT-SELFRIPGLGKQKVMQLLRR 568

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           F S   + QA+  +I+ +PG G +TA+ I E
Sbjct: 569 FSSFAEIRQASIEDISALPGFGVKTAEKIKE 599


>UVRC_EUBE2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  388 bits (996), Expect = e-110
 Identities = 230/629 (36%), Positives = 345/629 (54%), Gaps = 36/629 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY   D+   +IY+GKAK L+ R+  YFQ       +   M+S     ++ + +
Sbjct: 11  LPAKPGVYIMHDKWDNIIYIGKAKVLKNRVRQYFQSNRNKSAKIVQMVSHIQYFEYIITD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IKE+ P++N   +DDKSYP++ +T+ EE+PRV   R  +    +YFGP
Sbjct: 71  SELEALVLECNLIKEHRPKYNTMLKDDKSYPFIKITVGEEYPRVLFARKMKHGAGKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+ A A++DT++LL +++ VRTC+  +  +     RPCL  +I +C APC G +  EEYR
Sbjct: 131 YTSAAAVKDTIELLCKLYKVRTCNRNL-PKDEGRDRPCLNYHIGQCDAPCQGYVSGEEYR 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              ++  AF+ G+  + +                      RD + +++ V +KQ +   D
Sbjct: 190 RRIDEVVAFLNGDYKKIMDRLTTQMQEASEKMEYEEAARYRDLLMSVKQVAQKQKITADD 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA A D  +A VQVF++R G++ G   + +   E  S   ++ +F+ Q YGG  
Sbjct: 250 VNDRDVIACASDGQDAVVQVFFIRQGKLLGRDHFHMKVAEGDSKSDIISEFMKQYYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP  ++V  E  D D +  WLS R+   V +  P++GDK  ++E   KNA+  
Sbjct: 308 ----TPFIPNIIMVQYEIEDADTIAQWLSARKSRKVSIVTPKKGDKEKMVELAYKNAQLV 363

Query: 374 LAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
           L +   K +R    TT +                 R E +DIS   G  +V SMVVFEDG
Sbjct: 364 LTQDAEKIKREESRTTGAMKEIAGWLGLGTLH---RAEAYDISNTNGVESVGSMVVFEDG 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             +K++YR+F IR  +G D D  +M EV++RRFTR + E  R G  D+ G          
Sbjct: 421 KPKKNDYRKFRIRTVKGPD-DYKSMREVLTRRFTRGMRE--REGLEDSHG---------- 467

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDP 547
               F+  P+L+++DGGR QV  A   L +LG+ ++ VCG+ K        ++    E P
Sbjct: 468 ----FSRYPDLIMMDGGRGQVNIALDVLKELGL-NIPVCGMVKDDTHSTRGLYYNNIEIP 522

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
           I   + SEG  L+ RV+DEAHRFAI+YHR  R KA  +SVLD I G+GPVRR AL+KHF 
Sbjct: 523 I--DKHSEGFKLITRVQDEAHRFAITYHRSLRDKAQVSSVLDSIEGIGPVRRKALMKHFL 580

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            + ++ QA+  E+ +  GI E  A+ IY+
Sbjct: 581 DIEKIRQASVDELMKADGITENVAENIYK 609


>UVRC_CLOPS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 620

 Score =  387 bits (993), Expect = e-109
 Identities = 238/631 (37%), Positives = 367/631 (58%), Gaps = 25/631 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  ++  G VIYVGKAK L+ R+  YFQ+      + + M+   A+ ++ V +
Sbjct: 11  LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+YSPR+N+  +DDK YP++ +T NE+FPRV V R   + G RYFGP
Sbjct: 71  SEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+ + + L+ ++FP+RTC   + +    + R CL  +I+ C APC G I   EY 
Sbjct: 131 YTNGTAVYEVMGLIKKLFPLRTCKKAIVEGGEPT-RACLNYHINLCKAPCAGYISKAEYW 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + ++    + G     ++                    IRD I A+  + EKQ +    
Sbjct: 190 KMIDEIINILNGTDTSIIKNXXXXXXXXXXXXXXXXXXXIRDRILAIELISEKQKMFTVK 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D I +  D+ +   QVF+VR G++ G   ++++ + D    +++  F+A  YGG  
Sbjct: 250 EGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP+ + V  E  D++ +  +L+++RG+ V ++VP++GDK+ L++ V  NA+  
Sbjct: 308 ----TAQIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIM 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   +                    P RIE +DIS +QG  +V +MVVFE+G A
Sbjct: 364 LDQFKEKMVEEKELNKSALIELADVLGLDSLPTRIEAYDISNIQGVDSVGTMVVFENGKA 423

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + S+YRRF I+  +G  +D  +M E++SRRF+  LEE  ++ E          +  E   
Sbjct: 424 KNSDYRRFKIKSVKG-PNDYESMREILSRRFSHGLEEVNKIKE----------RNLEYSK 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPII 549
            +F   P+L+++DGG+ QV  A   L D GIE + VCGL K    R   +    EE  I+
Sbjct: 473 GKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE-IPVCGLVKDDKHRTRGIIFNNEE--IL 529

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           + R S  + L+ RV+DE HR+AI+YHR  R K    S+L+DIP +G  RR  LL  FGS+
Sbjct: 530 IRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSI 589

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
             + +A+  E+ + PGI +R A++I +  +S
Sbjct: 590 DNIKKASMEELLDTPGIDKRAAESIKQYFSS 620


>UVRC_MOOTA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 613

 Score =  386 bits (992), Expect = e-109
 Identities = 258/646 (39%), Positives = 363/646 (56%), Gaps = 39/646 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  K   +P  PGVY   D +G +IYVGKA +LR R+ SYF+      PRTQ M+S  AD
Sbjct: 3   LEEKLARLPDHPGVYIMHDANGAIIYVGKAASLRNRVRSYFR--GQHQPRTQAMVSHVAD 60

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ + + EVEAL LE + IK++ PR+NV  +DDKSYPY+ +T  E+FPR+Q+ R   R 
Sbjct: 61  FEYILTDNEVEALILECNLIKQHRPRYNVSLKDDKSYPYIKITTQEDFPRIQITRSVTRD 120

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G RYFGPY+ A ++++T+ LL  +FP+RTC     +      RPCL  +I +C APC G+
Sbjct: 121 GSRYFGPYTSAGSLKETLKLLRGLFPIRTCRDTPLQ---PRSRPCLNAHIGRCLAPCAGQ 177

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E YR   ++   F+ G     ++                      D ++A++ V EK
Sbjct: 178 VDRETYREAVDNVIMFLEGRHTALVKELKEQMXXXXXXXXXXXXXXXXDQLRAVQEVCEK 237

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +               +   A   +F+ RGG++ G   + +   E +S G+++   L 
Sbjct: 238 QKLXXXXXXXXXXXXXXREGEAALGLIFFSRGGKVIGRDHFFLTGSEGLSRGEVMAALLK 297

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           + Y    +      IP E+L+  EP D   + +WLS+ RG  V++RVP+RG K  L+  V
Sbjct: 298 EYYSRGVE------IPPEILLHDEPEDAATIASWLSRLRGGRVNLRVPKRGTKLKLLRLV 351

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            +NA   L  H   R                             +DIS  QG   V +M 
Sbjct: 352 HENAVSLLQEHLLTRRRQEEGSXXXXXXXXXXXXXXXXXXXXXXYDISNFQGSSQVGAMA 411

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VF DG    S YRRF I+   G + D A++ EV+SRRF R  E+                
Sbjct: 412 VFVDGRPLPSAYRRFQIKTVRGPN-DFASLQEVLSRRFRRAAEQD--------------- 455

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEED 546
                  P FA  P+ V++DGG  Q+ AA+  ++ +G+  +   GLAK  E ++  G  +
Sbjct: 456 -------PHFADLPDFVLIDGGLGQLHAARETMEAMGVGYIPTFGLAKEEELLFRVGTSE 508

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           PI LPR S+ L +LQ +RDE HRFAI+YHR+KR K    SVLDDIPG+GP R+ ALL+HF
Sbjct: 509 PIRLPRESKALQILQHLRDEVHRFAITYHRQKREKTAYRSVLDDIPGVGPKRKKALLRHF 568

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPENS 652
           GSV  +++AT  ++  V G+    A  I   L     G+R+  E+S
Sbjct: 569 GSVAAISKATLEDLLAVEGMNRTVAARILAGL-----GRRSDGEDS 609


>UVRC_CLOP1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 620

 Score =  385 bits (990), Expect = e-109
 Identities = 239/631 (37%), Positives = 367/631 (58%), Gaps = 25/631 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  ++  G VIYVGKAK L+ R+  YFQ+      + + M+   A+ ++ V +
Sbjct: 11  LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+YSPR+N+  +DDK YP++ +T NE+FPRV V R   + G RYFGP
Sbjct: 71  SEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+ + + L+ ++FP+RTC   + +    + R CL  +I+ C APC G I   EY 
Sbjct: 131 YTNGTAVYEVMGLIKKLFPLRTCKKAIVEGGEPT-RACLNYHINLCKAPCAGYISKAEYW 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + ++    + G     +                     IRD I A+  + EKQ +    
Sbjct: 190 EMIDEIINILNGTDTSIIXXXXXXXXXXXXXXXXXXXXXIRDRILAIELISEKQKMFTVK 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D I +  D+ +   QVF+VR G++ G   ++++ + D    +++  F+A  YGG  
Sbjct: 250 EGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENISDDPVKEVISSFIASFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP+ + V  E  D++ +  +L+++RG+ V ++VP++GDK+ L++ V  NA+  
Sbjct: 308 ----TAQIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIM 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   +                    P RIE +DIS +QG  +V +MVVFE+G A
Sbjct: 364 LDQFKEKMVEEKELNKSALTELADVLGLDSLPARIEAYDISNIQGVDSVGTMVVFENGKA 423

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + S+YRRF I+  +G  +D  +M E++SRRF+  LEE  ++ E          +  E   
Sbjct: 424 KNSDYRRFKIKSVKG-PNDYESMREILSRRFSHGLEEVNKIKE----------RNLEYSK 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPII 549
            +F   P+L+++DGG+ QV  A   L D GIE + VCGL K    R   +    EE  I+
Sbjct: 473 GKFCIFPDLIMMDGGKGQVNIALEVLKDFGIE-IPVCGLVKDHKHRTRGIIFNNEE--IL 529

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           + R S  + L+ RV+DE HR+AI+YHR  R K    S+L+DIP +G  RR  LL  FGS+
Sbjct: 530 IRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSI 589

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
             + +A+  E+ + PGI +R A++I +  +S
Sbjct: 590 DNIKKASMEELLDTPGIDKRAAESIKQYFSS 620


>UVRC_CLOPE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 620

 Score =  384 bits (986), Expect = e-108
 Identities = 239/631 (37%), Positives = 368/631 (58%), Gaps = 25/631 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  ++  G VIYVGKAK L+ R+  YFQ+      + + M+   A+ ++ V +
Sbjct: 11  LPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHSEKVRAMVKNIAEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+YSPR+N+  +DDK YP++ +T NE+FPRV V R   + G RYFGP
Sbjct: 71  SEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+ + + L+ ++FP+RTC   + +    + R CL  +I+ C APC G I   EY 
Sbjct: 131 YTNGTAVYEVMGLIKKLFPLRTCKKAIVEGGEPT-RACLNYHINLCKAPCAGYISKAEYW 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + ++    + G     +                     IRD I A+  + EKQ +    
Sbjct: 190 EMIDEIINILNGTDTSIIXXXXXXXXXXXXXXXXXXXXXIRDRILAIELISEKQKMFTVK 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D I +  D+ +   QVF+VR G++ G   ++++ + D    +++  F+A  YGG  
Sbjct: 250 EGDEDFIDLYTDEKDGCAQVFFVREGKVTGREHFMIENIGDDPVKEVISSFIASFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP+ + V  E  D++ +  +L+++RG+ V ++VP++GDK+ L++ V  NA+  
Sbjct: 308 ----TAQIPKTIYVPEEIEDQELIEKFLTEKRGSKVWIKVPKKGDKKNLLDMVRNNAKIM 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   +                    P+RIE +DIS +QG  +V +MVVFE+G A
Sbjct: 364 LDQFKEKMVEEKELNKSALTELADVLGLDSLPVRIEAYDISNIQGVDSVGTMVVFENGKA 423

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + S+YRRF I+  +G  +D  +M E++SRRF+  LEE  ++ E          +  E   
Sbjct: 424 KNSDYRRFKIKSVKG-PNDYESMREILSRRFSHGLEEVNKIKE----------RNLEYSN 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPII 549
            +F   P+L+++DGG+ QV  A   L   GIE + VCGL K    R   + L  EE  I+
Sbjct: 473 GKFCIFPDLIMMDGGKGQVNIALEVLKGFGIE-IPVCGLVKDHKHRTRGIILNNEE--IL 529

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           + R S  + L+ RV+DE HR+AI+YHR  R K    S+L+DIP +G  RR  LL  FGS+
Sbjct: 530 IRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGEKRRRNLLMKFGSI 589

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
             + +A+  E+ + PGI +R A++I +  +S
Sbjct: 590 DNIKKASMEELLDTPGIDKRAAESIKQYFSS 620


>UVRC_GLOVI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 628

 Score =  382 bits (980), Expect = e-108
 Identities = 240/627 (38%), Positives = 328/627 (52%), Gaps = 44/627 (7%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT  GVY  RDE G ++YVGKAKNLR R+ SYFQ      PR   M+    D +  + +T
Sbjct: 19  PTSAGVYLMRDEAGEILYVGKAKNLRNRVRSYFQPGHDHSPRIAIMVGKVHDFELILTDT 78

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMR--GARRRGVRYFG 132
           E EAL LE + IK + PR+NV  +DDK YPYL +T +EE+PR+ V R  G+     RYFG
Sbjct: 79  EAEALVLEDNLIKTHKPRYNVLLKDDKQYPYLCITWSEEYPRIFVTRRRGSGHPEDRYFG 138

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY+ A A+  T+ LL ++FP+R  +  VFK      RPC+   + +C   C   I  +EY
Sbjct: 139 PYTDAGALHSTLGLLKKLFPLRQRNTPVFK-----DRPCINYEMGRCPGLCQRLISPQEY 193

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL- 251
           RA        + G T   L                     +RD I  L  +   Q + + 
Sbjct: 194 RATIRQIQMILQGRTAELLAQLEDQMQTAAAAMNFEHAARLRDRITGLNQLGAHQKITVP 253

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
                              +Q+F VR G++ G  G+          G ++++ L + Y  
Sbjct: 254 XXXXXXXXXXXXXXXXXXXIQLFQVRSGKLIGRLGFSA-AASGEDPGHILQRVLEEHYRA 312

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
           +  EE    IP EVL      + D +  WL++++G  V++  PQR  K  L+E V +NAE
Sbjct: 313 SASEE----IPLEVLTQHPLPEADILATWLAEKKGRKVEIHAPQRQIKAELVEMVARNAE 368

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L R   +R S    + K              P R+EC+DIS +QG  TVAS VVF DG
Sbjct: 369 AELQR--LERFS--RRQEKGLLNLAEALELPSVPRRMECYDISHIQGTDTVASRVVFVDG 424

Query: 432 LARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
              K  YR + IR      G   D A+M EVISRRF R   ES+  G+L           
Sbjct: 425 APAKQYYRHYKIRDPRIVAGRPDDFASMAEVISRRFAR--AESEPEGDL----------- 471

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPI 548
                      P+LVV+DGG+ Q++AA+  +++L   DV   GLAKRLEEV+LPG  DP+
Sbjct: 472 -----------PDLVVIDGGKGQLSAARAVMEELSYGDVPTIGLAKRLEEVFLPGRSDPV 520

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           ++ +    L+LLQR+RDEAHRFA+S+HR +R K +T S LDDIPG+GP +R  LL  F S
Sbjct: 521 LIAQGDPALHLLQRIRDEAHRFAVSFHREQRGKRMTRSSLDDIPGIGPAKRKILLDTFRS 580

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIY 635
           V  L +A+  EIA+ PGIG R AQ I+
Sbjct: 581 VPVLEKASFEEIAKTPGIGSRLAQVIH 607


>UVRC_CLOK5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 622

 Score =  378 bits (971), Expect = e-107
 Identities = 217/625 (34%), Positives = 338/625 (54%), Gaps = 26/625 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  ++  G VIYVGKAK L+ R+  YFQ       + +TM+   ++ ++ V +
Sbjct: 11  LPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQKSKNHSEKVRTMVKHISEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+Y PR+N+  +DDK YP + +TLNE+FPR+   R   + G +YFGP
Sbjct: 71  SEMEALVLECNLIKKYRPRYNILLKDDKIYPLIKITLNEDFPRIICARNKIKDGAKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y    A+ +T++++ ++FP+R C   + K+     RPCL  +I  C APC G I  EEY 
Sbjct: 131 YISTGAVYETMEVIKKIFPIRDCKLNI-KKGNVKVRPCLNYHIGLCKAPCTGHISKEEYG 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            +      F++G+    +R                    +RD I AL  ++EKQ +  G 
Sbjct: 190 KIISGVMDFLSGKNKDIIRKLKEDMDTLSENMEFEKAAELRDKIFALEKIIEKQKITTGG 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D I I  D+ ++ +QVF+ R G+I G   ++++  +D+  G++V  F+ + YGG  
Sbjct: 250 FEDEDFINIHSDEKDSCIQVFFSRTGKIIGREHFIIEDTQDLPKGEIVANFIKEFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                TA   + +   E  D   +  WLS ++ + V +++PQ+GDK+A++  V KNA  T
Sbjct: 308 -----TAYIAKTIYVPEIYDVQLLEDWLSIKKDSKVYIKIPQKGDKKAILNLVEKNARTT 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L   K +   D                    P RIE +D+S +QG  +V +MVVFE+G  
Sbjct: 363 LQNFKLKFIQDKKMYETSLEELMEILNLDDIPHRIEAYDVSNIQGVDSVGTMVVFENGRP 422

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + ++YRRF I   +GA +D  +M E++ RRF   +                     E  A
Sbjct: 423 KHNDYRRFKINEVKGA-NDYESMKEILRRRFQNGM----------XXXXXXXXXXLEFSA 471

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPII 549
            +F++ P+L+++DGG+ QV+AA   L +  I D+ VCG+ K    R   +    EE P  
Sbjct: 472 GKFSFFPDLILMDGGKIQVSAALEVLKEFNI-DITVCGMVKDDKHRTRGLIYRNEEMP-- 528

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           L R S  + L+ R++DE HRFA++YHR  R+K +  SVL+DIP +G  RR  LLK F SV
Sbjct: 529 LNRNSNIIKLITRIQDEVHRFAVTYHRSLRSKRVLHSVLEDIPNVGVKRRKELLKRFLSV 588

Query: 610 RRLAQATAAEIAEVPGIGERTAQTI 634
             + +A+  E+   P I  RTA++I
Sbjct: 589 ENIKKASMEELISTPSIDMRTAESI 613


>UVRC_GEMAT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 616

 Score =  378 bits (970), Expect = e-107
 Identities = 230/625 (36%), Positives = 331/625 (52%), Gaps = 39/625 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY ++D  G+V+YVGKAK LR+R+ SY+       P+T+ M+    D++  VV 
Sbjct: 10  LPESPGVYLWKDVEGQVLYVGKAKRLRSRVRSYWAQEHESSPKTRAMVRKVRDLETIVVP 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E  AL LE + IKEY PRFN+  RDDKSYPY+ VT+NE FPRV V R     G RYFGP
Sbjct: 70  SEAHALILEATLIKEYHPRFNIALRDDKSYPYIRVTVNEPFPRVMVTRRLLDDGARYFGP 129

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+R  ++++ R+F VR+C   +     +  RPCL   I +C APCVG    E+YR
Sbjct: 130 YTDVGAMRRALNVVKRIFTVRSCHYAL--PGEAPERPCLDYSIKRCKAPCVGYQSREDYR 187

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
           A+ ++   F+ G T   +                     +RD +  L  +     V+  +
Sbjct: 188 AMIDEVVWFLDGRTSDVMHHVRERMLDASERLDFERAAELRDALAHLEKMESPSVVLEVE 247

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DV+  A D  +A V V  +RGG++      +++  ED   G ++   LAQ Y  A+
Sbjct: 248 GGDRDVVGYARDGEDACVAVMRIRGGKLLARDHRLLEHAEDEEDGAVLGACLAQWYRTAE 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                 A   E+LV  +  DR+++ A L         +RVPQRG +RAL++   +NA   
Sbjct: 308 ------ARAGELLVPFDFEDRESLEASLD-----GTHIRVPQRGPRRALVDLADQNARHX 356

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
                                          P  + CFDIS  QG   VAS V FE+G  
Sbjct: 357 XXXXXXXXXXXXXRAVDPVYELQRELGLPRLPRSLVCFDISHAQGTDVVASAVFFENGRP 416

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           ++SEYR+F I+  EG D D  +M+EV++R F R L+E + +                   
Sbjct: 417 KRSEYRKFKIKVFEGND-DFRSMHEVVTRYFRRRLDEEKPL------------------- 456

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRT 553
                 P+L V+DGG+ Q+ AA+ ALD+LG   + +  LAKR EE++  G  DP+ LPR 
Sbjct: 457 ------PDLAVIDGGKGQLGAARAALDELGAPQIGLISLAKREEEIFQYGRPDPVRLPRR 510

Query: 554 SEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLA 613
           S  L +LQ+ RDEAHRFAI++ R+KRA     S L  IPG+GP +R ALL  FGSV+ + 
Sbjct: 511 SPALRMLQQARDEAHRFAITFQRQKRAARTITSELLKIPGVGPTKRRALLHTFGSVQGVR 570

Query: 614 QATAAEIAEVPGIGERTAQTIYERL 638
           +A+  +IA +PG G  +A+ + E L
Sbjct: 571 EASVEQIAAIPGFGAASARRLLEAL 595


>UVRC_CLOCE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 613

 Score =  377 bits (967), Expect = e-106
 Identities = 215/627 (34%), Positives = 338/627 (53%), Gaps = 31/627 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P   GVY  +D +G VIYVGKA  L+ R+  YFQ  +   P+ Q M+S  ++ ++ VV+
Sbjct: 11  LPDKSGVYIMKDANGVVIYVGKAVVLKNRVRQYFQQSANHPPKVQAMVSKVSEFEYIVVD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +EVEAL LE + IK+Y P++N+  +DDK YPY+ VTLNEE+PR+   R   + G RYFGP
Sbjct: 71  SEVEALMLECTLIKKYKPKYNILLKDDKHYPYIKVTLNEEYPRILKTRRVEKDGARYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           YS  +A+ DT+D L ++F ++TC+  +  R     RPCL  ++ +C APC G +  +EYR
Sbjct: 131 YSSGFAVNDTIDTLKKLFSLKTCNKNL-PRDIGKTRPCLNYHMKQCLAPCQGGVNRDEYR 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + +  C F+ G+    +                     +R+ I +++ + E Q V+  D
Sbjct: 190 EMMKKICRFLGGQYDEIINDLRIQMETAAEQLDFEKAAQLRNKITSIKQLSESQKVLFTD 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D+I  + D  +  +QVF+VR GR+ G   ++ +   +   G  +  F+ Q Y    
Sbjct: 250 LEDRDIIGYSADSTDLCIQVFFVRNGRVIGREHFIFEGEANEDKGYSLSTFIKQFY---- 305

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                  +P E+++ +E  D + +  WL+++RG  V +RVPQRGD   L+  V +NAE T
Sbjct: 306 --TKVQYVPSEIVLQSEVDDSETIAKWLTEKRGFKVALRVPQRGDLVKLVHMVSENAEIT 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L  H+ +++ + T  S+              P RIE +DIS       VASMVVFE+G  
Sbjct: 364 LKLHRERQSREGTVHSEGMAQLVKLLGLEEAPARIESYDISNTGSSEIVASMVVFENGRP 423

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
            + EYR+F ++  E   +D  +M E + RR  R   E +              +G E   
Sbjct: 424 ARQEYRKFKMKSIE-QQNDYGSMQETLFRRLNRAKREKE--------------EGTEN-- 466

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPII 549
            +F+  P+L++VDGG   V AA++ +++LG  +  + G+AK    R + +   G E    
Sbjct: 467 AKFSKLPDLILVDGGSNHVNAARQVVEELGY-NFKIAGMAKDDRHRTKSLVYMGNE--YE 523

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           L      L  +  ++DE HR A+ Y+R+ R K    S LD+I G+G  R+ AL+KHF SV
Sbjct: 524 LATNMPLLRFITEIQDETHRVAVEYNRKLREKRYVRSELDEIEGIGQTRKKALIKHFKSV 583

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYE 636
             + +A  A++ EV GI E+ A+ IYE
Sbjct: 584 AAIRKADIAQLQEVNGISEKIAKNIYE 610


>UVRC_RUBXD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 611

 Score =  375 bits (963), Expect = e-106
 Identities = 263/635 (41%), Positives = 353/635 (55%), Gaps = 37/635 (5%)

Query: 9   PKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVD 68
           P    +P  PGVY FRD  GRV+YVGKA+N+R+R++SYF       P+   +      +D
Sbjct: 7   PDRSHLPASPGVYIFRDGEGRVLYVGKARNIRSRVASYFTRSGDGRPKIAELRERVRQID 66

Query: 69  WTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV 128
           +     E EAL LE + IK + PRFN   RDDKSYPY+ VT  +E+PRV   RG      
Sbjct: 67  FIAARGETEALVLEANLIKRHRPRFNASLRDDKSYPYIVVTTGDEYPRVFATRGPHDPRH 126

Query: 129 RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIG 188
           RYFGP+  A ++  T+D+L + F  R C     +  R SG PCL  +I + +APC+G + 
Sbjct: 127 RYFGPFPSAGSVHATLDVLNKTFRFRKCRGP--EPGRRSGIPCLNYHIGRSAAPCIGAVS 184

Query: 189 VEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQA 248
            EEY A+  D  AF+ G     +                               V ++Q 
Sbjct: 185 KEEYGAIIADVIAFLEGRVDGLIXXXXXXXXXXXXXXDFXXXXXXXXXXXXXXHVRDRQQ 244

Query: 249 VVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQT 308
             +      D +    +  EA VQ+F VR GRI G   +++D   +     +   F+ Q 
Sbjct: 245 ATIASEDSFDAVGAYAEGEEACVQIFAVREGRIVGRDSFLLDNYGEQDAESVALSFVPQY 304

Query: 309 YGGADDEESTTAIPREVLVSAEPADRDAVVA-WLSKRRGAAVDVRVPQRGDKRALMETVL 367
           Y        T A+PREVLVS+   +  A +A  LS+ RG  V+VR PQRGDKR ++E  L
Sbjct: 305 Y-------ETAAVPREVLVSSPDEEALAPIAEHLSRLRGTRVEVRRPQRGDKRRVLELAL 357

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
            NA   L   ++   +                        IEC+DIS   G ++VASMVV
Sbjct: 358 HNARMGLEHERAMSEAXXXXXXXXXXXXXXXXXXXXXXXXIECYDISNTMGTNSVASMVV 417

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           F+ G   K +YRRF I+  EGAD D A+M                               
Sbjct: 418 FQGGRPAKDQYRRFRIKTVEGAD-DPASM------------------AXXXXXXXXXXXA 458

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG----IEDVAVCGLAKRLEEVWLPG 543
           G E+ +P     P+L+++DGG+ Q++A    L+ LG    + D+ V  LAKR EEV+ PG
Sbjct: 459 GDEKFSP----APDLILLDGGKGQLSAVAEVLEGLGSGGRLPDIPVRALAKREEEVFEPG 514

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
              P++L   S  L LLQRVRDEAHRFA +YHR+ R +A+TASVLDD+PG+GPVR+  +L
Sbjct: 515 RPGPVVLAPDSAELRLLQRVRDEAHRFANAYHRKLRGRAMTASVLDDLPGVGPVRKRRIL 574

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +HFG+ +            VPG+  R A+ I+ RL
Sbjct: 575 EHFGTPQXXXXXXXXXXXXVPGLPGRVAREIHARL 609


>UVRC_SYNWW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 601

 Score =  370 bits (950), Expect = e-104
 Identities = 221/630 (35%), Positives = 329/630 (52%), Gaps = 40/630 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ +   +P  PGVY F+++ G+V+YVGKA+ LR R+ SYFQ    +HP+ + M++  +D
Sbjct: 6   LKERLKKVPLQPGVYLFKNQEGQVLYVGKARVLRQRMRSYFQAPERMHPKVKAMMAWVSD 65

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            D+ V ++E+EAL LE + IK Y PR+N+  RDDKSYPY+ VT+ ++FPRV + R  +  
Sbjct: 66  FDFIVTHSEMEALILENNLIKSYKPRYNIDLRDDKSYPYIKVTVADKFPRVYLAREKKDG 125

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             RYFGPY+   ++RDT+ LL  VF +R+C     +  +S  RPCL   + KC +PC G 
Sbjct: 126 VSRYFGPYTDVTSLRDTLKLLNGVFGLRSC-----RTMKSRRRPCLNRDMGKCLSPCSGE 180

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  EEY    +    F+ G+    +R                    +RD IQ+LR + EK
Sbjct: 181 ISEEEYSQKVQALITFLEGDFQEIVREKEKEMAMAARSLEFEKAARLRDQIQSLRQLGEK 240

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q + L    + D++ +   + E  V VF VR G+I G+  + + +       + +E F+ 
Sbjct: 241 QKIELASPYELDLVGMLSGEKENLVLVFKVRSGKIVGKDTFWLKRPIQEDENEAMEFFIK 300

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
             Y    D      IP E+L+S  P++   V AWL  R    V++RVPQRG+K+ +    
Sbjct: 301 HYYDENPD------IPPEILLSHLPSESKLVEAWLKSRVSHRVELRVPQRGEKKQVXXXX 354

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
                      + +    L   S               P R+ECFD+S L GE TVASMV
Sbjct: 355 XXXXXXXXXXKQREENKQLAALS----HLARVLDLEVVPNRLECFDVSHLAGEETVASMV 410

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VF  G   K  YR F IR  +  ++D A++ E + RR                       
Sbjct: 411 VFVGGQPEKKAYRHFKIRTQQ--NNDTASLAETVRRRL---------------------- 446

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEED 546
           + A +  P F   P+L++VDGG  QV A    L ++ + D+ +  LA++ EE++ PG+  
Sbjct: 447 ENARQANPAFLPEPDLILVDGGLGQVNAVAAVLQEMNL-DIPLFALAEKNEEIYRPGKSQ 505

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P++L     GL LLQR+RDEAHRFAI Y+            LD+IPG+G  R+  LL HF
Sbjct: 506 PLVLAARDNGLQLLQRLRDEAHRFAIEYNXXXXXXXXXXXXLDEIPGIGKQRKKNLLVHF 565

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            SV ++ +A+  EIA VPG+  + A  + E
Sbjct: 566 TSVAKIKEASLDEIAAVPGMNRKAALAVIE 595


>UVRC_CLOB8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 621

 Score =  370 bits (950), Expect = e-104
 Identities = 211/625 (33%), Positives = 337/625 (53%), Gaps = 22/625 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVY  ++  G +IYVGKAK L+ R+  YFQ+      + + M+   A+ ++ V +
Sbjct: 11  LPNEPGVYLMKNSLGEIIYVGKAKILKNRVRQYFQNSKNHSEKVKAMVKNVAEFEYIVTD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+YSP++N+  +DDK YP++ VT NE+FPRV + R   + G +YFGP
Sbjct: 71  SEMEALILECNLIKKYSPKYNISLKDDKFYPFIKVTTNEDFPRVFITRNYAKDGNKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  A  + +T++L+ ++FP+RTC   + +  + + R CL  +I KC+APC GRI   EY+
Sbjct: 131 YPNAGDVHETINLIRKIFPLRTCKKSIIEGEKPT-RACLNYHIKKCNAPCEGRISKTEYK 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            + ++    ++G+    L                     +RD + A+  + EKQ V    
Sbjct: 190 KMIDEIMEVLSGKDRSLLNKLKEEMQSASGNLEFEKAASLRDKMIAIENIAEKQKVFKSQ 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D I I +D+ +  +QVF++R G+I G   ++++         ++ QF+   YGG  
Sbjct: 250 ENDEDFINIYKDEKDCCIQVFFLRDGKITGREHFMIENSSHEEDTTIISQFIISFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  +P+ + +  E  + +A+  +LS +RG+ V V+VP +G+K+ ++E V  NA+ T
Sbjct: 308 ----TPKVPKNIYI-PESDEIEALEEFLSIKRGSRVFVKVPIKGEKKEMLELVKNNAKVT 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   D                    PLRIE +DIS +QG  +V SM+VFE+G A
Sbjct: 363 LDQFKDKILRDKEINMISLKEIQELLELDSIPLRIEAYDISNIQGVDSVGSMIVFENGKA 422

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + S+YRRF I+  + A +D  +M E++ RRFT  L              SG         
Sbjct: 423 KNSDYRRFRIKTVKSA-NDYDSMREILDRRFTHGLXXXXXXXXXXXXFSSG--------- 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRT 553
            +F+  P+L+++DGG+ QV  A   L+ LGI D+ VCGL K                   
Sbjct: 473 -KFSNFPDLIMMDGGKGQVNIALEVLEKLGI-DIPVCGLVKDDYHATRGXXXXXXXXXXX 530

Query: 554 SEG--LYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
                + +++R++DE HRFAI+YHR  R K    S+LDDIP +G  RR +LL  FGS+  
Sbjct: 531 XXXXLMQMIRRIQDEVHRFAITYHRSLRDKRTLHSILDDIPNIGQKRRMSLLMKFGSIDN 590

Query: 612 LAQATAAEIAEVPGIGERTAQTIYE 636
           + +AT  E+ E   I  + A ++ E
Sbjct: 591 IKKATLDELLETESIDTKAANSVLE 615


>UVRC_METBU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 604

 Score =  369 bits (947), Expect = e-104
 Identities = 231/631 (36%), Positives = 345/631 (54%), Gaps = 42/631 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           +RP   +IP  PGVY  +D    +IY+GKAK+L+ R+S YFQ       +T+ M+   AD
Sbjct: 1   MRPDISNIPELPGVYLMKDISDNIIYIGKAKSLKKRVSQYFQSSKNHSSKTRAMVRKIAD 60

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           VD+ V  +EV AL LE + +K+  P +N+  +DDK YPY+ VT+N +FP++ + R     
Sbjct: 61  VDYIVTESEVAALILEANLVKKNRPHYNIDLKDDKRYPYVKVTVNTKFPKIFITRRRLMD 120

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G  YFGPY+    +R T+D++ ++F ++ C+  V  + +   R CL  +ID+C APC G 
Sbjct: 121 GALYFGPYTNVKPVRQTLDMISQIFRIKRCNRRVDGKGK---RACLNYHIDRCYAPCNGS 177

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  EEYR    +      GET   ++                    IRD I AL+++  +
Sbjct: 178 ITPEEYRNNVMEAVKLFKGETSGTIKELQEKMNIHAIAQEYESAAVIRDQIDALKSLSRQ 237

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDV-STGKLVEQFL 305
           Q    G+            +    VQ+FY+R G + G+    +   +   +  ++ E+F+
Sbjct: 238 QTATAGNXXXXXXXXXXXXE-TVFVQIFYIRDGNMVGKADMSLSWGDATGNIARVTEEFI 296

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y  A        +P E+LV     +++ V+ WLS++   +V ++VPQRG+K+ LME 
Sbjct: 297 KQYYQDA-------PVPPEILVQYPIPEKELVIKWLSEKAARSVQIQVPQRGNKKRLMEM 349

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             +NA+ TL      + SD                    P  IE FDIS + G   V SM
Sbjct: 350 AEQNAQMTL-EQSHLKQSDKEXXXXXXXXXXXXXXXSTLPAHIEGFDISNISGTDAVGSM 408

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFE+GL   S+YR F+I+  +G D D A M EV+ RR+T    E  ++           
Sbjct: 409 VVFENGLPANSKYRHFNIKTVKGID-DFAMMAEVVKRRYTHQKAEKDKL----------- 456

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLP--G 543
                         P+L+++DGG  QV+AA  +L +L + D+ + GLAKR E + +P  G
Sbjct: 457 --------------PDLILIDGGPGQVSAAMGSLKELQL-DIPLVGLAKRFEHIIVPKDG 501

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            ++ +ILP TSE L +L RVRDE+HRFA+S HRR+R   L+ S LD IPG+G  R+ ALL
Sbjct: 502 TDEVVILPHTSEALKVLMRVRDESHRFAVSSHRRRRTARLSHSELDTIPGIGASRKKALL 561

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTI 634
            HF S+ ++  A+  E+  V GI +  A+ I
Sbjct: 562 NHFSSIEQIRHASVEELTAVEGISKGLAERI 592


>UVRC_THETN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 617

 Score =  368 bits (944), Expect = e-104
 Identities = 217/620 (35%), Positives = 336/620 (54%), Gaps = 25/620 (4%)

Query: 19  GVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVEA 78
           GVY  +DE G +IYVGKA  L+ R+  YFQ+     P+ + M+S   D ++ V +TE+EA
Sbjct: 15  GVYLMKDEEGNIIYVGKASVLKNRVRQYFQNTDNHPPKVKVMLSHVEDFEYIVTDTELEA 74

Query: 79  LQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAW 138
           L LE + IK+Y P++NV  +DDK+YPY+ +T+ E++PR+   R     G +YFGPY  A+
Sbjct: 75  LMLECNLIKKYKPKYNVLLKDDKNYPYIKITVAEDYPRIMFTRKIDMDGSKYFGPYGSAF 134

Query: 139 AIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAED 198
           A+R+T+ L+ ++FP+RTC+  + +++    R CL  +I  CSAPC GRI  EEYR L + 
Sbjct: 135 AVRETIKLVRKMFPIRTCNVNI-EKSLGKVRECLYYHIGLCSAPCTGRIEKEEYRKLVDQ 193

Query: 199 FCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDCD 258
              F+ G+    +                     +RD I A+  + EKQ V   +  + D
Sbjct: 194 AVMFLEGKREWLVEKLKEEMQKAADELRFEEAARLRDQIFAIEKISEKQKVTSINEDEQD 253

Query: 259 VIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEEST 318
           VI++A     A ++VF+VR G++ G   + +   E +   +++  F+ Q Y      ES+
Sbjct: 254 VISMARSDDIAHIEVFFVREGKLSGREHYYMKNTEGMGREEIISSFIKQFY------ESS 307

Query: 319 TAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHK 378
            ++P                 WLS++RG  V + VP RG K+ L++ V +NA + L    
Sbjct: 308 PSVPXXXXXXXXXXXXXXXXXWLSQKRGNRVSITVPLRGKKKELVDMVYQNAVEALKNEI 367

Query: 379 SQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEY 438
             R   L                   P RIE +DIS ++GE  V SMVVF DG  +KSEY
Sbjct: 368 LAREKIL---KDPAVLELSNLLGIEYPKRIEAYDISNVRGEDNVGSMVVFVDGKPKKSEY 424

Query: 439 RRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAY 498
           R+F+I+  EG D D  +M E+I RRF   LEE +++ E  TL +  A         +F  
Sbjct: 425 RKFTIKYVEGQD-DYQSMREMIERRFLHALEEKKQIEE-GTLSKEKA---------KFIE 473

Query: 499 PPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGEEDPIILPRTSEG 556
            P+L++VDGG   V AA   ++ LGI  V V G+ K  R     L G    + +P T   
Sbjct: 474 MPDLILVDGGIGHVNAALEVIEKLGI-SVPVYGMVKDSRHRTRGLVGVSGEVQMPVTGRA 532

Query: 557 LYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQAT 616
             L+ ++++EAHRFAI++HR +++K     +L +I G+G  R   L + FGS+  + +A+
Sbjct: 533 FRLVAQIQEEAHRFAITFHRERQSKRFKTDLL-NIKGIGEKRAKVLYEAFGSIEEIKKAS 591

Query: 617 AAEIAEVPGIGERTAQTIYE 636
             E+ +V G+ ER+A+ +YE
Sbjct: 592 LEELKKVKGMNERSAKAVYE 611


>UVRC_SYNJB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  367 bits (943), Expect = e-103
 Identities = 251/656 (38%), Positives = 356/656 (54%), Gaps = 50/656 (7%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           R  L  +   IP +PGVY  RD   +++YVGK+K LR+R+ SYF+  S L PR Q M++ 
Sbjct: 9   RDVLESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTSDLSPRIQRMVAQ 68

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
             ++++ V + E EAL LE + IK + P +NV  +DDK YPYL +T +E +P++ + R  
Sbjct: 69  VCEIEFIVTDNESEALALEDNLIKTHQPPYNVLLKDDKKYPYLCITWSEPYPQLYITRHR 128

Query: 124 R--RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSA 181
           R  R   +Y+GPY+    +R T+ L+ R+FP+R     ++K      R CL   I +C  
Sbjct: 129 RLDRNQDKYYGPYTDVGLLRHTLGLVKRIFPLRQRPKPLYK-----DRTCLNYDIGRCPG 183

Query: 182 PCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALR 241
            C G I  EEYR           G+T   +R                      D I+ L 
Sbjct: 184 VCQGLISPEEYRKTLTQVAMIFQGQTDELIRELQEKMIXXXXXXXXXXXXXXXDQIRGLE 243

Query: 242 TVMEKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
            + E Q V L +ST   D +A+A +   A +Q+F VR G++ G  G+V +   D   G +
Sbjct: 244 QLGESQKVSLPNSTVSRDALALAMNDSRACIQLFQVRAGKLVGRLGFVAENRGD-DPGLI 302

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
           +++ L + Y   D  E    IP E+L   E  D D + +WLS+++G  V +  PQR  K 
Sbjct: 303 LQRALQEHYQYCDPVE----IPSEILTQYELPDHDFLESWLSQKKGRKVSLVAPQRQSKA 358

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
            L+E V +NA+  L R +                          P R+E +DIS +QG  
Sbjct: 359 ELIELVERNAQLELTRTQXXXXXXXXXXXXXXXXXXXPDV----PRRLEAYDISHIQGSD 414

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGEL 477
            VAS VVF DGL  K  YRR+ IR  E   G   D A+  EV  RRF++   E Q     
Sbjct: 415 AVASQVVFIDGLPAKQHYRRYKIRNPEVRPGHSDDFASHAEVARRRFSKMTPEDQ----- 469

Query: 478 DTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLE 537
                                 P+LV++DGG+ Q++A    L DLG++ + V  LAKR E
Sbjct: 470 ----------------------PDLVLIDGGKGQLSAVMAVLADLGLDHLPVIALAKREE 507

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           E++LPG   P+ LP       LLQR+RDEAHRFA+++HR++R     AS LD+IPGLG  
Sbjct: 508 EIFLPGNPVPLRLPAQDPARLLLQRLRDEAHRFALAFHRQQRKARQHASTLDEIPGLGKY 567

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL---TSVEGGQRTQPE 650
           R+  L++ F S+ R+  A+  ++A+VPGIG + A+ IY      T  E  +  Q E
Sbjct: 568 RQKLLMEEFRSIARIQVASEDQLAQVPGIGPKIARQIYRYFHPETQAESPETAQVE 623


>UVRC_MICAN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 625

 Score =  367 bits (942), Expect = e-103
 Identities = 222/629 (35%), Positives = 333/629 (52%), Gaps = 40/629 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PGVY  RD++G ++Y+GK+K LR+R+ SYF+    L PR   M+    ++++ V +
Sbjct: 24  IPLEPGVYFLRDQNGEILYIGKSKKLRSRVRSYFRPSQPLSPRIALMVRQVTEIEFIVTD 83

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR--RRGVRYF 131
           TE E+L LE + IK++ P FN   +DDK YPY+ +T +E +PR+ + R  R   +  RY+
Sbjct: 84  TEAESLALEANLIKQHQPHFNTLLKDDKKYPYICITWSETYPRIFITRKRRINNQKDRYY 143

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R T+ L+ R FP+R     +FK      RPCL   I +C   C   I  ++
Sbjct: 144 GPYVDTRLLRYTLHLIKRTFPLRQRPQPLFK-----DRPCLNYDIGRCPGVCQKLISPQD 198

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           YR   +       G TG  L                     IRD I+ L+ +   Q V L
Sbjct: 199 YRETLQKVAMIFQGRTGELLEKLATKMLAASENLDFEQAATIRDQIRGLQALNTDQKVSL 258

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            D T   D IA+A+D+    +Q+F VR GR+ G  G+  D  +  + G+++++ L + Y 
Sbjct: 259 PDDTVSRDAIALAKDEQHCCIQLFQVRSGRLVGRLGFFADS-QSANEGEILQKVLEEHYL 317

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             +  E    IP E+L+  E  + + +  WL +++G  V++ VPQR  K  L+  V KNA
Sbjct: 318 SVEGVE----IPSEILLPCELPEGEVLAGWLREKKGRKVELTVPQRQSKADLLAMVEKNA 373

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L   K++R++D   +S               P RIE +DIS +QG + VAS VVF D
Sbjct: 374 LYEL--EKTKRSADRDLQS--LQDLAVILDLPALPHRIEGYDISHIQGSNAVASGVVFID 429

Query: 431 GLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           G+A    YR + I+  E   G   D A++ EVI RRF RY E    + E D         
Sbjct: 430 GVAANQHYRHYKIKNPEVKIGHSDDFASLAEVIRRRFRRYAENPDNIAESDDF------- 482

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG-IEDVAVCGLAKRLEEVWLPGEED 546
                       P+LV++DGG+ Q++A    L ++  +E V V  LAK+ EE++LPGE  
Sbjct: 483 ------------PDLVMIDGGKGQLSAVVAVLGEMNLLEQVKVVSLAKQREEIFLPGESS 530

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P+   +   G+ LL+RVRDEAHRFA+S+H            LD+IPGLG  R+  LL HF
Sbjct: 531 PLETDKEQPGVQLLRRVRDEAHRFAVSFHXXXXXXXXXXXXLDEIPGLGFKRQKELLAHF 590

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            S+  + +A+  ++ +V GIGE+ A+ IY
Sbjct: 591 HSLDYIREASLEQLQQVTGIGEQLAKEIY 619


>UVRC_PROA2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 616

 Score =  363 bits (932), Expect = e-102
 Identities = 219/603 (36%), Positives = 324/603 (53%), Gaps = 38/603 (6%)

Query: 10  KPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDW 69
           K  ++PT PGVY+F++  G +IYVGKAKN+R+R+ SYF++   +  +T+ +++  AD+D 
Sbjct: 15  KLSNLPTCPGVYQFKNNQGTIIYVGKAKNIRSRVRSYFREGPHISGKTKVLVNHIADIDI 74

Query: 70  TVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVR 129
            + ++EVEAL LE + IK+  PR+N+  +DDK+YPYL +T NE FPR+ + R  +R G  
Sbjct: 75  ILTSSEVEALILENNLIKDLKPRYNINLKDDKTYPYLVIT-NEAFPRILITRQVKRDGST 133

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGR--PCLLGYIDKCSAPCVGRI 187
           YFGPY+ A  +R  +DL+  +FPVR C   + K    SGR   CL  +I  C  PC G+ 
Sbjct: 134 YFGPYTEARQLRSVLDLISTIFPVRKCKLKLTKENIESGRFSVCLNYHIHTCKGPCEGKQ 193

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             E+Y  + E+    + G+TG  +R                    ++  I+ LR   E+Q
Sbjct: 194 REEDYLRMIEEIKGLLKGKTGALIRTLSAEMHRYADELRFEEAAELKIQIEGLRKYTERQ 253

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            VV  D  D DV  IA+ Q +A   +F +R G++ G +      V+D     L+ + L +
Sbjct: 254 KVVSKDPVDRDVFGIAQHQDDACGVIFKIREGKLLGSQRMYFSNVDDEQHETLLRKCLEK 313

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y      E+   IP+E+ +   P D D V+A         +   VP+ G+K  L+   +
Sbjct: 314 YY-----LETPDLIPQEIFLPL-PIDDDEVMALRELTGDINLRFIVPKIGEKAKLVAMCI 367

Query: 368 KNAEQTLARH--KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
            NA   L  +  + Q+  +L+                  P RIECFD S  QG    +SM
Sbjct: 368 DNARHHLEEYLIEKQKRGELSRIVPALQALQETLHLSRQPERIECFDNSHFQGTDYTSSM 427

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           V F  G  RKS+YR+F +   EG+D D AAM E ++RR++  L++   +           
Sbjct: 428 VCFVGGKPRKSDYRKFKLNSFEGSD-DYAAMQEAVTRRYSGSLQDELPL----------- 475

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEE 545
                         P+L+V+DGG+ QV  A + L +LG+E + V GLAKRLEE++LP   
Sbjct: 476 --------------PDLIVIDGGKGQVNTAWKVLQELGLE-IPVIGLAKRLEEIFLPNTP 520

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           DP  L +TS  L LLQ++RDEAHRFAI+YHR+ R K    + L DI G+G      LL+H
Sbjct: 521 DPYNLAKTSPALKLLQQIRDEAHRFAITYHRKLRTKRTIQTGLTDIAGIGEKSAMKLLEH 580

Query: 606 FGS 608
           FGS
Sbjct: 581 FGS 583


>UVRC_DESAA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  363 bits (931), Expect = e-102
 Identities = 220/641 (34%), Positives = 336/641 (52%), Gaps = 52/641 (8%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           +  K  ++   PGVY  +DE G +IYVGKA++L+ R+SSYF +      +T  ++   A 
Sbjct: 4   IEKKLATLSNGPGVYLMKDESGEIIYVGKARSLKKRVSSYFLEKPNRDLKTGILVKKIAS 63

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            D  +V TE EAL LE + I+++ PR+N+  +D K +P L + +   +PR++V+R  ++ 
Sbjct: 64  FDAILVTTEKEALILEANLIRKHKPRYNILLKDGKRFPSLRIDVRTSYPRLEVVRKVKKD 123

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G  YFGP+S A  +R T+ ++ + F +R C     K      RPCL   + +C  PC   
Sbjct: 124 GAIYFGPFSSAGKLRSTLKIINKTFQLRKCKQ---KEPPKRNRPCLNYQMGQCLGPCCLP 180

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  +EY  +  +   F+ G T   L+                    +RD + A++  +EK
Sbjct: 181 VDRDEYLDMVNEVILFLKGRTNDLLQKIKEQMAAASERQEYELAARLRDRMFAIQATVEK 240

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           QA V  D  D DVI I  +   +A+ V Y+RGG + G R +  D+V    + + ++ FL 
Sbjct: 241 QAAVTTDFVDRDVIGIDREPEGSAISVLYIRGGFLLGSRNYNFDEVLGTDS-ESIQAFLR 299

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y      +    IP EV V  +  + + +  WL++     V +  PQRG+K  L+E  
Sbjct: 300 QYY------DKDRFIPDEVFVPCQLENMELMEQWLTETAEKRVVLHWPQRGEKTRLIEMA 353

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            +NA + L      R S                     P RIECFDIS   G  TVASM+
Sbjct: 354 NENAHEAL----KDRISSENVFKSLLERLQKRLRMDRPPRRIECFDISHTGGNQTVASMI 409

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VFEDG   KSEYR F+I   +  D D AAM+EV++RRF                      
Sbjct: 410 VFEDGKEAKSEYRTFNIDSLDHPD-DYAAMHEVMARRF---------------------- 446

Query: 487 QGAERKAPRFAYP-PNLVVVDGGRPQVAAAQRALDDLGIEDV-AVCGLAKR-------LE 537
                 +P   +P P+++++DGG+ Q++     LD LG+     V  +AK+       ++
Sbjct: 447 ------SPDKDWPTPDVLLIDGGKGQLSITASVLDGLGVMGAFEVISIAKKDEAKKETMD 500

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           +++ PG+ +P++  R  + L  LQRVRDEAHRFAI+ HR+KRAK +  S LD +PG+G  
Sbjct: 501 KIYRPGQANPVVFGRDGDVLLFLQRVRDEAHRFAITTHRKKRAKTIRKSALDSVPGIGEK 560

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           R+ ALL+HFGS++RL +A+  +IA+VPGI  + AQ I E L
Sbjct: 561 RKKALLRHFGSIKRLKEASPEDIAQVPGISVKRAQEILEAL 601


>UVRC_CYAP4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 624

 Score =  362 bits (930), Expect = e-102
 Identities = 236/632 (37%), Positives = 345/632 (54%), Gaps = 43/632 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PGVY  RD   +++Y+GK+K LR+R+ SYF+ F+ L PR + M+   A++++ V +
Sbjct: 23  IPAEPGVYFMRDSQDQILYIGKSKKLRSRVRSYFRKFNELGPRLELMVRQVAEIEFIVTD 82

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQV--MRGARRRGVRYF 131
           T           IK++ P FNV  +DDK YPYL +T +E +PR+ +   R A  +  RY+
Sbjct: 83  TXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSEAYPRIFITRKRRAEAKDDRYY 142

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY+    +R T+ L+ R+FP+R     +FK      RPCL   I +C   C   I  E+
Sbjct: 143 GPYTDTHLLRQTLGLVKRIFPLRQRPKPLFK-----DRPCLNFDIGRCPGVCQQLIASED 197

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           YR           G T   +                     IRD I  L+T+ E+Q V L
Sbjct: 198 YRKTIHKVAMIFQGRTSELIDTLTPQMEAAAENLNFEQAARIRDQINGLKTLGEEQKVSL 257

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            D T   D IA+A D+  A +Q+F +R GR+ G  G+V D  +    G ++++ L + Y 
Sbjct: 258 PDDTVSRDAIALAADEQHACIQLFQIRAGRLVGRLGFVAD-AQSGPPGAILQRVLEEHYA 316

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
           GAD  E    IP E+LV  E  + + +  +L++ +G  V + VPQR  K  L+E V +NA
Sbjct: 317 GADPVE----IPAEILVQTELPEAEMLATYLTEYKGRKVTLLVPQRQSKAELIEMVERNA 372

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
           +  LAR  +QR SD    ++                RIE +DIS +QG   VAS VVF D
Sbjct: 373 QYELAR--TQRFSDRNAEAQKXXXXXXXXXXXXQ--RIEGYDISHVQGSDAVASRVVFID 428

Query: 431 GLARKSEYRRFSIRG---AEGADSDVAAMYEVISRRFTRYLE--ESQRVGELDTLGESGA 485
           GL  K  YR + I+      G   D A++ EV+ RRF +++E  E+ R+ + D       
Sbjct: 429 GLPAKQHYRHYKIKNPNVTAGHSDDFASLAEVVQRRFRKFIEHPETDRLSDPDW------ 482

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG-IEDVAVCGLAKRLEEVWLPGE 544
                         P+L+++DGG+ Q++A   AL   G +ED+ +  LAK+ EE++LPGE
Sbjct: 483 --------------PDLIMIDGGKGQLSAVVNALSGTGLLEDLQIVSLAKQREEIFLPGE 528

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
             P+       G+ LL+R+RDEAHRFA+S+H            LD+IPGLG  R+  LL 
Sbjct: 529 SLPLNTDPDQPGVQLLRRLRDEAHRFAVSFHXXXXXXXXXXXXLDEIPGLGYERQKQLLA 588

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            F S+  + +A+  ++A VP IG R AQ IY+
Sbjct: 589 AFRSIDYIREASPEQLATVPLIGPRLAQQIYD 620


>UVRC_ALHEH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 611

 Score =  362 bits (930), Expect = e-102
 Identities = 249/633 (39%), Positives = 349/633 (55%), Gaps = 53/633 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           S+   PGVYR  D  G V+YVGKA+NL+ R++SYF   S    R + M++   D+  TV 
Sbjct: 16  SLTQRPGVYRMVDGRGEVLYVGKARNLKKRVASYFTR-SRKSARIELMLTQVQDIQVTVT 74

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE + IKE  PR+NV  RDDKSYP++ ++ +++FPR+   RGAR+   R+FG
Sbjct: 75  HTEAEALILENTLIKELRPRYNVLLRDDKSYPWIYLSSHQDFPRLSFHRGARKGPGRWFG 134

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P+    A+R+T++ L +VF +R C    F    +  RPCL   I +C+APCVG I  E Y
Sbjct: 135 PFPSGHAVRETLNTLQKVFRIRQCQDSFFS---NRSRPCLQHQIKRCTAPCVGYISREAY 191

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +        F+ G + + +                      RD IQAL+ V E+Q +V G
Sbjct: 192 QEDVRHAVLFLEGRSNQVIEELGARMEAASERLEFEAAAQYRDRIQALQAVQERQYIV-G 250

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVIA   D + A V VF+ R GR  G + +     E     +++  FLA+ Y G 
Sbjct: 251 EKGDLDVIACVSDGVTACVTVFFFRQGRNLGNKVFYPRIPEGADEAEVLAAFLARYYIG- 309

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                    P E+++S    ++  +   LS+  G  V V    R ++R  +E  L NA  
Sbjct: 310 ------RKAPPELVISHTIPEQKVLGEALSRESGHRVRVTHSVRKERRRWLEMALTNARH 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L    S +A  L                     RIECFDIS  +GE TVA+ VVF    
Sbjct: 364 ALTARTSTQAMAL----HRXXXXXXXXXXXXXXXRIECFDISHTRGEATVAACVVFNQDG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             KS+YRRF+IRG    D D AAM + +SRR+ R L++ + V                  
Sbjct: 420 PLKSDYRRFNIRGITPGD-DYAAMRQALSRRYQR-LKKGEGV------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPII--- 549
                  P+++++DGG+ QVA A+  L++L ++DV + G+AK  E    PGEE  I+   
Sbjct: 460 ------LPDILLIDGGKGQVAQAEAVLEELQVDDVYLVGIAKGPER--RPGEETLILSDE 511

Query: 550 ------LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
                 L   +  L LLQ+VRDEAHRFAI+ HR++R KA T S L+DIPGLGP RR ALL
Sbjct: 512 DGREKTLGPDAPALQLLQQVRDEAHRFAIAGHRQQRGKARTRSALEDIPGLGPKRRQALL 571

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +HFG ++ +A+A   ++A  PGI    AQ +Y+
Sbjct: 572 RHFGGLKAVARAGVEDLARTPGISRALAQKVYD 604


>UVRC_THICR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 613

 Score =  362 bits (928), Expect = e-102
 Identities = 224/628 (35%), Positives = 336/628 (53%), Gaps = 51/628 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVY   D  G++IYVGKAKNL+ R+SSYF+       +T+T++S  A ++ TV +TE E
Sbjct: 22  PGVYLMYDASGQIIYVGKAKNLKRRVSSYFKKRHE-EIKTETLVSQVASIEVTVTDTESE 80

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IK + PR+N+ +RDDKSYPY+ V+  ++FP +   RGA+R+  RYFGP+  A
Sbjct: 81  ALILENTLIKRHKPRYNILFRDDKSYPYIFVSTGKKFPSLSYHRGAKRKVGRYFGPFPNA 140

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEYRALA 196
            A+  T+  L ++FPVR C+  VF       RPCL   I +CS PCV G +   EY    
Sbjct: 141 SAVHQTLHALQKIFPVRQCTESVFNH---RSRPCLQYQIKRCSGPCVEGLVTEAEYNEDV 197

Query: 197 EDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTD 256
           +   AF+ G++   +                      RD I ALR +  +  +    S D
Sbjct: 198 QHTIAFLEGKSFDVIESLGHKMQQASDEFEFEKAALYRDKISALRAIQSQHLINQPGSKD 257

Query: 257 CDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKV--EDVSTGKLVEQFLAQTYGGADD 314
            DV+A+AE+  +  V +   RGG + G + +   K+  + ++ G+++  F+ Q Y     
Sbjct: 258 TDVVALAEEANQVCVSIMMYRGGNLWGSQNY-FPKIGGQSINPGEIISAFITQHY----- 311

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
                 IP+ +LVS    D+ ++  WLS+++ A V +R       + LM+  L NA+  L
Sbjct: 312 --IDLPIPQMILVSDVLEDKSSLETWLSEQKKAKVSIRKAVSQTHKGLMKLALTNAQSGL 369

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            +  +Q+AS    +++              P  +ECFDIS  QG  TVAS VVF +G+  
Sbjct: 370 KQQLTQKAS----QAERVKSLQDVLALASPPNHMECFDISHTQGNQTVASCVVFNEGVPN 425

Query: 435 KSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAP 494
            S YR+F+I G +  D D AAM++ I+RR++R  +E             G P        
Sbjct: 426 TSAYRKFNIEGIQPGD-DYAAMHQAITRRYSRVKKE-------------GLPL------- 464

Query: 495 RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPI 548
                P+L+V+DGG+ Q+  A      L ++++ +  +AK       LE ++ P  E+ I
Sbjct: 465 -----PDLIVIDGGKGQLNKAIDVFKTLELDNLPLVSVAKGEGRKAGLEILYTPFNEEGI 519

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
            L      L+LL  +RDEAHRFAI+ HR +R KA T S L+DIPG+G   R  LL HFG 
Sbjct: 520 DLEADDIALHLLNYIRDEAHRFAITSHRSRRQKAQTHSRLEDIPGVGAKTRHKLLTHFGG 579

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  +  A  +E+ +VPGI  R AQTIY+
Sbjct: 580 LTEVKNAAVSELQKVPGISARIAQTIYD 607


>UVRC_ALCBS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  361 bits (927), Expect = e-102
 Identities = 244/627 (38%), Positives = 347/627 (55%), Gaps = 48/627 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D  G V+YVGKA+NL+ARL+SYFQ  +    +T+ ++    D+  TV  +EVE
Sbjct: 17  PGVYRMLDAEGGVLYVGKARNLQARLNSYFQK-NVASVKTRALVGRIRDIQTTVTGSEVE 75

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE S IKE  P +N+  RDDKSYPY+ +T ++ FPRV   RG RR G +YFGPY   
Sbjct: 76  ALLLEQSLIKELKPPYNILLRDDKSYPYIRITRSDRFPRVTFHRGTRRAGSQYFGPYPSG 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+R+ + L+ ++F VR CS   F   R+  RPCL   I++C+APCVG +  E+Y     
Sbjct: 136 SAVREALSLIEKIFQVRNCSDSYF---RNRTRPCLQHQINRCTAPCVGLVSEEDYARQVT 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                          RD + A++ V +KQ    G   D 
Sbjct: 193 MAADFLDGRSREVADQLSTDMXXXXXXXXXXXXXXXRDQLAAIQAVQQKQYAETGQG-DL 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+AI      A ++V  +R GRI G R +  D   +    +++E FL+Q Y G D E+ 
Sbjct: 252 DVVAIETRHGLAIIEVLMIRDGRILGHRTFRPDTRGEDDRSEILEAFLSQYYLG-DREDP 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
               P+E+L+  E    +A+   L ++    V +    R D+ A +     NA+Q++A  
Sbjct: 311 VK--PQEILLCMEIPGAEALQQALEEQWAKKVRLAWRVRSDRAAWISMAQTNAQQSMATE 368

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPL-RIECFDISTLQGEHTVASMVVFEDGLARKS 436
            + R        +              P+ RIECFDIS  QGE  VAS VVF+   ARK 
Sbjct: 369 MAAR-----EHMEARFLALETLLESSEPIRRIECFDISHTQGEKAVASCVVFDQQGARKQ 423

Query: 437 EYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRF 496
           +YR F++  A G D D  A+ E I RR+ R L+E  R+                      
Sbjct: 424 DYRYFNVNPAAGGD-DYEALEEAIRRRYQRVLKEQGRM---------------------- 460

Query: 497 AYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVAVCGLAK------RLEEVWLPGEEDPII 549
              P+L+++DGG+ Q+    + + +L +   + V G+ K        E ++LP  ++ I 
Sbjct: 461 ---PDLLLIDGGKGQMQRGWKVVQELDLHASIRVMGIGKGPSRRPGFEALYLPCGKEMIP 517

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
            P  S  L+LLQ+VRDEAHRFA++ HR +R KA   S LD+IPG+GP RR ALL HFG +
Sbjct: 518 GPADS-ALHLLQQVRDEAHRFALTGHRARRGKARKQSTLDEIPGIGPKRRKALLTHFGGL 576

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYE 636
           +++  A+A+E A VPGI  + AQT+Y+
Sbjct: 577 KQMRNASASEFARVPGINSQMAQTLYD 603


>UVRC_SYNJA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 621

 Score =  359 bits (921), Expect = e-101
 Identities = 241/628 (38%), Positives = 345/628 (54%), Gaps = 47/628 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PGVY  RD   +++YVGK+K LR+R+ SYF+    L PR Q M+    ++++ V +
Sbjct: 19  IPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTGDLSPRIQRMVVQVCEIEFIVTD 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR--RRGVRYF 131
            E EAL LE + IK Y P +NV  ++DK YPYL +T +E +P++ + R  R  +   +Y+
Sbjct: 79  NESEALALEDNLIKTYQPPYNVLLKEDKKYPYLCITWSEPYPQIYITRHRRLNQNQDKYY 138

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY+    +R T+ L+ R+FP+R     ++K      RPCL   I +C   C G I  E 
Sbjct: 139 GPYTDVGLLRYTLGLVKRIFPLRQRPKPLYK-----DRPCLNYDIGRCPGVCQGLISPEA 193

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           YR           G+T   +R                     RD I+ L  + + Q V L
Sbjct: 194 YRKTVAQVAMIFQGQTDELIRELKEKMXXXXXXXXXXXXXRYRDQIRGLEQLGQSQKVSL 253

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            +ST   D IA+A +   A +Q+F VR G++ G  G+V +   D     ++++ L + Y 
Sbjct: 254 PNSTASRDAIALAMNDSRACIQLFQVRAGKLVGRLGFVAENRGD-DPALILQRVLQEHYQ 312

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E    IP E+L   E  DRD + +WLS+++G  V +  PQR  K  L+E V +NA
Sbjct: 313 YCDPVE----IPSEILTQYELPDRDFLESWLSQKKGRKVSLLAPQRQSKAELIELVERNA 368

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
           +                                 P R+E +DIS +QG   V S VVF D
Sbjct: 369 Q----XXXXXXXXXXXXXXXXXXXXXXVLDLPEPPRRLEAYDISHIQGSDAVGSQVVFID 424

Query: 431 GLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           GL  K  YRR+ IR  +   G   D A+  EV  RRF++   E Q               
Sbjct: 425 GLPAKQHYRRYKIRNPQVRPGHSDDFASHAEVARRRFSKMTSEDQ--------------- 469

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDP 547
                       P+LV++DGG+ Q+AA    L +LG++ + V  LAKR EE++ PG+ +P
Sbjct: 470 ------------PDLVLIDGGKGQLAAVMAVLAELGLDHLPVFALAKREEEIFRPGDPEP 517

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
           + LP       LLQR+RDEAHRFA++YHR++R     ASVL++IPGLG  R+  L++ F 
Sbjct: 518 LRLPPQDPARLLLQRLRDEAHRFALAYHRQQRKLRQQASVLEEIPGLGKQRQKLLMEAFR 577

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIY 635
           S+ R+  AT  ++A+VPGIG + A+ IY
Sbjct: 578 SLARIQVATEEQLAQVPGIGPKLARQIY 605


>UVRC_RHOS4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  358 bits (920), Expect = e-101
 Identities = 248/626 (39%), Positives = 346/626 (55%), Gaps = 43/626 (6%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   +V+YVGKA+NLRAR+S+Y +  S    R   MI   A + +        
Sbjct: 29  PGVYRMLDAQSQVLYVGKARNLRARVSNYARP-SGHSGRIARMIRETASMMFXXXXXXXX 87

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                 + IK+  PR+NV  RDDKS+P + +  +  FP ++  RG +     YFGP++ A
Sbjct: 88  XXXXXQNLIKQLKPRYNVLLRDDKSFPNILIAKDHPFPMLKKHRGKKSEKGSYFGPFASA 147

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+  T++ L RVF +RTCS   F+   S  RPCLL  I +CSAPCVGR+  E+Y  L  
Sbjct: 148 GAVNRTLNQLQRVFLLRTCSDATFE---SRTRPCLLFQIKRCSAPCVGRVPAEDYAELIG 204

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
           D   F+ G T +                       +RD I+AL  V   Q +      + 
Sbjct: 205 DAERFLQGRTTKVQANLXXXXXXXXXXXXXXRAAALRDRIKALTQVQSSQGINPRGVAEA 264

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVIA+  +  +A VQVF++R  +  G R +           +++E FLAQ Y   DD+E 
Sbjct: 265 DVIAVHLEGGQACVQVFFIRANQSWGNRDFFPRTGAGAEEPEILEAFLAQFY---DDKEP 321

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
               PR +L+S    + D V   LS+R G  V + VPQRG+K  L+E   +NA ++LAR 
Sbjct: 322 ----PRMILLSHPVDNPDLVGQLLSERAGRKVTLGVPQRGEKAELVENAARNARESLARR 377

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            ++ A    T+++              P RIE +D S +QG + V  M+V       KS+
Sbjct: 378 MAESA----TQNRLLAGLAEAFELDAAPKRIEVYDNSHIQGTNAVGGMIVAGPEGFLKSQ 433

Query: 438 YRRFSIRGAEGADSD-VAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRF 496
           YR+F+IRGA GA  D    M EV++RRF R L+E                   ERK   +
Sbjct: 434 YRKFNIRGAAGAQGDDFGMMKEVLTRRFERLLKEDP-----------------ERKTDAW 476

Query: 497 AYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIIL 550
              P+L+++DGG  QV+A Q  L +LG++DV   G+AK +      EE   PGE  P  L
Sbjct: 477 ---PDLLLIDGGAGQVSAVQEILQELGVDDVPFIGVAKGIDRDAGKEEFHRPGEP-PFAL 532

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
                 LY +QR+RDEAHR+AI  HR KRAKA++A+ LD+IPG+G  R+ ALL HFGS +
Sbjct: 533 RMNDPVLYFVQRLRDEAHRWAIGAHRAKRAKAVSATPLDEIPGVGAARKRALLAHFGSAK 592

Query: 611 RLAQATAAEIAEVPGIGERTAQTIYE 636
            +A+A   ++  V GI E  AQ+I++
Sbjct: 593 AVARAGVPDLCAVEGISETMAQSIHD 618


>UVRC_CHLTE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 626

 Score =  358 bits (918), Expect = e-100
 Identities = 245/638 (38%), Positives = 342/638 (53%), Gaps = 35/638 (5%)

Query: 2   TVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMI 61
           T +  L  K  ++PT PGVYRF +  G VIYVGKA+NLR R+ SYF        +T  M+
Sbjct: 11  TAKSALAEKLATLPTSPGVYRFSNAAGTVIYVGKARNLRNRVRSYFNSQGRQPGKTAVMV 70

Query: 62  STAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMR 121
           S  AD++  + ++EVEAL LE + IKE  PR+NV  +DDKSYP+L +T NE FPR+ + R
Sbjct: 71  SHIADLNVIITSSEVEALILENNLIKELKPRYNVNLKDDKSYPWLVIT-NERFPRIFLTR 129

Query: 122 GARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSG--RPCLLGYIDKC 179
             RR G  YFGPY+ A  +R  +DL+  +FPVR+C   + + A +SG  R CL  +I KC
Sbjct: 130 QVRRDGSLYFGPYTEASQLRLILDLIGSIFPVRSCKYKLTEEAVASGRYRVCLDYHIHKC 189

Query: 180 SAPCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQA 239
             PC G    EEY+A+  +    + G+T   LR                        I+ 
Sbjct: 190 KGPCEGLQSEEEYQAMIREIVTLLKGKTSALLRDLSAEMQXXXXXXXXXXXXXXXXQIEG 249

Query: 240 LRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGK 299
           L+   E+Q +V  ++ D DV A+A  + +A   VF +R G++ G R   +    +     
Sbjct: 250 LKRYAERQKIVSTEAIDRDVFAVAAGEDDACGVVFRIREGKLIGSRHTYLSNTGNTPLPN 309

Query: 300 LVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDK 359
           L+  F+   Y    D                              R   V   VP+ G+K
Sbjct: 310 LLASFVEHYYLETPDLIXXXXXXXXXXXXXXXXXXXXXXXXXXTER-RQVRFTVPRIGEK 368

Query: 360 RALMETVLKNAEQTLARHKSQR--ASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
             L+   L NA+  L     Q+    ++  +S               P RIECFD S  Q
Sbjct: 369 AHLIAMCLDNAKHHLHEFMVQKKLRGEIARKSPALESLKQVLHLGKLPERIECFDNSHFQ 428

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGEL 477
           G   V+SMV F  G  +KS+YR+F ++  EG+D D AAM E ++RR+   L      GEL
Sbjct: 429 GTDYVSSMVTFVSGKPKKSDYRKFRLKSFEGSD-DYAAMREAVTRRYGGSL-----AGEL 482

Query: 478 DTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLE 537
                                 P+LV++DGG+ QV  A + L +LG+ D+ V GLAKRLE
Sbjct: 483 PL--------------------PDLVLIDGGKGQVNVAWQVLQELGL-DLPVAGLAKRLE 521

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           E+++P E DP  LP+TS  L LLQ++RDEAHRFAI+YHR+ R+     + L  I G+G  
Sbjct: 522 EIYVPNEPDPYNLPKTSPALKLLQQLRDEAHRFAITYHRKLRSDRTIRTELTGIKGVGEK 581

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
               LLKHFGSV  +++A+  E++ V   G +TA++IY
Sbjct: 582 SAEKLLKHFGSVESVSKASIDELSAV--AGRKTAESIY 617


>UVRC_PSEMY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  355 bits (910), Expect = e-100
 Identities = 223/635 (35%), Positives = 334/635 (52%), Gaps = 58/635 (9%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RLSSYF+  +   P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDADARLLYVGKAKNLKKRLSSYFRK-TGQAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ + EFPR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +   R+  RPCL   I +C  PCVG +  EEY     
Sbjct: 136 LAIRESLSLLQKTFLVRQCEDSYY---RNRTRPCLQYQIKRCKGPCVGLVSPEEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G S D 
Sbjct: 193 HSVMFLEGRSNALSEELSASMEKASMALEFERAAELRDQISMLRRVQDQQSME-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A+  +   A V +  VRGGR+ G + +      +   G+++  FLAQ Y G  + + 
Sbjct: 252 DVVAVMLNPGGACVHLISVRGGRVLGSKNFFPQVAIEEEGGEVLMAFLAQYYLGNAERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLA-- 375
              +P E++V+ +  D   ++  +               G +    +  + NAEQ LA  
Sbjct: 311 ---LPSELIVNVQHEDFSTLIEAVEXXXXXXXXXXXXXXGTRARWQQLAVTNAEQALAAR 367

Query: 376 ----RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
               +H ++R   L T                 P R+ECFDIS   GE TVAS VVF   
Sbjct: 368 LANRQHLAERFEALAT----------VLEMDEPPQRMECFDISHSSGEATVASCVVFGPE 417

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G    D D AAM++ ++RRF++  +   ++                 
Sbjct: 418 GPLKSDYRRFNIEGVTPGD-DYAAMHQALTRRFSKIKDGEGKL----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
                   P++++VDGG+ Q+A A+  L +L + D+ + G+AK       LE ++L   E
Sbjct: 460 --------PDVLLVDGGKGQLAMAREVLQELAVPDLILLGVAKGTTRKPGLEVLYLNDAE 511

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
               LP  S  L+L+Q++RDE+HRFAI+ HR +R KA   S L+++ G+GP RR  LL H
Sbjct: 512 HEFTLPGNSPALHLIQQIRDESHRFAITGHRARRGKARRTSTLEEVAGIGPKRRRELLNH 571

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           FG ++ L++A+A EIA+ PGI ++ A+ IY  L S
Sbjct: 572 FGGLQELSRASAEEIAKAPGISKKLAELIYATLHS 606


>UVRC_NOSP7 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 625

 Score =  354 bits (909), Expect = 1e-99
 Identities = 223/637 (35%), Positives = 333/637 (52%), Gaps = 40/637 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  +   IP +PGVY  RD   R+IY+GK++ LR+R+ SYF+D      R  TM+    +
Sbjct: 17  LENRLAEIPPEPGVYFMRDNSDRIIYIGKSRKLRSRVRSYFRDGYNKTERIATMVKLVTE 76

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR-- 124
           +++ V +T           IK++ P FNV  +DDK YPYL +T +E++PR+ + R  +  
Sbjct: 77  IEFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYLCITWSEDYPRIFITRKRQLG 136

Query: 125 RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
           +   +++GPY+ A  +R+ V +  R+FP R     +FK      RPCL   + +C   C 
Sbjct: 137 KEKDKFYGPYTDAGLLREIVRICKRIFPQRQRPQPLFK-----DRPCLNYDLGRCPGVCQ 191

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
                EEYR + +       G T   +                     IRD I  L+++ 
Sbjct: 192 KLTSPEEYRKIVQKIAMVFQGRTQELIDILTQQMNAAAENLNFESAARIRDQISGLKSLT 251

Query: 245 EKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
             Q V L D T   D IA+A ++  A +Q+F +R G++ G   +V D   ++  G ++++
Sbjct: 252 ADQKVSLPDDTVSRDAIALAANEEHACIQLFQIRAGQLVGRLAFVADAHAEL--GAILQR 309

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
            L + Y  AD  E    IP E+LV  +  D D +   L++R+G  V +  P R  K  L+
Sbjct: 310 ALEEHYQTADSVE----IPLEILVQHDLPDSDILADVLTQRKGKKVTILTPLRQTKAELI 365

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           E V +NA+  L R   Q+  D   ++               P RIE +DIS +QG + VA
Sbjct: 366 EMVERNAQYELQR--MQKFGDRNHQAMQDLAAILDLPDV--PHRIEGYDISHIQGSNAVA 421

Query: 424 SMVVFEDGLARKSEYRRFSIRG---AEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           S VVF DGL  K  YR + I+      G   D A++ EVI RRF +Y E+ Q       L
Sbjct: 422 SQVVFIDGLPAKQHYRHYKIKNPTVTAGHSDDFASLAEVIQRRFRKYAEDPQ-------L 474

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEV 539
              G P             P+L+++DGG+ Q+++    L ++ + ED+ V  LAK+ EE+
Sbjct: 475 SRLGNPDW-----------PDLIMIDGGKGQLSSVTAVLQEMNLLEDLRVVSLAKQREEI 523

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           +LPGE  P        G+ LL+R+RDEAHRFA+S+HR++R+  L  S LD+IPGLG  R+
Sbjct: 524 FLPGESKPSSTDAEQPGVQLLRRLRDEAHRFAVSFHRQQRSDKLKRSRLDEIPGLGHHRQ 583

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
             LL HF SV  + QAT  ++AEVPGIG R AQ IY+
Sbjct: 584 KQLLGHFRSVDYIRQATTPQLAEVPGIGPRLAQEIYD 620


>UVRC_PELLD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 628

 Score =  353 bits (907), Expect = 2e-99
 Identities = 247/641 (38%), Positives = 349/641 (54%), Gaps = 49/641 (7%)

Query: 2   TVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMI 61
           T  P LR    S+PT PG+Y+F++  G+VIYVGKAKN+R+R+ SYF+D   L  +TQ ++
Sbjct: 7   TTLPELRETVASLPTGPGIYQFKNSAGKVIYVGKAKNIRSRVRSYFRDPRQLTGKTQVLV 66

Query: 62  STAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMR 121
               D++  + ++EVEAL LE + IKE  PR+NV  +DDK+YP+L +T  E FPRV + R
Sbjct: 67  GHITDLEIIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPWLVIT-GEPFPRVFISR 125

Query: 122 GARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKR--ARSSGRPCLLGYIDKC 179
              R    +FGPY+ A  +R  ++L+  +FPVR+C   +     A    + CL  +I KC
Sbjct: 126 NRTRDKSTWFGPYTEAGQLRSILELIGSIFPVRSCRYSLTPENIAAKKHKLCLDYHIGKC 185

Query: 180 SAPCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQA 239
             PC G     EY  +  +    + G T   L+                     +  +Q+
Sbjct: 186 KGPCEGLQNEAEYLEMIGEIVRLLKGRTAGLLKELHEKMXXXXXXXXXXXXXXXKMQLQS 245

Query: 240 LRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGK 299
           LR   ++Q +V  D  D DV AIA    EA   VF +R G++ G R +++         K
Sbjct: 246 LRRYADRQKMVAADGMDRDVSAIASGDDEACGVVFRIREGKMLGARHFILTNTAGEPEKK 305

Query: 300 LVEQFLAQTYGGADDEESTTAIPREVLVSA--EPADRDAVVAWLSKR------RGAAVDV 351
           L+ + L   Y      +S  A+P EVL+SA  +  D +++ A   +R      R  AV  
Sbjct: 306 LLGKVLEGYY-----LKSPEAMPEEVLLSAQLDLEDTESLQALSREREEECPTRRKAVKF 360

Query: 352 RVPQRGDKRALMETVLKNAEQTLARH--KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIE 409
            VPQ G+K  L+E   +NA   LA +  + Q+  +                    P RIE
Sbjct: 361 TVPQIGEKAHLVEMCRQNARHHLAEYLVQKQKRGEAAREHYGVKALGESLHLETPPKRIE 420

Query: 410 CFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAE-----GADSDVAAMYEVISRRF 464
           CFD S LQG   V+SMV F +G   KS YR+F ++  E     G+  D AAM +V+ RR+
Sbjct: 421 CFDNSHLQGTDYVSSMVCFVNGKPLKSAYRKFRLQSLEEACGTGSSDDYAAMEQVLGRRY 480

Query: 465 TRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI 524
              L++   +                         P+L+VVDGG+ Q  +A++ LD LGI
Sbjct: 481 GGSLQDELPL-------------------------PDLIVVDGGKGQANSAKKVLDRLGI 515

Query: 525 EDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALT 584
             V V GLAKRLEEV+ P  + P  LP+TS  L LLQ++RDEAHRFAI+YHR  R+K   
Sbjct: 516 -TVPVIGLAKRLEEVFTPDADGPFNLPKTSPALKLLQQLRDEAHRFAITYHRNIRSKRTL 574

Query: 585 ASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPG 625
            + L  IPG+G     ALL+ FGSV  +A A+A E+++  G
Sbjct: 575 ETGLTTIPGVGEKIAFALLERFGSVDGVAAASAEELSQFAG 615


>UVRC_ACIBL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  353 bits (906), Expect = 2e-99
 Identities = 220/626 (35%), Positives = 336/626 (53%), Gaps = 48/626 (7%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  K  ++PT PGVY +++  G +IYVGKAKNLR+R+ SYF   +  + +T +++  A D
Sbjct: 3   LHQKIRTLPTSPGVYLYKNAEGEIIYVGKAKNLRSRVGSYFVRGADENSKTGSLLREAVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           V++ VV+ E EAL LE + IK+  PRFN+  RDDK+YPY+ +T+ E++PRV V R  ++ 
Sbjct: 63  VEYIVVDNEKEALALENNLIKQKKPRFNILLRDDKTYPYIKLTMGEKWPRVYVTRRLKKD 122

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-G 185
           G  Y+GP+  A      VDL+ R F V +C   +    R   RPCL  YI +C  PCV G
Sbjct: 123 GSEYYGPFFPANLAYRVVDLIHRNFLVPSCYIDL---RRYHPRPCLQHYIGRCLGPCVEG 179

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
                +Y    +D   F+ G      +                     RD I  +  + +
Sbjct: 180 LTNEVQYGEAVKDVKLFLEGRHSDLKQSLTARMNKAAEGMQFELAAKYRDLITTVEDLHQ 239

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVED------VSTGK 299
           KQ +   +  D DV     +    AV +F++RGG++   R +  + + +      ++TG+
Sbjct: 240 KQRIAAAEGDDADVFGYHYENHMVAVNLFHMRGGKVLDRRDFFFEDLGEMEATGGLNTGE 299

Query: 300 LVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDK 359
                L Q Y           +PR + V  E  DR+A+   LS++    +D+ VPQRGDK
Sbjct: 300 FFSTLLQQIY------LDNKYVPRTIYVPVEFEDREALCEILSEQMHRKIDINVPQRGDK 353

Query: 360 RALMETVLKNAEQTL-ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
           R+L++ V +NA+Q+   R +  R      +S               P RIECFDIS +QG
Sbjct: 354 RSLIDLVAQNAKQSYDQRFRVMRPQTDVLKS----VLQDTLELPELPNRIECFDISHIQG 409

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELD 478
             TVASMVV+EDG  +KS+YR+F I+  +G D D A+M EV++RR+ R +EE+Q +    
Sbjct: 410 AETVASMVVWEDGKMKKSDYRKFIIKTVQGVD-DFASMREVVTRRYKRIVEENQPM---- 464

Query: 479 TLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEE 538
                                P+LV++DGG  Q+ AA  AL+ +GI +  +  +AKR E 
Sbjct: 465 ---------------------PSLVLIDGGVGQLHAAAGALEAIGITNQPLASIAKREEI 503

Query: 539 VWLPGEED-PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           +++ G ED PI +   S  L+++Q +RDEAHRFAI++HR++R     ++ L +IPG+G  
Sbjct: 504 IYVHGREDEPIRIDHHSPVLHIIQLIRDEAHRFAITFHRKRREIRDRSNELLEIPGIGEQ 563

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEV 623
               LL+HFGS++ +  A A  +  V
Sbjct: 564 AMKRLLRHFGSIQSIRTANATSLEAV 589


>UVRC_CHLCH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 629

 Score =  352 bits (904), Expect = 4e-99
 Identities = 223/640 (34%), Positives = 330/640 (51%), Gaps = 37/640 (5%)

Query: 3   VRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIS 62
           ++  L  K  ++PT PG+Y+F++  GR+IYVGKAKNLR R+ SYF++   L  +T  ++S
Sbjct: 13  IKKVLTEKLATLPTSPGIYQFKNSAGRIIYVGKAKNLRNRVRSYFRNSHQLFGKTLVLVS 72

Query: 63  TAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRG 122
              D++  + ++EVEAL LE + IKE  PR+NV  +DDK+YPYL +T NE +PR+   R 
Sbjct: 73  HIDDLEVIITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVIT-NEPYPRILFTRH 131

Query: 123 ARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGR--PCLLGYIDKCS 180
            R  G   FGPY+ A  +R  +DL+  +FPVR+C   +   A +SG+   CL  +I KC 
Sbjct: 132 RRNDGSIAFGPYTEARQLRSILDLIGSIFPVRSCKLRLTPDAIASGKYKVCLDYHIHKCK 191

Query: 181 APCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQAL 240
             C G    +EYR + ++    + G+T   +R                    I+  I++L
Sbjct: 192 GACEGLQPEDEYRQMIDEIIKLLKGKTSALIRSLTENMHLAATELRFEQAAEIKAQIESL 251

Query: 241 RTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
           +   E+Q VV  D  D DV AIA  + +A   +F +R G++ G +   ++     S   +
Sbjct: 252 KRYAERQKVVAADMVDRDVFAIAAGEDDACGVIFKIREGKLLGSQRIYINNTNGESEASM 311

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGA---AVDVRVPQRG 357
             + L + Y  + +                           +K  G     + + VPQ G
Sbjct: 312 QLRMLEKFYVESIEPVPDXXXXXXXXXXXXXXXXXXXXXVKAKNEGQEKKGIRLVVPQIG 371

Query: 358 DKRALMETVLKNAEQTLARH--KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDIST 415
           DK  L+    +NA   L  +  + Q+  +                    P RIECFD S 
Sbjct: 372 DKAHLVGMCRQNARHHLEEYLIQKQKRGEAAREHFGLTALKELLHLPTLPQRIECFDNSH 431

Query: 416 LQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVG 475
            QG   V+SMV FE G  +KS+YR+F I+  EG+D D AAM EV+ RR++  L ES  + 
Sbjct: 432 FQGTDYVSSMVCFEKGKTKKSDYRKFKIKTFEGSD-DYAAMDEVLRRRYSGSLTESLAL- 489

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR 535
                                   P+L+VVDGG+ QV  A + L +LG+  + V GLAKR
Sbjct: 490 ------------------------PDLIVVDGGKGQVNTAYKTLQELGVT-IPVIGLAKR 524

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           +EE++ P   DP  LP+TS  L LLQ++RDEAHRFAI+YHR+ R+     + L  I G+G
Sbjct: 525 IEEIFTPHSSDPFNLPKTSPALKLLQQLRDEAHRFAITYHRKLRSDRTLQTELTTIAGIG 584

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
                 LL+HFGSV  +AQA+  E+  V  IG +  +T+Y
Sbjct: 585 EKTAFKLLEHFGSVESVAQASREELQAV--IGAKAGETVY 622


>UVRC_THEP3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 615

 Score =  352 bits (903), Expect = 5e-99
 Identities = 222/637 (34%), Positives = 346/637 (54%), Gaps = 33/637 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T+  K   +P  PGVY  +D+ G++IYVGKA  L+ R+  YFQ+     P+ + M+S   
Sbjct: 2   TIEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVE 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V +TE+EAL LE + IK+Y P++NV  +DDK+YPY+ VT+NEE+PR+   R    
Sbjct: 62  DFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMFTRRIEP 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G +YFGPYS A+A+R+T+ L+ ++FP+RTC+  + ++     R CL  +I  CSAPC  
Sbjct: 122 DGAKYFGPYSSAFAVRETIKLVRKMFPIRTCNKNI-EKDMGKVRECLYYHIGLCSAPCTN 180

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +I  E+Y  L +    F+ G+    ++                      D I A+    E
Sbjct: 181 KINKEDYIKLVDQAVLFLDGKRDWLIQKLKEDMKKXXXXXXXXXXXXXXDQIFAIERTSE 240

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQ VV     + D+I++A     + +QVF+VR G++ G   + +   E +  G+++  F+
Sbjct: 241 KQKVVSVGEDEQDIISMARSADISCIQVFFVRDGKLSGREHYYMKNTEGMERGEIISSFI 300

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y GA        IP+E++                ++RG  V + +P RG K+ L++ 
Sbjct: 301 KQFYEGA------PYIPKEIITDVXXXXXXXXXXXXXQKRGNKVFITIPVRGKKKELVDM 354

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL----RIECFDISTLQGEHT 421
           V +NA + L        +D++ R +               L    RIE +DIS  +G+  
Sbjct: 355 VYQNALEAL-------KNDISIREEISKAQVVLELSNLVGLDYAKRIEAYDISNTRGQDN 407

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V SMVVF DG  +KS+YR+F+I+  EG D D  +M EVI RRF                 
Sbjct: 408 VGSMVVFVDGKPKKSQYRKFNIKYVEGQD-DYESMREVIERRFLHAXXXXXXXXXXXXXX 466

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEV 539
           +            +FA  P+L+ VDGG   V A  + L  LGI  + V G+ K  +    
Sbjct: 467 DKA----------KFAEMPDLIFVDGGIGHVNAVLQVLSGLGI-SIPVYGMVKDSKHRTR 515

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L   +  I +P TS+   L+ ++++EAHRFAI++H+ K++K   + +L +IPG+G  R 
Sbjct: 516 GLVSPQGEIDIPMTSKAFRLIAQIQEEAHRFAITFHKEKQSKRFKSELL-NIPGIGEKRA 574

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            AL   F S+  + +A+  ++ +V G+ E+ AQ +YE
Sbjct: 575 KALYDAFKSIEEIKRASVEDLKKVEGMNEKAAQAVYE 611


>UVRC_PSEA7 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  351 bits (901), Expect = 9e-99
 Identities = 230/629 (36%), Positives = 339/629 (53%), Gaps = 45/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   +++YVGKAK+L+ RL+SYF+  S L P+T  ++   A V+ T+   E E
Sbjct: 18  PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVVRIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYP++ ++  +E+PR+ + RGA++R  RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA 136

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR++++LL + F VR C    F   R+  RPCL   I +C  PCVG +G EEY     
Sbjct: 137 GAIRESLNLLQKAFLVRQCEDSYF---RNRTRPCLQYQIKRCKGPCVGLVGPEEYAEDVR 193

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 194 HSVMFLEGRSNALADELNTGMEQAAMRLDFEKAAELRDQVAILRRVQDQQSME-GGNGDV 252

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           D++A       A V +  VRGGR+ G + +      +   G+++  FL Q Y    + + 
Sbjct: 253 DIVAAIVTPGGACVHLISVRGGRVLGSKNFFPQVAIEEEVGEVLLAFLGQYYLSHQERD- 311

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   +VA +++ RG  +++    RG +    +  + NAEQ L   
Sbjct: 312 ---LPAELIVNVMHEDFPVLVAAIAEARGRQLEISYRVRGTRARWQQLAVTNAEQALGAR 368

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R                       P R+ECFDIS   GE TVAS VVF      KS+
Sbjct: 369 LANRQH----VXXXXXXXXXXXXXXXPPQRLECFDISHSSGEATVASCVVFGPEGPLKSD 424

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF+R  E   ++                       
Sbjct: 425 YRRYNIEGVTAGD-DYAAMHQALTRRFSRLKEGEGKM----------------------- 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q+A AQ  L +                    LE ++L        LP
Sbjct: 461 --PDILLVDGGKGQLAMAQEVLQEXXXXXXXXXXXXXXXTRKPGLETLYLNDAAHEFTLP 518

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+PG+GP RR  LLKHFG ++ 
Sbjct: 519 ADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSTLEDVPGVGPKRRRDLLKHFGGLQE 578

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  E+A+ PGI ++ A+ IY  L S
Sbjct: 579 LSRASIDELAKAPGISKKLAEQIYAVLHS 607


>UVRC_THEPX RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 615

 Score =  351 bits (900), Expect = 1e-98
 Identities = 221/637 (34%), Positives = 346/637 (54%), Gaps = 33/637 (5%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           T+  K   +P  PGVY  +D+ G++IYVGKA  L+ R+  YFQ+     P+ + M+S   
Sbjct: 2   TIEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKVMLSHVE 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V +TE+EAL LE + IK+Y P++NV  +DDK+YPY+ VT+NEE+PR+   R    
Sbjct: 62  DFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKVTVNEEYPRIMFTRRIEP 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G +YFGPYS A+A+R+T+ L+ ++FP+RTC+  + ++     R CL  +I  CSAPC  
Sbjct: 122 DGAKYFGPYSSAFAVRETIKLVRKMFPIRTCNKNI-EKDMGKVRECLYYHIGLCSAPCTN 180

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +I  E+Y  L +    F+ G+    ++                      D I A+    E
Sbjct: 181 KINKEDYIKLVDQAVLFLDGKRDWLIQKLKEDMKKXXXXXXXXXXXXXXDQIFAIERTSE 240

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQ VV     + D+I++A     + +QVF+VR G++ G   + +   E +  G+++  F+
Sbjct: 241 KQKVVSVGEDEQDIISMARSADISCIQVFFVRDGKLSGREHYYMKNTEGMERGEIISSFI 300

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y GA        IP+E++                ++RG  V + +P RG K+ L++ 
Sbjct: 301 KQFYEGA------PYIPKEIITDVXXXXXXXXXXXXXQKRGNKVFITIPVRGKKKELVDM 354

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL----RIECFDISTLQGEHT 421
           V +NA + L        +D++ R +               L    RIE +DIS  +G+  
Sbjct: 355 VYQNALEAL-------KNDISIREEISKDQVVLELSNLVGLDYAKRIEAYDISNTRGQDN 407

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V SMVVF DG  +KS+YR+F+I+  EG D D  +M EVI RRF                 
Sbjct: 408 VGSMVVFVDGKPKKSQYRKFNIKYVEGQD-DYESMREVIERRFLHAXXXXXXXXXXXXXX 466

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEV 539
           +            +FA  P+L+ VDGG   V A  + L  LGI  + V G+ K  +    
Sbjct: 467 DKA----------KFAEMPDLIFVDGGIGHVNAVLQVLSGLGI-SIPVYGMVKDSKHRTR 515

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L   +  I +P T++   L+ ++++EAHRFAI++H+ K++K   + +L +IPG+G  R 
Sbjct: 516 GLVSPQGEIDIPMTTKAFRLIAQIQEEAHRFAITFHKEKQSKRFKSELL-NIPGIGKKRA 574

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            AL   F S+  + +A+  ++ +V G+ E+ AQ +YE
Sbjct: 575 KALYDAFKSIEEIKRASVEDLKKVEGMNEKAAQAVYE 611


>UVRC_DESAP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 614

 Score =  351 bits (900), Expect = 1e-98
 Identities = 241/622 (38%), Positives = 334/622 (53%), Gaps = 26/622 (4%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           P  PGVY FR   G V+YVGKA +L+ R+ SYF    A   + Q ++    DV+  V  +
Sbjct: 11  PDKPGVYLFRGARGEVLYVGKAVSLKNRVRSYFT--GARSDKVQALVGKTRDVECLVTGS 68

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
           E+EAL LE + IKE+ PR+NV  +DDKSYPYL VT+ EE+PR+ + R   R G RYFGPY
Sbjct: 69  EIEALILESNLIKEHRPRYNVVLKDDKSYPYLKVTVQEEYPRIFLTRAQPRDGARYFGPY 128

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
             A A+ +TV LL ++FP+R+C    F++     RPCL  +I +C  PC G +  E YRA
Sbjct: 129 PSAAAVHETVRLLKKLFPLRSCRQTRFRQQ----RPCLNHHIGRCLGPCSGTVDPERYRA 184

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           + ++   F+ G     +R                      D ++A+  V+ +Q++V    
Sbjct: 185 MVQEVLLFLEGRHADLVRGLARKMXXXXXXXXXXXXXXXXDQLRAVEQVLARQSIVSPGR 244

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            D DV+A+A D     V V  +R G++ G     +  + + S  +++  FL Q Y     
Sbjct: 245 EDRDVLALARDGNRGRVIVLEIRDGKLLGRHSLDLQGIAERSDAEVLAAFLKQYY----- 299

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
            E+                +  +  WL  RR   V + VP+RG KR L+    +NA +  
Sbjct: 300 REAXXXXXXXXXXXXXXXXQGLIAEWLGLRRQGRVRLHVPRRGRKRELVRLAEQNAAEAR 359

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
           A+ + +R                       P R+E +DIS LQG  TV  MVVFEDG   
Sbjct: 360 AQMEFER-----DXXXXXXXXXXXXXXDQAPARLEGYDISNLQGAQTVGVMVVFEDGRPA 414

Query: 435 KSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAP 494
             EYR+F +R   G  +D                      G+L   G   +      +  
Sbjct: 415 PGEYRQFRVRETAGTPND----XXXXXXXXXXXXXXXXXXGKLIATGRLSS------RDA 464

Query: 495 RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTS 554
           RF   P+LV+VDGG+ Q++AA   L + G E V V  L K  E+++ PG  DP+ +P  S
Sbjct: 465 RFHRLPDLVLVDGGKGQLSAALEGLRETGFEAVPVFALTKEEEKIFAPGRSDPVPVPPGS 524

Query: 555 EGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQ 614
           + L+LLQ +RDEAHRFA+  HRR             I G+GP RR AL K F S+  L  
Sbjct: 525 QALFLLQHLRDEAHRFAVDTHRRTXXXXXXXXXXXXIDGIGPARRRALQKAFPSLDALKG 584

Query: 615 ATAAEIAEVPGIGERTAQTIYE 636
           AT AE+A VP +  + AQ +Y+
Sbjct: 585 ATLAELAAVPSMNRKAAQAVYD 606


>UVRC_METFK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  350 bits (897), Expect = 3e-98
 Identities = 227/626 (36%), Positives = 331/626 (52%), Gaps = 49/626 (7%)

Query: 19  GVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVEA 78
           GVYR  +    VIYVGKA++L+ R+SSYFQ  +    RT+ M+S  A ++ TV  +    
Sbjct: 16  GVYRMINAQDEVIYVGKARDLKKRVSSYFQK-NLPSARTRLMVSNIARIETTVTRSXXXX 74

Query: 79  LQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAW 138
                  IK + PR+NV +RDDKSYPY+A+T  + FPR+   RGA+R+G  YFGP+  A 
Sbjct: 75  XXXXXXXIKGFMPRYNVLFRDDKSYPYIALT-GDTFPRLAFHRGAQRKGSSYFGPFPNAV 133

Query: 139 AIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAED 198
           A+R+++ LL +VF +RTC   VF    +  RPCLL  I++C+APCVG I  E+YR     
Sbjct: 134 AVRESIQLLQKVFRLRTCENTVFA---NRSRPCLLHQIERCTAPCVGFISEEDYRRDVMH 190

Query: 199 FCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDCD 258
              F+ G+  + +                      RD IQ+LR V  KQ V   + +D D
Sbjct: 191 ASLFLQGKEQQVMDELGEKMNEAAEKMEYELAAVYRDRIQSLRQVQAKQFVSDFNVSDAD 250

Query: 259 VIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEEST 318
           VIA AE + +  V +  +RGG   G++ +     +       +E FL Q Y         
Sbjct: 251 VIACAELEGQWCVNLVMIRGGHHLGDKSFFPKNADGADLETTMEAFLEQHYMAG------ 304

Query: 319 TAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHK 378
            AIP  ++V A   +  A+    S++ G  + +     GDKR  ++    NA+  L++  
Sbjct: 305 -AIPPLLIVGAS-LETAALEEVFSEQAGRRIRINTHPIGDKRVWLKMAHTNAQLALSQRI 362

Query: 379 SQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEY 438
           +Q+A+  +  +                 RIECFDIS   GE TVAS VVF+ G  + SEY
Sbjct: 363 AQQANQQSRLNALREALGLPESTE----RIECFDISHTMGEATVASCVVFDKGAMQSSEY 418

Query: 439 RRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAY 498
           RR++I G    D D AAM +V++RR+ +                  A +G          
Sbjct: 419 RRYNITGITPGD-DYAAMRDVLTRRYRKV----------------AAGEGKR-------- 453

Query: 499 PPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILPR 552
            P+LV +DGG+ Q+  A   L+++G+ D+ + G+AK       LE+++ P  E+P+ L +
Sbjct: 454 -PDLVFIDGGKGQLGVAVEVLNEVGLPDIQLVGIAKGEERKPGLEQMFFPEREEPVSLKK 512

Query: 553 TSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRL 612
              GL+LLQ++RDEAHRFAI+ HR KR KA   S L+DI G+G  RR +LL  FG +  +
Sbjct: 513 DHPGLHLLQQIRDEAHRFAITGHRAKRGKARMHSSLEDISGIGAKRRKSLLTRFGGLDGV 572

Query: 613 AQATAAEIAEVPGIGERTAQTIYERL 638
             A+  EIA+V GI    AQ IYE L
Sbjct: 573 KNASVDEIAQVDGISHALAQKIYEEL 598


>UVRC_GEOMG RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 614

 Score =  350 bits (897), Expect = 3e-98
 Identities = 246/649 (37%), Positives = 342/649 (52%), Gaps = 63/649 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  +   G ++YVGKAK+LR R+ SYF          + +++  A+V+  V 
Sbjct: 9   TLPESPGVYLMKGSDGTILYVGKAKSLRKRVRSYFGAAGESRYHIRFLVARVAEVEVIVT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE + IK++ PR+N+  RDDK+Y  L + +NEEFPR+ ++R  R+ G RYFG
Sbjct: 69  DTEKEALILENTLIKKHRPRYNLDLRDDKTYFSLRMDMNEEFPRLTIIRKVRQDGARYFG 128

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PYS A + R+ +  L R+FP+R       +R R   RPCL   + +CSAPC G I  EEY
Sbjct: 129 PYSSAASAREALKQLYRLFPLRHYPLETCRRRR---RPCLFYQLRQCSAPCHGLISPEEY 185

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           + L +    F+ G+    L+                      D I+A+   +EKQ +V  
Sbjct: 186 QGLVQGAALFLDGKNRDLLKTYRERMXXXXXXXXXXXXXXXXDLIRAIEVTVEKQKMVT- 244

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D DV+ I  +    ++ + ++RGGR+ G R +++    ++   + V  FL   Y   
Sbjct: 245 TGGDADVLGIHREGSSLSLALLFIRGGRLIGSRSYLL--AWELEDEEAVSSFLNDYY--- 299

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP EVLV    AD            G    V  PQRG K  L++   KNAE 
Sbjct: 300 ---SREVFIPDEVLVPLPVADXXXXXXXXXXXXGKRTSVAHPQRGTKAGLVKLAGKNAEA 356

Query: 373 TLARHKSQR---ASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
            L R K +R   A  + T  K              P  IEC+DIS +QG + V S V F 
Sbjct: 357 AL-REKQKREEGAEAVLTELK------ERLHLRNLPRCIECYDISNIQGTYPVGSRVSFR 409

Query: 430 DGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGA 489
           DG A K  YR + I+   GAD D A M+EV+SRRF                         
Sbjct: 410 DGKADKGGYRHYRIKTVAGAD-DFAMMHEVLSRRF------------------------- 443

Query: 490 ERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--------------R 535
            R +P     P+L+VVDGG  Q+      L +L +EDV    LAK               
Sbjct: 444 -RDSPAKDEHPDLIVVDGGIGQLNILTAVLRELQVEDVDAASLAKSRVERDMAAEELTRS 502

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
            E V+LPG ++P+IL + S  L LL R+RDEAHRFAI+YH++ R K    S+LD IPG+G
Sbjct: 503 TERVFLPGRKNPVILRQNSAPLLLLARIRDEAHRFAITYHQKLRGKDTIRSILDTIPGIG 562

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
           P RR  LL+ FGS+RR+ +A+  E+A  P I    A++I++ L   + G
Sbjct: 563 PKRRKELLRQFGSLRRIREASRDELAATPTIPPTLAESIWKSLHENDEG 611


>UVRC_PSEAE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  349 bits (895), Expect = 4e-98
 Identities = 227/629 (36%), Positives = 339/629 (53%), Gaps = 45/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   +++YVGKAK+L+ RL+SYF+  S L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDAEAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYP++ ++  +E+PR+ + RGA++R  RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA 136

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR++++LL + F VR C    F   R+  RPCL   I +C  PCVG +  EEY     
Sbjct: 137 GAIRESLNLLQKAFLVRQCEDSYF---RNRTRPCLQYQIKRCKGPCVGLVSPEEYAEDVR 193

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 194 HSVMFLEGRSNALADELNVGMEQAAMRLDFEKAAELRDQVAILRRVQDQQSME-GGNGDV 252

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           D++A       A V +  VRGGR+ G + +      +   G+++  FL Q Y    + + 
Sbjct: 253 DIVAAIVTPGGACVHLISVRGGRVLGSKNFFPQVAIEEEVGEVLLAFLGQYYLSHQERD- 311

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   +V+ +++ RG  +++    RG +    +  + NAEQ L   
Sbjct: 312 ---LPAELIVNVTHEDFPVLVSAIAEARGRELEISYRVRGTRARWQQLAVTNAEQALGAR 368

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R                       P R+ECFDIS   GE TVAS VVF      KS+
Sbjct: 369 LANRQH----VXXXXXXXXXXXXXXXPPQRLECFDISHSSGEATVASCVVFGPEGPLKSD 424

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF+R  +   ++                       
Sbjct: 425 YRRYNIEGVTAGD-DYAAMHQALTRRFSRLKDGEGKM----------------------- 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q+A AQ  L +                    LE ++L        LP
Sbjct: 461 --PDILLVDGGKGQLAMAQEVLQEXXXXXXXXXXXXXXXTRKPGLETLYLNDASHEFTLP 518

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+PG+GP RR  LLKHFG ++ 
Sbjct: 519 ADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSTLEDVPGVGPKRRRDLLKHFGGLQE 578

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  E+A+ PGI ++ A+ IY  L S
Sbjct: 579 LSRASIDELAKAPGISKKLAEQIYAVLHS 607


>UVRC_PSEAB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  348 bits (894), Expect = 6e-98
 Identities = 227/629 (36%), Positives = 339/629 (53%), Gaps = 45/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   +++YVGKAK+L+ RL+SYF+  S L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYP++ ++  +E+PR+ + RGA++R  RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA 136

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR++++LL + F VR C    F   R+  RPCL   I +C  PCVG +  EEY     
Sbjct: 137 GAIRESLNLLQKAFLVRQCEDSYF---RNRTRPCLQYQIKRCKGPCVGLVSPEEYAEDVR 193

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 194 HSVMFLEGRSNALADELNVGMEQAAMRLDFEKAAELRDQVAILRRVQDQQSME-GGNGDV 252

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           D++A       A V +  VRGGR+ G + +      +   G+++  FL Q Y    + + 
Sbjct: 253 DIVAAIVTPGGACVHLISVRGGRVLGSKNFFPQVAIEEEVGEVLLAFLGQYYLSHQERD- 311

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   +V+ +++ RG  +++    RG +    +  + NAEQ L   
Sbjct: 312 ---LPAELIVNVTHEDFPVLVSAIAEARGRELEISYRVRGTRARWQQLAVTNAEQALGAR 368

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R                       P R+ECFDIS   GE TVAS VVF      KS+
Sbjct: 369 LANRQH----VXXXXXXXXXXXXXXXPPQRLECFDISHSSGEATVASCVVFGPEGPLKSD 424

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF+R  +   ++                       
Sbjct: 425 YRRYNIEGVTAGD-DYAAMHQALTRRFSRLKDGEGKM----------------------- 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q+A AQ  L +                    LE ++L        LP
Sbjct: 461 --PDILLVDGGKGQLAMAQEVLQEXXXXXXXXXXXXXXXTRKPGLETLYLNDASHEFTLP 518

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+PG+GP RR  LLKHFG ++ 
Sbjct: 519 ADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSTLEDVPGVGPKRRRDLLKHFGGLQE 578

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  E+A+ PGI ++ A+ IY  L S
Sbjct: 579 LSRASIDELAKAPGISKKLAEQIYAVLHS 607


>UVRC_PSEA8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  348 bits (894), Expect = 6e-98
 Identities = 227/629 (36%), Positives = 339/629 (53%), Gaps = 45/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   +++YVGKAK+L+ RL+SYF+  S L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDADAKLLYVGKAKSLKKRLASYFRK-SGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYP++ ++  +E+PR+ + RGA++R  RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA 136

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR++++LL + F VR C    F   R+  RPCL   I +C  PCVG +  EEY     
Sbjct: 137 GAIRESLNLLQKAFLVRQCEDSYF---RNRTRPCLQYQIKRCKGPCVGLVSPEEYAEDVR 193

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 194 HSVMFLEGRSNALADELNVGMEQAAMRLDFEKAAELRDQVAILRRVQDQQSME-GGNGDV 252

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           D++A       A V +  VRGGR+ G + +      +   G+++  FL Q Y    + + 
Sbjct: 253 DIVAAIVTPGGACVHLISVRGGRVLGSKNFFPQVAIEEEVGEVLLAFLGQYYLSHQERD- 311

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   +V+ +++ RG  +++    RG +    +  + NAEQ L   
Sbjct: 312 ---LPAELIVNVTHEDFPVLVSAIAEARGRELEISYRVRGTRARWQQLAVTNAEQALGAR 368

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R                       P R+ECFDIS   GE TVAS VVF      KS+
Sbjct: 369 LANRQH----VXXXXXXXXXXXXXXXPPQRLECFDISHSSGEATVASCVVFGPEGPLKSD 424

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF+R  +   ++                       
Sbjct: 425 YRRYNIEGVTAGD-DYAAMHQALTRRFSRLKDGEGKM----------------------- 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q+A AQ  L +                    LE ++L        LP
Sbjct: 461 --PDILLVDGGKGQLAMAQEVLQEXXXXXXXXXXXXXXXTRKPGLETLYLNDASHEFTLP 518

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+PG+GP RR  LLKHFG ++ 
Sbjct: 519 ADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSTLEDVPGVGPKRRRDLLKHFGGLQE 578

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  E+A+ PGI ++ A+ IY  L S
Sbjct: 579 LSRASIDELAKAPGISKKLAEQIYAVLHS 607


>UVRC_SYNAS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  348 bits (892), Expect = 1e-97
 Identities = 237/637 (37%), Positives = 335/637 (52%), Gaps = 63/637 (9%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQ--DFSALHPRTQTMISTAADVDWTVV 72
           P  PGVY  +D  G+++YVGKAKNL++R  +YF   D  A+ P    ++S   D+++ + 
Sbjct: 14  PRTPGVYLMKDAAGKILYVGKAKNLKSRTRAYFSGTDSRAMIP---FLVSRIHDIEFILT 70

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            TE EAL LE + IKE+ PR+N+ +RDDK+Y  +   LNE FPR Q++R  R+ G +YFG
Sbjct: 71  ETEKEALILENNLIKEHHPRYNICFRDDKAYFNIRADLNEPFPRFQLVRRPRKDGAKYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  + + R+T+  L  +FP+RTC     K   S  RPCL   I +C APCVGRI  E+Y
Sbjct: 131 PYPSSASARETLQFLQSIFPLRTCRDAELK---SRTRPCLEYQIKRCLAPCVGRINSEDY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             +  D  +F                              +RD I+A+   +E+Q +V  
Sbjct: 188 LQMVRDGVSFXXXXXXXXXXXXXXXMKMAAEQMNYEEAAFLRDRIRAIEETLERQRMVSM 247

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+  +  +     V +  +R G+I G R   + K E   T  ++   L Q Y  +
Sbjct: 248 TFKDQDIFGLYREGHLIQVCILLIRQGKILGSRLLPLLKFEG-ETADMLSSLLMQYYDQS 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
            D      IP+E+L+ A   DR  +  WL ++RG  + + +P++G    L+    +NAE 
Sbjct: 307 VD------IPQEILIPASIEDRQVIREWLEEKRGKGLSILIPRKGRGLELLHIAEQNAEH 360

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                +                          P +IE FDIS + G   VA+MV F+DG 
Sbjct: 361 GFKMERKXXXXXXXXXXXXXXXXXXXXF----PRKIEAFDISNIGGRLAVAAMVTFQDGR 416

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             KS YRRF IR   GAD D A MYE + RR+                      QG E  
Sbjct: 417 PLKSGYRRFRIRTVHGAD-DYAMMYEALKRRY----------------------QGKENL 453

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL--------------EE 538
                  P+L+VVDGG+ Q+A A   L DL I    V GLAK                + 
Sbjct: 454 -------PDLIVVDGGKGQLAVAFSLLKDLSISGQDVIGLAKERVNGVTVQGGVNKSEDR 506

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           V+LP +++ + L R    L+LLQR+RDEAHRFA+SYHR  + ++   S+LDDIPG+G VR
Sbjct: 507 VYLPHKKEALYLSRWPAVLFLLQRIRDEAHRFAVSYHRSLKTRSDFMSLLDDIPGVGEVR 566

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           + ALL  FG + R+ +AT  E+ +V GIG+   + I+
Sbjct: 567 KKALLLSFGDLARIREATVEELTQVEGIGKDLGEKIH 603


>UVRC_MAGSA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 624

 Score =  348 bits (892), Expect = 1e-97
 Identities = 243/631 (38%), Positives = 344/631 (54%), Gaps = 43/631 (6%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYR     G V+YVGKAK+L+ R+ +Y +    +  R Q MI+  A ++    
Sbjct: 24  TLPLSPGVYRMLSGKGDVLYVGKAKSLKKRVVAYTRP-DRMPLRIQRMIAETASMEVVTT 82

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            TEVEAL LE + IK   PR+N+  +DDK++P++ +T + ++P+V   RGAR R   YFG
Sbjct: 83  RTEVEALLLESNLIKSLGPRYNILLKDDKTFPHILITADHDWPQVLKHRGARNRKGEYFG 142

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ A A+  T+  L R F +R+CS  VF    S  RPCLL  I +CSAPCV RI  +EY
Sbjct: 143 PFASAGAVNQTLAALQRAFLLRSCSDSVF---ASRTRPCLLFQIKRCSAPCVERIDRDEY 199

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
            AL E+  AF++G++ R                        RD I+AL  +   Q +   
Sbjct: 200 LALVEEARAFLSGQSRRVQHDLTXXXXXXXXXXXXXXXXVFRDRIRALTRIQAHQDINPA 259

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + DV+A+ +      +QVF+ R G   G R +     +     +++  FL Q Y   
Sbjct: 260 EVEEADVVALHQAGDGVCIQVFFFRSGCNYGNRAYFPVHAQGEEAPQIMAAFLGQFY--- 316

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
               +    PRE+L+S EP +   V   LS++ G  V + VP+RGD++ L+E    NA  
Sbjct: 317 ----ADKTPPREILLSLEPDEVAIVAQALSEKAGRKVTLSVPKRGDRKRLVEHAHDNARD 372

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L R    R ++   + K              P RIE +D S +QG   V +M+V     
Sbjct: 373 ALGR----RMAESGAQRKLLEGVAELFGMESAPERIEVYDNSHIQGSDAVGAMIVAGPDG 428

Query: 433 ARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             KS YR+F+IR  +     D   M EV++RRF R  +E       D   + G       
Sbjct: 429 LMKSAYRKFNIRSTDLTPGDDFGMMREVLTRRFARAQKE-------DPDRDRG------- 474

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEE 545
                   P+L ++DGGR Q+ AA   L +LGI+DV + G+AK        E  +L G+E
Sbjct: 475 ------LWPDLALIDGGRGQLNAALGVLAELGIDDVMLVGIAKGPDRNAGRERFFLAGKE 528

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            PI L      LY LQR+RDEAHRFAI  HR +R+K L  S LD +PG+GP R+ ALL H
Sbjct: 529 -PISLESRHPVLYFLQRLRDEAHRFAIGTHRARRSKGLVQSTLDALPGIGPKRKKALLHH 587

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FGS R +A+A   ++  V GI    A+ I++
Sbjct: 588 FGSARAVAEAGLPDLESVEGISHAMAKKIHD 618


>UVRC_CLOPH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 628

 Score =  348 bits (892), Expect = 1e-97
 Identities = 219/643 (34%), Positives = 330/643 (51%), Gaps = 35/643 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY   +    +IYVGKA +L+ R+  YFQ    L  + Q M+S     ++ +V+
Sbjct: 11  LPAKPGVYIMHNNKDEIIYVGKAISLKNRVRQYFQSSRNLSTKIQQMVSNIDHFEYIIVD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IKE+ P++N   +DDKSYPY+ VT+NE +PRV   R  ++   +YFGP
Sbjct: 71  SEMEALVLECNLIKEHRPKYNTMLKDDKSYPYIKVTVNEAYPRVLFARQQKKDKAKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A++D +DLL R++ +RTC+  + K      RPCL  +I +C APC G I  EEYR
Sbjct: 131 YTSLGAVKDILDLLRRLYFIRTCNRNLPKDI-GLERPCLYYHIKQCKAPCQGYISEEEYR 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              ++   F+ G      +                     RD I ++  + +KQ     D
Sbjct: 190 KSIDEVIEFLNGNYALVTKDLQAKMKAASENLEFEEAAGYRDLILSVEKLSQKQKASDVD 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D+IA A    EA  QVF++R G++ G   + +  V + S   ++  F+ Q Y G  
Sbjct: 250 GVDRDIIAFASTGDEAVAQVFFIRDGKMLGREHYHITGVANESRSSIMTNFVKQFYAG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IPR                    +RG  V + VP++GDK  L+E   KNA   
Sbjct: 308 ----TPYIPRXXXXXXXXXXXXXXXXXXXTKRGQKVRIHVPKKGDKERLVELAEKNASLV 363

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL----RIECFDISTLQGEHTVASMVVFE 429
           L     Q+ SD   R +               L    R+E FDIS   G  +V SMVV+E
Sbjct: 364 L-----QQDSDKIQREEAKTIGAVRHIADMLSLPGIYRMESFDISNTNGFESVGSMVVYE 418

Query: 430 DGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGA 489
           +G  ++++YR+F I+  +G D D A+M EV++RRF+   +E++ +          A +  
Sbjct: 419 NGKPKRNDYRKFKIKSVQGPD-DYASMREVLTRRFSHGQKEAEEL----------AKKNI 467

Query: 490 ERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEE 545
           +     F   P+L+++DGGR QV  A   +++L +  + VCG+ K    R   ++    E
Sbjct: 468 DISHGSFTRYPDLILMDGGRGQVNIALEVMNELKL-TIPVCGMVKDDNHRTRGLYFDNVE 526

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            PI     SE   L+ R++DE HRFAI YHR  R+KA   S+LDDI G+G  RR AL+KH
Sbjct: 527 IPI--DTHSEAFRLITRIQDETHRFAIEYHRSLRSKAQVHSILDDIDGVGQTRRRALMKH 584

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL-TSVEGGQRT 647
           F S+  +  A+  ++  VP + + +A  +YE   TS E G  T
Sbjct: 585 FASIDAIKAASMEDLMAVPSMNKLSAAKVYEFFHTSSERGTET 627


>UVRC_NITOC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  347 bits (891), Expect = 1e-97
 Identities = 219/625 (35%), Positives = 336/625 (53%), Gaps = 52/625 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D  G+V+YVGKAKNL+ R+ SYF++ S L P+   ++    D+  TV +TE E
Sbjct: 17  PGVYRMLDAKGKVLYVGKAKNLKRRIKSYFRN-SKLAPKIHVLVKQICDIKITVTHTENE 75

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IK   PR+NV  RDDKSYPY+ ++  ++FPR+   RG ++   +YFGPY   
Sbjct: 76  ALILESNLIKALQPRYNVLLRDDKSYPYIFLSA-DDFPRLGFHRGVKQVSGQYFGPYPNI 134

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            ++  T+ LL RVFPVR C    +   R+  RPCL   I +C+APCVG I  ++Y    +
Sbjct: 135 RSVWQTLKLLQRVFPVRQCEDNFY---RNRSRPCLQYQIKRCTAPCVGLISKKDYSQDIQ 191

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G   + +                      RD I +LR +  +Q  + G+  D 
Sbjct: 192 HVVMFLKGRDQQVINELVIRMEEASGQLAFEQAAYYRDRIASLRQIQARQ-YISGEKKDI 250

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+ +A  +  A V+VF++RGG   G + ++     +++  +L+  F+AQ Y   +    
Sbjct: 251 DVLGVALTEKMACVEVFFIRGGHNLGNKTFLPKLEGNLTPEELLSTFIAQYYLNRE---- 306

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
               P  +++S +P D   +   LSK+ G  + +  P RG K   ++  L NA+  L +H
Sbjct: 307 ---TPPILILSHQPKDMGLLTEVLSKQAGRKIALIKPVRGPKVQWIKMALANAKINLNQH 363

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            +++ S++T R K              P RIECFD+S +QG  TVAS VVF+    RK++
Sbjct: 364 LAEK-SNITARFK---SLQQLLSLANFPQRIECFDVSHIQGTATVASCVVFDREGPRKAD 419

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G    D D  A+ + + RRF                         ++K   F 
Sbjct: 420 YRRFNITGIIPGD-DYGALRQALMRRF-------------------------KKKEGVF- 452

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEE------VWLPGEEDPIILP 551
             P+L+V+DGG+ Q+  + R L ++GI ++ V G+AK  E       ++L G E+P+++ 
Sbjct: 453 --PDLLVIDGGKGQINQSLRVLKEIGITEITVLGIAKGPERKAGNETLFLAGYENPVMVT 510

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L++LQ +RDEAHRFAI  HR++RAK    S+L+ I GLGP RR  LL   G ++ 
Sbjct: 511 SDSPALHILQHIRDEAHRFAIVSHRKRRAKGGKLSLLEGISGLGPKRRRKLLIQLGGLQE 570

Query: 612 LAQATAAEIAEVPGIGERTAQTIYE 636
           + +A   ++A++ GI    AQ IY+
Sbjct: 571 ITRAGVEDLAQIEGISLELAQRIYD 595


>UVRC_METST RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 598

 Score =  347 bits (891), Expect = 1e-97
 Identities = 219/629 (34%), Positives = 317/629 (50%), Gaps = 43/629 (6%)

Query: 11  PGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSAL-HPRTQTMISTAADVDW 69
           P  +P  PGVY   ++   VIYVGKAK L++RL SYF+D   L  P+TQ ++   +  ++
Sbjct: 6   PDEVPQKPGVYIMHNKEDEVIYVGKAKKLKSRLQSYFRDEDKLDRPKTQFLMRHFSYFEY 65

Query: 70  TVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVR 129
            + NTE EAL LE + IK+Y P +N+  +D K YPY+ +T NE+FPR+ + R        
Sbjct: 66  ILTNTEKEALILEANLIKKYRPHYNISLKDGKQYPYIKIT-NEDFPRIYITRNIVNDKAS 124

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGV 189
           Y+GPY+ +   R  +D L + F +RTC        +    PCL   I +CSAPCV  I  
Sbjct: 125 YYGPYTDSTHARAFIDFLNKNFQIRTC--------KHMDGPCLNYQIKQCSAPCVNYISQ 176

Query: 190 EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV 249
           EEY          + G                           +RD I  ++  +EKQ +
Sbjct: 177 EEYNRNIRRVKLLLQGXXXXXXXXXXXDMNRYAKNMEFEKAAMLRDQIDTIKITLEKQNI 236

Query: 250 VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
                 + D+I    +  EAAV +  VR G+   +   V+  ++  S  ++  +F+ Q Y
Sbjct: 237 QPNQDVNQDIIGFDHNNEEAAVVILSVRSGKTNKKDDLVLKGIKGFSDKQIRTEFIKQYY 296

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
                  ST                     WL ++    + + V   G    L++   KN
Sbjct: 297 -------STAXXXXXXXXXXXXXXXXXXXXWLEEKANHKIKITVATDGHYITLIKIAKKN 349

Query: 370 AEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           A  +L  +  +  + L T  K              P  IE FDIS + G + VASMVVFE
Sbjct: 350 AHISLTENTKEEENPLLTLEKYLNLPRL-------PYHIEAFDISNISGIYAVASMVVFE 402

Query: 430 DGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGA 489
           +G   K  YR+F +       +D A M EVI+RR++                   +P   
Sbjct: 403 NGKPAKKMYRKFKMNTP--GPNDFAMMKEVITRRYSHI-----------------SPNNT 443

Query: 490 ERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPII 549
              +   +  P+LV++DGG+ Q+  A      L I DV + GLAK+ EEV+LPG+ +PII
Sbjct: 444 NNTSDSLSIHPDLVLIDGGKGQLGMAVDVFKKLNITDVPLAGLAKKFEEVYLPGQTNPII 503

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
           LPR S  L+LLQ VRDE+HRFAI++HR+ R+KA T S+LDDIPG+G  R+ ALL HF S+
Sbjct: 504 LPRQSSALHLLQYVRDESHRFAITFHRKLRSKAFTKSILDDIPGVGKKRKQALLTHFESL 563

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYERL 638
             +  A+  EI +V GI ++ A+TIYE L
Sbjct: 564 DNIYNASFDEICQVKGINQKLAKTIYETL 592


>UVRC_ANASP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 627

 Score =  347 bits (889), Expect = 2e-97
 Identities = 220/639 (34%), Positives = 332/639 (51%), Gaps = 44/639 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  +   IP +PGVY  RD   R+IY+GK++ LR+R+ SYF++      R  TM     +
Sbjct: 17  LEARLSEIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGYNKTERIATMAKLVTE 76

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR-- 124
           +++ V +T           IK++ P FNV  +DDK YPY+ +T +E++PR+ + R  +  
Sbjct: 77  IEFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRIFITRKRQLG 136

Query: 125 RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
           +   +Y+GPY+ +  +R+ + +  R+F +R     +FK      RPCL   + +C   C 
Sbjct: 137 KEKDKYYGPYTDSGLLREILRISKRIFALRQRPQPLFK-----DRPCLNYDLGRCPGVCQ 191

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
             I  EEYR   +       G T   +                     IRD I  L+++ 
Sbjct: 192 QLISPEEYRKTVQKVAMVFQGRTQELIDILSEQMEKAAEALNFEVAARIRDQIAGLKSLT 251

Query: 245 EKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
            +Q V L D T   D IA+A D   A +Q+F +R G++ G   +V +       G ++++
Sbjct: 252 AEQKVSLPDDTVSRDAIALAGDAQHACIQLFQIRAGQLVGRLAFVAES--HAEPGAILQR 309

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
            L + Y  A+  E    IP E+LV  E  D + +   L++ +G  V +  PQR  K  L+
Sbjct: 310 VLEEHYQTAESVE----IPAEILVQHELPDAEILADVLTQLKGRKVTIFTPQRQVKAELI 365

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           E V +NA+  L R   Q+  D   ++               P RIE +DIS +QG + VA
Sbjct: 366 EMVERNAQYELQR--MQKLGDRNHQATQDLAAILDLPNL--PHRIEGYDISHIQGSNAVA 421

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQ--RVGELD 478
           S VVF DGL  K  YR + I+      G   D A++ EVI RRF +Y E+ Q  RVG  D
Sbjct: 422 SQVVFIDGLPAKQNYRHYKIKNPTVTIGHSDDFASLAEVIQRRFRKYAEDPQLSRVGNPD 481

Query: 479 TLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLE 537
                                P+L+++DGG+ Q+++    L ++ + ED+ V  LAKR E
Sbjct: 482 W--------------------PDLIMIDGGKGQLSSVVTVLQEMNLLEDLRVISLAKRRE 521

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           E++LPGE  P+       G+ LL+R+RDEAHRFA+S+HR++R+  L  S LD+IPGLG  
Sbjct: 522 EIFLPGESQPLKTDAEQPGVQLLRRLRDEAHRFAVSFHRQQRSDKLKRSRLDEIPGLGHH 581

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           R+  +L HF SV  + QAT ++IAEVPGIG   AQ IY+
Sbjct: 582 RQKQMLAHFRSVDYIRQATPSQIAEVPGIGPHLAQAIYD 620


>UVRC_YERPS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  346 bits (888), Expect = 3e-97
 Identities = 225/637 (35%), Positives = 342/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+   A + +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++ +E  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLITRMEEASQQLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRLGKVLGSRSYFPKVPAGTELSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQGRT---LPGEILLDFTLTEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALITRLSQQ-STIHQRMKELAKVLKLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ Q++                 
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMAQVLKRRYGKALDD-QKI----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 460 --------PDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR A
Sbjct: 512 ASEGEGFSLPPDSPALHLIQHIRDDSHNHAITGHRQRRSKVKNTSALEMIEGVGPKRRQA 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQPLFNASVEEIAKVPGISQALAEKIHNAL 608


>UVRC_PELPB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 627

 Score =  346 bits (887), Expect = 4e-97
 Identities = 221/618 (35%), Positives = 328/618 (53%), Gaps = 45/618 (7%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           +  L  K G++P  PGVY+FR+  GRVIYVGKAKNLR R+ SYF++   L+ +T  +++ 
Sbjct: 14  KKALVEKLGTLPPSPGVYQFRNSSGRVIYVGKAKNLRNRVRSYFRNQQQLYGKTLVLVTH 73

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
            AD +  + ++EVEAL LE + IKE  PR+NV  +DDK+YPYL +T NE FPR+ + R  
Sbjct: 74  IADFEVIITSSEVEALILENNMIKELKPRYNVNLKDDKTYPYLVIT-NEPFPRILISRQR 132

Query: 124 RRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKR--ARSSGRPCLLGYIDKCSA 181
           R+ G  +FGPY+ +  +   +DL+  +FPVR+C   + +   A    + CL  +I KC  
Sbjct: 133 RKDGSTWFGPYTESRQLHSILDLIGSIFPVRSCKFRLSEENIATKKYKVCLDYHIHKCKG 192

Query: 182 PCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALR 241
           PC GR   EEY  +  +    + G+T   +R                    I+  +++L+
Sbjct: 193 PCEGRQSEEEYLLMIAEITRLLKGKTSTMIRSLTSAMQLFARELKFERAAEIKMQLESLK 252

Query: 242 TVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLV 301
              E+Q VV GD  D DV A+A  + +    VF +R G++ G +   ++ V   +   L 
Sbjct: 253 RYAERQKVVAGDGLDRDVFAVATGEEDGCGVVFKIREGKLLGSQRIYMNNVTGETDSGLQ 312

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAE-PADRDAVVAWL--SKRRGAAVDVR-----V 353
            + + + Y      E+   +P E+L+     AD +  +  L   K R  A + +     V
Sbjct: 313 ARVMEKYY-----LETLELLPDEILLQESLGADEEETLRALFSEKEREEAQEKKNIRFLV 367

Query: 354 PQRGDKRALMETVLKNAEQTLARH--KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECF 411
           PQ G+K  L+E   +NA   L  +  + Q+  +                    P RIECF
Sbjct: 368 PQIGEKAHLVEMCRQNARHHLEEYLIQKQKRGEAAREHYGLTALKELLHLPKLPQRIECF 427

Query: 412 DISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEES 471
           D S LQG   V+SM+ FE G  +K++YR+F I   EG+D D AAM EVI RR++  L   
Sbjct: 428 DNSHLQGTDYVSSMICFEKGKPKKADYRKFKINSFEGSD-DYAAMEEVIRRRYSGSLSS- 485

Query: 472 QRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCG 531
                               K P     P+L+VVDGG+ QV  A + L+ LG+  + + G
Sbjct: 486 --------------------KLPW----PDLIVVDGGKGQVNIAFQTLNALGL-SIPIIG 520

Query: 532 LAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDI 591
           LAKR+EE++ P   DP  LP+TS  L LLQ++RDEAHRFAI+YHR+ R++ +  + L  I
Sbjct: 521 LAKRIEEIFTPQARDPFNLPKTSPALKLLQQMRDEAHRFAITYHRKLRSERMLQTELTTI 580

Query: 592 PGLGPVRRAALLKHFGSV 609
            G+G      LL+ FGSV
Sbjct: 581 AGIGEKTAFKLLERFGSV 598


>UVRC_GEOSL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 613

 Score =  346 bits (887), Expect = 4e-97
 Identities = 236/644 (36%), Positives = 335/644 (52%), Gaps = 57/644 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  +   G ++YVGKAK+LR R+ SYF          + ++   AD+D  V 
Sbjct: 9   TLPDAPGVYLMKGNGGDILYVGKAKSLRKRVRSYFSKGGESRYHIRFLVGRVADIDVIVT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE + IKE+ PR+N+  RDDK+Y  L + +NEEFPR+ ++R   R G RYFG
Sbjct: 69  DTEKEALLLENTLIKEHRPRYNLDLRDDKTYFSLRLDMNEEFPRLTIVRRPGRDGARYFG 128

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PYS A A R+ +  L ++FP+R       +R R   RPCL   + +C+APC G I  E+Y
Sbjct: 129 PYSSASAAREVLKQLYKLFPLRHYPLESCRRRR---RPCLFYQLRQCAAPCHGLISGEDY 185

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           ++LAE    F+AG+     R                        I+A+   +EKQ +V G
Sbjct: 186 QSLAEGAALFLAGKNSDLTRLYRQRMXXXXXXXXXXXXXXXXXLIRAIEVTVEKQKMVAG 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           D  D DV+    D  + +V + + RGGR+ G R +++D   D + G  +  FL+  Y   
Sbjct: 246 DG-DTDVVGFFRDATDLSVSILFYRGGRLMGSRNYLLDWEMDDAEG--LSSFLSGYY--- 299

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP E+L+     D D +   L++RRG    +R P RG K  L+    +NAE 
Sbjct: 300 ---NRDVVIPDEILIPFTVDDTDPLGELLTERRGKKTVLRHPVRGTKAELVRLAARNAEA 356

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L   K ++ S +    +              P RIEC+DIST+QG ++V S V F++G 
Sbjct: 357 YL-HEKREKDSGM---EQVLGELKEKLHLTNLPRRIECYDISTIQGRYSVGSRVRFQNGA 412

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K+ YRR+ IR   G D D A M+EV+S                               
Sbjct: 413 PDKAGYRRYRIRTVPGTD-DFAMMHEVLS--------------------------XXXXX 445

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL--------------EE 538
                    L+V+DGG  Q+      L++LG+  +    LAK                E 
Sbjct: 446 XXXXXXXXXLIVIDGGMGQLNVLTAILEELGLHGIDAVSLAKSRVERNMSDNEVVRSDER 505

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           V+LPG  +P++L +    L LL R+RDEAHRFAI+YH++ R K    S L+ IPG+G  R
Sbjct: 506 VFLPGRRNPVVLRQNGAPLLLLARIRDEAHRFAITYHQKLRGKGSIRSSLEGIPGIGEKR 565

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           +  LLK FGS+R L QA   ++A VP +    A  I++ L   E
Sbjct: 566 KRELLKRFGSIRALRQADREQLAAVPSVSPALADAIWKALHGEE 609


>UVRC_YERE8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  345 bits (886), Expect = 5e-97
 Identities = 222/637 (34%), Positives = 338/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D+ G VIYVGKAK+L+ RL+SYF+   A   +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDKAGTVIYVGKAKDLKKRLTSYFRAHVASR-KTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++  ++ PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSA-DKHPRLAIHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVPGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLISRMEEASRLLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRQGKVLGSRSYFPKVPAGTELSEVVQTFVGQFY-- 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                    +P E+L+    A++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 305 -LQGSQVRTLPGEILLDFTLAEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALVTRLSQQ-STIHQRMKELAKILNLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ +                   
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMSQVLKRRYGKALDDKK------------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 459 -------IPDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR  
Sbjct: 512 AAEGEGFSLPPDSPALHLIQHIRDDSHHHAITGHRQRRSKVKNTSALELIEGVGPKRRQI 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VP I +  A+ IY  L
Sbjct: 572 LLKYMGGLQPLLNASVEEIAKVPSISQALAEKIYNAL 608


>UVRC_CLONN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 621

 Score =  345 bits (885), Expect = 6e-97
 Identities = 203/625 (32%), Positives = 331/625 (52%), Gaps = 22/625 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP  PGVY  ++  G VIYVGKAK L+ R+  YFQ+      + + M+   A+ ++ + +
Sbjct: 11  IPEKPGVYLMKNSLGEVIYVGKAKVLKNRVRQYFQNSKNHGSKVRAMVKNIAEFEYIITD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK+Y PR+N+  +DDK YP+L +T NE+FPR+ V R   + G RY GP
Sbjct: 71  SEMEALILECNLIKKYRPRYNILLKDDKHYPFLKITTNEDFPRIFVTRVRAKDGARYLGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y    A+ +T++L+ ++FP+RTC   + K      +PCL  +I  C+APC G I  EEY 
Sbjct: 131 YPETSAVYETIELIKKIFPLRTCRLNI-KENGEPVKPCLNYHIKLCTAPCAGYISREEYG 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +     + G+    +                      RD + A+  + E+Q ++  +
Sbjct: 190 KTIKKIIDLLNGKDNEVINDLKIKMEKASSELKFEEAASFRDKLLAVEKIRERQKIISSN 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + D I +  ++++   Q+F+VR G+I G   +++D+    +   ++  F+   YGG  
Sbjct: 250 FENEDFINMYSEEIDLCAQIFFVRDGKIMGREHFILDRSIFGNNADIISNFIKDFYGG-- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
               T  IP+ + V  E  D + +  WL            PQ+G+K+ +++ V  NA+ T
Sbjct: 308 ----TAFIPKTIYV-PEVMDIELLENWLXXXXXXXXXXXXPQKGEKKKILDLVESNAKNT 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L + K +   D    S               P RIE +DIS +QG  +V SM+VF+ G  
Sbjct: 363 LEQFKLKLKVDKELYSNTLKELQNILELEEIPNRIEAYDISNIQGVDSVGSMIVFDKGKP 422

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           + S+YRRF I+  +GA +D  +M E+++RRFT  LEE + + + + L  SGA        
Sbjct: 423 KNSDYRRFKIKTVKGA-NDYDSMREILTRRFTHGLEEIKEIQKRNLL-LSGA-------- 472

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGEEDPIILP 551
            +F+  P+L+++DGG+ QV  A   L+ L I ++ VCG+ K  + +   L          
Sbjct: 473 -KFSVFPDLILMDGGKGQVNIALEVLEKLNI-NIPVCGMVKDDKHKTRGLVYXXXXXXXX 530

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
                +  + RV+DE HRFAI+YHR  R + +  SVL+DIP +G  RR  LL+ FGSV  
Sbjct: 531 XXXXXMQFITRVQDEVHRFAITYHRSLRNRRVLHSVLEDIPNIGEKRRKELLQKFGSVEN 590

Query: 612 LAQATAAEIAEVPGIGERTAQTIYE 636
           + +A+  E+ +   I ++ A++I +
Sbjct: 591 IKKASYDELLDTNSINQKAAKSIID 615


>UVRC_CLOBM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  345 bits (885), Expect = 6e-97
 Identities = 202/628 (32%), Positives = 330/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEGAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R + +D    ++G+    +                     +RD               L 
Sbjct: 189 REIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V     D   +  WL+ ++ +   +++P +G+K+ +++ V KNA+ 
Sbjct: 308 -----TAYIPKTIYV-PNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILDLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILSLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKISTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNTFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+++ E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAESVLE 615


>UVRC_YERPN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  345 bits (884), Expect = 8e-97
 Identities = 224/637 (35%), Positives = 341/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+   A + +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++ +E  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLITRMEEASQQLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRLGKVLGSRSYFPKVPAGTELSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQGRT---LPGEILLDFTLTEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALITRLSQQ-STIHQRMKELAKVLKLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ Q++                 
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMAQVLKRRYGKALDD-QKI----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 460 --------PDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR  
Sbjct: 512 ASEGEGFSLPPDSPALHLIQHIRDDSHNHAITGHRQRRSKVKNTSALEMIEGVGPKRRQV 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQPLFNASVEEIAKVPGISQALAEKIHNAL 608


>UVRC_YERPE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  345 bits (884), Expect = 8e-97
 Identities = 224/637 (35%), Positives = 341/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+   A + +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++ +E  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLITRMEEASQQLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRLGKVLGSRSYFPKVPAGTELSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQGRT---LPGEILLDFTLTEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALITRLSQQ-STIHQRMKELAKVLKLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ Q++                 
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMAQVLKRRYGKALDD-QKI----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 460 --------PDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR  
Sbjct: 512 ASEGEGFSLPPDSPALHLIQHIRDDSHNHAITGHRQRRSKVKNTSALEMIEGVGPKRRQV 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQPLFNASVEEIAKVPGISQALAEKIHNAL 608


>UVRC_YERPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  345 bits (884), Expect = 8e-97
 Identities = 224/637 (35%), Positives = 341/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+   A + +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++ +E  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLITRMEEASQQLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRLGKVLGSRSYFPKVPAGTELSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQGRT---LPGEILLDFTLTEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALITRLSQQ-STIHQRMKELAKVLKLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ Q++                 
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMAQVLKRRYGKALDD-QKI----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 460 --------PDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR  
Sbjct: 512 ASEGEGFSLPPDSPALHLIQHIRDDSHNHAITGHRQRRSKVKNTSALEMIEGVGPKRRQV 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQPLFNASVEEIAKVPGISQALAEKIHNAL 608


>UVRC_YERP3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  345 bits (884), Expect = 8e-97
 Identities = 224/637 (35%), Positives = 341/637 (53%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+   A + +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVA-NRKTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++ +E  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSADEH-PRLAVHRGAKHEKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +CS PCV G +  EE
Sbjct: 131 PFPNSYAVRETLALLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCSGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YQRQVDYVRLFLSGKDQQVLTQLITRMEEASQQLHFEDAARIRDQIQAVRRVTEQQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GDS D DVI +A D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDSEDLDVIGVAFDAGLACVHVLFIRLGKVLGSRSYFPKVPAGTELSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D + + LS+  G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQGRT---LPGEILLDFTLTEKDLLASSLSELAGRKIQIQSRPRGDRARYLKLARTNAS 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +  R K                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALITRLSQQ-STIHQRMKELAKVLKLDEIN----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++ Q++                 
Sbjct: 419 GPVRSEYRRYNISGITPGD-DYAAMAQVLKRRYGKALDD-QKI----------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q++ A      L +    +   + G+AK       LE ++L
Sbjct: 460 --------PDVIFIDGGKGQLSQAFDVFASLNVPWDKQKPLLVGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+L+Q +RD++H  AI+ HR++R+K    S L+ I G+GP RR  
Sbjct: 512 ASEGEGFSLPPDSPALHLIQHIRDDSHNHAITGHRQRRSKVKNTSALEMIEGVGPKRRQV 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQPLFNASVEEIAKVPGISQALAEKIHNAL 608


>UVRC_PSEFS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  344 bits (882), Expect = 1e-96
 Identities = 214/629 (34%), Positives = 328/629 (52%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RL+SYF+  S L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDSEARLLYVGKAKNLKNRLASYFRK-SGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ +  FPR+ + RGA+++  +YFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGNFPRLSIHRGAKKQKGKYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +K      RPCL   I +C APCVG +   EY     
Sbjct: 136 GAIRESLSLLQKTFFVRQCEDSFYKNRT---RPCLQYQIKRCKAPCVGLVDPAEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSNALTDELSGAMEQAASTLDFERAAELRDQISLLRRVQDQQSME-GGTGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVIA   +   A V +  VRGGR+ G + +      D    +++  FL Q Y  + + + 
Sbjct: 252 DVIAAFVNPGGACVHLISVRGGRVLGSKNFFPQTGIDEEVAEVMAAFLGQYYVSSPERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   ++  + + RG  +D+    RG +    +  + NAEQ L   
Sbjct: 311 ---LPSELIVNVVHEDFPTLIEAIHELRGRELDISHRVRGTRARWQQLAVTNAEQALGAR 367

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R       +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 368 LANRQHV----AARFDALAEVLNLDEPPQRLECYDISHSSGEATVASCVVFGPEGPIKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF++  +   ++                       
Sbjct: 424 YRRYNIEGVTAGD-DYAAMHQALTRRFSKLKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L        L 
Sbjct: 460 --PDILLVDGGKGQLSMARDVLNELAVPDLILLGVAKGATRKAGFETLYLNDSAHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ + G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGPTRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A+ IY  L S
Sbjct: 578 LSRASIDEIAKAPGISKKLAELIYANLHS 606


>UVRC_GLUOX RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 645

 Score =  344 bits (882), Expect = 1e-96
 Identities = 214/644 (33%), Positives = 321/644 (49%), Gaps = 43/644 (6%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           +IP  PGVYR   E G V+YVGKA +L+ R+SSY +  + L  R + M+S    ++  + 
Sbjct: 37  TIPYSPGVYRMLSEKGEVLYVGKALSLKKRVSSYIR-INQLPERLRRMVSMTVSMEIVIT 95

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            TE +AL LE ++IK   PRFN+  RDDKSYP+L +T + EFP++   RG   +G  Y+G
Sbjct: 96  RTEADALLLEANYIKRMKPRFNILLRDDKSYPWLMLTESHEFPQITKQRGKPVKGATYWG 155

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ AWA+  T++L+ R F +R+CS  V     S  RPCLL  I +CSAPCV RI  E+Y
Sbjct: 156 PFANAWAVNQTLNLVQRSFLLRSCSDAVL---NSRTRPCLLYQIKRCSAPCVDRISKEDY 212

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L  +   F++G +    +                    IRD I+   ++     +   
Sbjct: 213 AELVSEARQFLSGHSTELQQRLVAEMEQASQELNYERAASIRDRIRGFASIQGSSTINPT 272

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D++ I ++  ++ +QVF++RG R  G R +     E+ +   ++  F+ Q Y   
Sbjct: 273 SINDADIMTIWQEAGQSCIQVFFIRGSRNNGNRAFYPAHAEEETAADVLSAFMIQFYDNK 332

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                    P  +LV+ E  +   V   LS RRG  V++  PQRG+K+ ++E    NA +
Sbjct: 333 PP-------PPSILVNCELPEPKLVEEALSIRRGQKVEILRPQRGEKKDVVEHAALNARE 385

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L R    + ++ T + +              P RIE +D S + G+     MVV     
Sbjct: 386 ALER----KLAENTGQRRLLEGVAEVFGLPEIPQRIETYDNSHIMGQAPYGVMVVGGPEG 441

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K  YR+++I+G      D   M EV+ RRF    E  +R  +                
Sbjct: 442 FNKRAYRKYAIKGPVTPGDDFGMMREVMERRFGHRSENGERPEDW--------------- 486

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLE-----EVWLPGEEDP 547
                  P+L+++DGG  Q  A +  L DLG+  + +  +AK  +     E +    + P
Sbjct: 487 -------PDLLLIDGGLGQFNAVRAVLADLGVTGIPIVAIAKGPDRDAGREWFFTETKSP 539

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
             LP     LY LQR+RDEAHRFAI+ HR  R+K L +S LD +PG+G  R+ ALL HFG
Sbjct: 540 FQLPPRDPVLYYLQRLRDEAHRFAITTHRAGRSKGLRSSELDHVPGIGAARKKALLNHFG 599

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPEN 651
           S + + QA+  E+   PGI   TA  IY      E  Q+T  +N
Sbjct: 600 SAKSVRQASLEELENAPGISSSTATAIYGHF-HPEWVQKTSADN 642


>UVRC_CLOBK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  344 bits (882), Expect = 1e-96
 Identities = 202/628 (32%), Positives = 329/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEGAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R + +D    ++G+    +                     +RD               L 
Sbjct: 189 REIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V +   D   +  WL+ ++ +   +++P +G+K+ ++  V KNA+ 
Sbjct: 308 -----TAYIPKTIYVPS-IEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNTFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+ + E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAECVLE 615


>UVRC_AZOVD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  344 bits (882), Expect = 1e-96
 Identities = 237/629 (37%), Positives = 337/629 (53%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D  G ++YVGKAKNLR RLSSYF+  S L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMLDAKGELLYVGKAKNLRKRLSSYFRT-SGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ +  FPR+ + RGA++R  RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGAFPRLGIHRGAKQRKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            +IR+++ LL + F VR C    F   R+  RPCL   I +C APCVG +   EY     
Sbjct: 136 GSIRESLGLLQKAFQVRQCEDSYF---RNRTRPCLQHQIRRCKAPCVGLVEPAEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G S D 
Sbjct: 193 HSVMFLEGRSNALAEELSAAMERAAVHLDFERAAELRDQIALLRRVQDQQSME-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A       A V +  VRGGR+ G + +      +   G ++  FL Q Y    + + 
Sbjct: 252 DVLAAVVKPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVGDVLAAFLGQYYLANPERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+A   D  A+V  L+++R   + +R   R  +    +  + NAEQ     
Sbjct: 311 ---LPGEIIVNATHEDFPALVLALTEQRSRELHIRHRVRATRARWQQLAIANAEQ----X 363

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
                                         +ECFDIS   GE TVAS VVF    A K E
Sbjct: 364 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMECFDISHSSGEATVASCVVFGPEGALKGE 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM + ++RRF +  E   ++                       
Sbjct: 424 YRRYNIEGVTAGD-DYAAMQQALTRRFGKLREGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILP 551
             P++++VDGG+ Q+A AQ  L +L + D+ + G+AK       LE ++L        LP
Sbjct: 460 --PDILLVDGGKGQLAIAQEVLRELAVPDLILLGVAKGVTRKPGLETLYLNDAVHEFTLP 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+++ G+GP RR  LLK FG ++ 
Sbjct: 518 ADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSSLEEVAGVGPKRRRELLKFFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A +IY  L S
Sbjct: 578 LSRASIDEIAKAPGISKKLADSIYAALHS 606


>UVRC_PSE14 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  343 bits (881), Expect = 2e-96
 Identities = 221/632 (34%), Positives = 331/632 (52%), Gaps = 52/632 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D    ++YVGKAKNL+ RL+SYF+  +   P+T  ++S  A ++ T+   E E
Sbjct: 18  PGVYRMFDAEATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVSRIAQIETTITGNETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ +  +PR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGNYPRLSIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    FK      RPCL   I +C  PCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFQVRQCEDSYFKNRT---RPCLQYQIKRCKGPCVGLVEPEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSNALSDELNATMEKAAMALDFERAAELRDQVALLRRVQDQQSMD-GATGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +   G+++  FLAQ + G  D E 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVGEVMSAFLAQYFLGGIDRE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P EV+V+    D  A V  + + RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGEVIVNVINDDFPAFVDAVEELRGVEMVISHRVRGTRARWQQMAVTNAEQALTAR 367

Query: 378 KSQR---ASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            + R   AS     +K              P+R+EC+DIS   GE TVAS VVF      
Sbjct: 368 LANRQHVASRFEALAKVLGLEDP-------PMRLECYDISHSSGEATVASCVVFGPEGPI 420

Query: 435 KSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAP 494
           KS+YRRF+I G    D D AAM++ ++RR++R                    +  E K P
Sbjct: 421 KSDYRRFNIEGVTAGD-DYAAMHQALTRRYSRI-------------------KAGEGKLP 460

Query: 495 RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPI 548
                 ++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L       
Sbjct: 461 ------DVLLVDGGKGQMSMARDVLNELQVPDLILLGVAKGTTRKAGFETLYLNDAAHEF 514

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
            LP  S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ + G+GP RR  LLKHFG 
Sbjct: 515 TLPGDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGPTRRRDLLKHFGG 574

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           ++ L++A+  EIA+ PGI ++ A++IY  L S
Sbjct: 575 LQELSRASIDEIAKAPGISKKLAESIYANLHS 606


>UVRC_CLOBL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  343 bits (881), Expect = 2e-96
 Identities = 202/628 (32%), Positives = 328/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEGAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R + +D    ++G+    +                     +RD               L 
Sbjct: 189 REIIDDVIKLLSGKHLDIVENFKLNMERAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V     D   +  WL+ ++ +   +++P +G+K+ ++  V KNA+ 
Sbjct: 308 -----TAYIPKTIYV-PNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNTFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+ + E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAECVLE 615


>UVRC_CLOBJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  343 bits (881), Expect = 2e-96
 Identities = 202/628 (32%), Positives = 328/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEGAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R + +D    ++G+    +                     +RD               L 
Sbjct: 189 REIIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V     D   +  WL+ ++ +   +++P +G+K+ ++  V KNA+ 
Sbjct: 308 -----TAYIPKTIYV-PNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNTFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+ + E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAECVLE 615


>UVRC_BDEBA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 630

 Score =  343 bits (881), Expect = 2e-96
 Identities = 219/655 (33%), Positives = 331/655 (50%), Gaps = 68/655 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           +R K    PT  GVY  ++   ++IY+GKAKNLR R+ SYF D     P+T+ ++S   +
Sbjct: 9   VRDKVKEFPTQSGVYLMKNTADKIIYIGKAKNLRNRVRSYFNDSKDHSPKTRLLVSNICE 68

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           V++ +  TEVEA  LE S IK++ P++N+R RDDK+YPY+  +  ++ PR+ + R  ++ 
Sbjct: 69  VEYILTKTEVEAFLLEASLIKKHRPKYNIRLRDDKAYPYIRFSWGDQAPRLYLARKVKKD 128

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G  YFGPY+   A+  T+  L R F +R C+  VFK   S  RPC+   I +C+APCV  
Sbjct: 129 GSLYFGPYTSGLAVHGTIKFLNRTFKIRDCTDAVFK---SRTRPCMTYQIGRCTAPCVKY 185

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I +E+YR   E    F+ G+  + ++                    +RD I+A++ +++K
Sbjct: 186 ITMEDYRNEVEGAKLFLKGQNKKVIKSMTEKMMGAADEEKFEVAARLRDSIEAIKAILQK 245

Query: 247 QAVVLGDS-TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVV------DKVEDVSTGK 299
           QAV+   S  D D +    D+    ++  ++R GR+ G R   +      D VED    +
Sbjct: 246 QAVINDTSEKDQDALGYYGDERGCLIETVHIRAGRVIGTRPHYLPHFDPNDAVED--PRE 303

Query: 300 LVEQFLAQTYGGADDEESTTAIPREVLVSAEPAD--RDAVVAWLSKRRGAAVDVRVPQRG 357
            +  FL Q Y           IP EVL+  +  +     +   L +R G+   VR     
Sbjct: 304 WLVDFLNQYY-------EDNFIPDEVLLPLDIGNDLTKLMEEVLKERSGSKTTVRFATDE 356

Query: 358 DKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
             R L++   +NA+    ++ S+    L    +              P RIEC+DIST Q
Sbjct: 357 RGRNLVDMAHENAKSHFLKYVSKSEEKL----RGLEEIKERFNLPERPRRIECYDISTFQ 412

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGEL 477
           G  TVAS VVFEDG+  K  YRR+ I+  +G  +D A+MYEV+SRRF        +  E 
Sbjct: 413 GAETVASQVVFEDGVPAKEHYRRYKIKTVQGI-NDFASMYEVLSRRF--------KHTEY 463

Query: 478 DTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL- 536
           D                     P L+V+DGG+ Q++ A + L+++G +D+ V GLAK   
Sbjct: 464 D--------------------DPQLIVIDGGKGQLSQAMKILEEIGRKDIPVVGLAKART 503

Query: 537 -------------EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKAL 583
                        E  +LPG  +P+I    +E LY+L  +RDEAHRFAI+YHR+ R    
Sbjct: 504 ESDFQKQEVESTEERFFLPGRSNPVIFKHNAEALYILSGIRDEAHRFAITYHRKLREGTS 563

Query: 584 TASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
             S LD + GLG  R+  LL  F S+  +  A   EIA++ G     A+ I  +L
Sbjct: 564 LESELDYVVGLGEKRKKVLLTQFNSIDEIKMADPEEIAKLKGFNRVLAERILLQL 618


>UVRC_PSEU2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  343 bits (880), Expect = 2e-96
 Identities = 221/632 (34%), Positives = 330/632 (52%), Gaps = 52/632 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D    ++YVGKAKNL+ RL+SYF+  +   P+T  ++S  A ++ T+   E E
Sbjct: 18  PGVYRMFDAEATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVSRIAQIETTITGNETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ N  FPR+ + RG ++   RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSDNA-FPRLSIHRGTKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    FK      RPCL   I +C  PCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFQVRQCEDSYFKNRT---RPCLQYQIKRCKGPCVGLVEPEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSNALSDELNASMEKAAMALDFERAAELRDQVALLRRVQDQQSMD-GGTGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +   G+++  FLAQ + G  D E 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVGEVMSAFLAQYFLGGIDRE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P EV+V+    D  A V  + + RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGEVIVNVINDDFPAFVDAVEELRGVEMVISHRVRGTRARWQQMAVTNAEQALTAR 367

Query: 378 KSQR---ASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            + R   AS     +K              P+R+EC+DIS   GE TVAS VVF      
Sbjct: 368 LANRQHVASRFEALAKVLGLEDP-------PMRLECYDISHSSGEATVASCVVFGPEGPI 420

Query: 435 KSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAP 494
           KS+YRRF+I G    D D AAM++ ++RR++R                    +  E K P
Sbjct: 421 KSDYRRFNIEGVTAGD-DYAAMHQALTRRYSRI-------------------KAGEGKLP 460

Query: 495 RFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPI 548
                 ++++VDGG+ Q++ A+  L++L + ++ + G+AK        E ++L       
Sbjct: 461 ------DVLLVDGGKGQMSMARDVLNELQVPELILLGVAKGTTRKAGFETLYLNDSAHEF 514

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
            LP  S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ + G+GP RR  LLKHFG 
Sbjct: 515 TLPGDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGPTRRRDLLKHFGG 574

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           ++ L++A+  EIA+ PGI ++ A++IY  L S
Sbjct: 575 LQELSRASIDEIAKAPGISKKLAESIYANLHS 606


>UVRC_PSEE4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  343 bits (880), Expect = 2e-96
 Identities = 219/629 (34%), Positives = 327/629 (51%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RL+SYF+  + L P+T  ++   A V+ T+   E E
Sbjct: 18  PGVYRMFDAEARLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVGRIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ + EFPR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +       RPCL   I +C  PCVG +  EEY     
Sbjct: 136 GAIRESLSLLQKAFSVRQCEDSYYANRT---RPCLQYQIKRCKGPCVGLVTPEEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G + +                       +RD I  LR V ++Q +  G S D 
Sbjct: 193 HSVMFLEGRSQQLGNELNAEMEKAAMALNFEKAAELRDQIALLRRVQDQQYME-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +    +++  FL+Q Y G  + E 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMAAFLSQYYLGNAERE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D DA+   +   RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGELIVNVVHEDFDAITEAVQTLRGRELSISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -NARLANRQHMAARFEALAQVLDLDEVPQRLECYDISHSSGEATVASCVVFGPEGPLKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G    D D AAM++ + RR+ R  +   ++                       
Sbjct: 424 YRRFNIEGVTAGD-DYAAMHQALQRRYGRIKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIILP 551
             P++++VDGG+ Q+  A+  + +LG  D+ + G+AK +      E ++L        L 
Sbjct: 460 --PDVLLVDGGKGQLNMARDVMQELGFGDLTLLGVAKGVTRKAGFETLYLNDVAHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+ G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKARRTSSLEDVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L +A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LNRASIDEIAKAPGISKKLAESIYASLHS 606


>UVRC_METCA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  343 bits (880), Expect = 2e-96
 Identities = 221/625 (35%), Positives = 324/625 (51%), Gaps = 48/625 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVY+  D +G VIYVGKAKNL+ R++S+F    +  P+   M++    ++ TV  TE E
Sbjct: 21  PGVYKMLDRNGEVIYVGKAKNLKKRVASHFAQRGS-SPKQNAMVARVQAIEVTVTRTEGE 79

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE   IK + PR+N+  RDDKSYPY+ V+ ++EFPR+   RG+R R  R+FGP+  A
Sbjct: 80  ALLLENQLIKRHKPRYNINLRDDKSYPYIYVSTHQEFPRLAFHRGSRARPGRFFGPFPSA 139

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+RD++  L ++FPVR C    F    +  RPCL   I++C+ PCVG +G E Y     
Sbjct: 140 AAVRDSLKTLQKIFPVRQCEDSYFV---NRTRPCLQYQIERCTGPCVGLVGAETYGEDVT 196

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
           +   F+ G     +                      RD I  LRTV+ KQ +V G+  D 
Sbjct: 197 NTLLFLEGRGEALIDRLAQRMEQAAQRLEFEKAARYRDQISNLRTVLAKQ-LVAGEQGDL 255

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           D+IA A     A V V +VR G+  G+R +     ++     ++  F+ Q Y   D E  
Sbjct: 256 DMIACAIKGNIACVHVVFVRNGQQIGDRSFFPRMQDEHDAAAVLGAFIPQFY--LDKE-- 311

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              IPRE+L+S E  + +   + L ++ G  V +    RG++   +E    NAE  L   
Sbjct: 312 ---IPRELLLSHEIRELELFESVLGQQAGRPVKISWRLRGERAKRLELARANAECAL--- 365

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R +   T +               P R+ECFDIS  QG+ TVAS VVF+     KS 
Sbjct: 366 -TTRLASQQTIADRLRHLTEMLGLAEPPKRMECFDISHTQGDQTVASCVVFDRTGPLKSA 424

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G  G D D AAM + +SRR+ R      R GE++                   
Sbjct: 425 YRRFNIEGITGGD-DYAAMAQALSRRYQRI-----RAGEVEA------------------ 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILP 551
             P+++ +DGG+ Q+ AA R L +LG+E++ + G+AK       +E ++  G  DPI++ 
Sbjct: 461 --PDILFIDGGKGQIHAAARTLAELGVENIRIIGIAKGPDRKPGMETLFQTGCSDPIVVK 518

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             + G  L+Q +RDEAHRFAI+ HR++RAK +T S L  I GLGP               
Sbjct: 519 PDNPGSLLIQHIRDEAHRFAITGHRQRRAKTVTRSPLQAIAGLGPKXXXXXXXXXXXXXX 578

Query: 612 LAQATAAEIAEVPGIGERTAQTIYE 636
           +++A    ++ V GI  + AQ IY+
Sbjct: 579 ISRADVEALSSVEGINRQLAQRIYD 603


>UVRC_SALHS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  343 bits (879), Expect = 3e-96
 Identities = 226/635 (35%), Positives = 334/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGAVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +C  PCV G +G EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPVRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVGEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHHPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_CLOBH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  342 bits (878), Expect = 4e-96
 Identities = 202/628 (32%), Positives = 327/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEEAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   +D    ++G+    +                     +RD               L 
Sbjct: 189 RETIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V     D   +  WL+ ++ +   +++P +G+K+ ++  V KNA+ 
Sbjct: 308 -----TAYIPKTIYV-PNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNAFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+ + E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAECVLE 615


>UVRC_CLOB1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  342 bits (878), Expect = 4e-96
 Identities = 202/628 (32%), Positives = 327/628 (52%), Gaps = 26/628 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEEAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   +D    ++G+    +                     +RD               L 
Sbjct: 189 RETIDDVIKLLSGKHLDIVENFKLNMEKAAENLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                T  IP+ + V     D   +  WL+ ++ +   +++P +G+K+ ++  V KNA+ 
Sbjct: 308 -----TAYIPKTIYV-PNIEDEALLEQWLTLKKESKSTIKIPIKGEKKNILVLVEKNAKT 361

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE G 
Sbjct: 362 TLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEKGR 421

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG        
Sbjct: 422 AKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG-------- 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
             +F+  P+L+++DGG+ Q+  A   L+   I D+ VCG+ K    R   +   GEE  I
Sbjct: 473 --KFSVFPDLILMDGGKGQINIALEVLNAFNI-DIPVCGMVKDNKHRTRGLIYNGEE--I 527

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F S
Sbjct: 528 IINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNFKS 587

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +  + +AT  E+  +P + +++A+ + E
Sbjct: 588 IDNIKKATYEELLSIPSMDKKSAECVLE 615


>UVRC_SACD2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  342 bits (877), Expect = 5e-96
 Identities = 225/630 (35%), Positives = 339/630 (53%), Gaps = 48/630 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVY+  D  G ++YVGKAKNL+ RLSSYF+  + L P+T  ++     ++ TV  +E E
Sbjct: 23  PGVYQMYDADGAILYVGKAKNLKNRLSSYFRA-TGLTPKTHALVKRIQAIEVTVTPSEAE 81

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE++ IK   P FN+  RDDKS+PY+ ++  E +P++   RG +++  +YFGP+  A
Sbjct: 82  ALVLEHNLIKSQKPPFNILLRDDKSFPYIFISEGEPYPKLAFHRGPKKKKGQYFGPFPNA 141

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+++T++ L R F VR C   VF   RS  RPCL   I +C+ PCV  I VE+Y     
Sbjct: 142 SAVKETLNFLQRTFRVRQCEDSVF---RSRTRPCLQYQIGRCTGPCVEAISVEDYAVDLA 198

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G++                         +RD I  LR V  +Q +  G S   
Sbjct: 199 HTAMFLDGKSXXXXXXXXXXXXXASQALDFERAVVVRDQITDLRQVQAQQVMEAGYSNQ- 257

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A A +     + + YVR GRI G + ++     D +   ++  FLA  Y G     +
Sbjct: 258 DVVACASESGVHCIHILYVRQGRIVGSKSYLPKTKLDSTEEDVLSAFLAHHYLGG----A 313

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P  +++S + AD+  +   + K  G  + +    R  +   +   L+ A Q L  H
Sbjct: 314 AMDVPPHIIISHKLADQLIIGEAVEKATGKQLKLTHNVRTYRAKWLAMALEAARQNLKNH 373

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + + + L  R +              P RIECFDIS   GE TV S VVF+   A+KS+
Sbjct: 374 LNNKQT-LVARFE---SLQDILGLDETPNRIECFDISHSSGELTVGSCVVFDQNGAKKSD 429

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G +  D D AAM +V++RR+TR  +ES  +                       
Sbjct: 430 YRRFNIEGIKAGD-DYAAMEQVLTRRYTRLQKESSSM----------------------- 465

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPI-------IL 550
             P+LV++DGG+ Q++ A+  +++LGI D+ + G+AK       PG E  +       +L
Sbjct: 466 --PDLVLIDGGKGQLSKAKAVVEELGIHDMMLIGVAKGTTR--KPGFETLVLTSGAERVL 521

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
              S  L+L+Q++RDEAHRFAI+ H+++R K    SVL+ IPG+GP RR  LL HFG ++
Sbjct: 522 KADSAALHLIQQIRDEAHRFAITGHKQRRDKKRRTSVLEGIPGVGPKRRKELLVHFGGLQ 581

Query: 611 RLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            + +A   ++A+ P I ++ AQ IY  L S
Sbjct: 582 EVLRANVDDLAKAPSISKKMAQEIYNVLHS 611


>UVRC_CITK8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  342 bits (877), Expect = 5e-96
 Identities = 223/637 (35%), Positives = 333/637 (52%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL +VFP+R C   V+   R+  RPCL   I +C  PCV G +  +E
Sbjct: 131 PFPNGYAVRETLALLQKVFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEDE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPNGTELGEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALISKLSQQ-STITQRLTALASVLKLPAVK----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              ++EYRR++I G    D D AAM +V+ RR+ + +EES+                   
Sbjct: 419 GPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIEESKI------------------ 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P+++++DGG+ Q+  A+    +L +        + G+AK       LE ++ 
Sbjct: 460 --------PDVILIDGGKGQLGQAKAVFAELDVPWDKNHPLLLGVAKGADRKAGLETLFF 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+++Q +RDE+H  AIS HR+KRAK    S L+ I G+GP RR  
Sbjct: 512 EPEGEGFSLPPDSPALHVIQHIRDESHDHAISGHRKKRAKVKNTSTLETIEGVGPKRRQM 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ I+  L
Sbjct: 572 LLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFYSL 608


>UVRC_ANASK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 707

 Score =  342 bits (877), Expect = 5e-96
 Identities = 237/689 (34%), Positives = 340/689 (49%), Gaps = 105/689 (15%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTA-A 65
           LR K   +P +PG Y  +D  G V+YVGKA +LR+R+ SYF            ++     
Sbjct: 5   LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELLG 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D++  V  +E EA+ LE   IK++ PRFNVR RDDK +  L +     +PR++V R   +
Sbjct: 65  DLEVIVTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREK 124

Query: 126 R--GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           R  G RYFGPYS A +IR+T+ ++ R F +RTCS  VF   +   RPC+L  I +C APC
Sbjct: 125 RQPGARYFGPYSSASSIRETLRMVNRHFQLRTCSDHVFDHRK---RPCILYQIHRCPAPC 181

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTV 243
           V  +  EEYR   ED   F                              +RD +QA+   
Sbjct: 182 VYEVAAEEYRQSVEDAVEFXXXXXXXXXXXXXXXMDGAAAGLRFEEAARLRDQLQAVERS 241

Query: 244 MEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
           +EKQ V++ D  D DVI +  +  +  VQV  +R G+++  +     + ++    +++  
Sbjct: 242 LEKQRVLMADRGDRDVIGLYREGPDLVVQVLSMRAGKLQDAQAHPF-REQEFPDEEILSS 300

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
           FL+  Y   D        P E+LV  EP   +A+   LS+RRG  V +  PQRG K  L+
Sbjct: 301 FLSLYYEHTD-------APDEILVPLEPVQAEALADVLSERRGRRVRLLTPQRGAKADLL 353

Query: 364 ETVLKNAEQTLA---RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
           +   +NAEQ       H  +R   L    +              P  +EC+DIST QG  
Sbjct: 354 DVARRNAEQGFRAWHEHDERREQALAAVER-------ALHLARPPRWMECYDISTFQGAL 406

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            V S V  +DG   K+ YRR+ ++   G D D A ++EVI+RR  R L E Q        
Sbjct: 407 AVGSGVSMKDGEPDKANYRRYKVKAVAGQD-DFAMLHEVITRRLRRALGEGQL------- 458

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-----------VAV 529
                              P+L+V+DGG+ Q+ AA  A  DLG+             V +
Sbjct: 459 -------------------PDLIVIDGGKGQLNAALAAAKDLGVPTRPSPGNPDAPFVEL 499

Query: 530 CGLAK-RL------------------------------------------EEVWLPGEED 546
            GLAK RL                                          E V+LPG +D
Sbjct: 500 VGLAKSRLVDGPSLGTXXXXXXXXXXXXXXXXXXXXXXEKGFVSELARSPERVFLPGRKD 559

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P++L + S  L+LL R+RDEAHRFAI++HR+ R +    SVL++IPG+G  R+ ALL+HF
Sbjct: 560 PVVLRQNSAELFLLARLRDEAHRFAITFHRKLRRERNFQSVLEEIPGIGEGRKRALLRHF 619

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           G++RR+ +AT  E+A+V G G R A  ++
Sbjct: 620 GALRRVREATPEELAQVEGFGPRQAAAVH 648


>UVRC_ESCF3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  341 bits (875), Expect = 9e-96
 Identities = 224/640 (35%), Positives = 332/640 (51%), Gaps = 64/640 (10%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   L++  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLTELAGRRINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQ------RASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             L    SQ      R S L T  K                R+ECFDIS   GE TVAS 
Sbjct: 364 TALTSKLSQQSTVHQRLSALATVLKLPEVK-----------RMECFDISHTMGEQTVASC 412

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+     +SEYRR++I G    D D AAM +V+ RR+ + +EES+             
Sbjct: 413 VVFDANGPLRSEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIEESKI------------ 459

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------ 535
                         P+++++DGG+ Q+A A+    +L +        + G+AK       
Sbjct: 460 --------------PDVILIDGGKGQLAQAKAVFAELDVPWDKNRPLLLGVAKGADRKAG 505

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LE ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+G
Sbjct: 506 LETLFFEPEGEGFSLPSDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVG 565

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           P RR  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 566 PKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ANADE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 707

 Score =  341 bits (875), Expect = 9e-96
 Identities = 249/687 (36%), Positives = 352/687 (51%), Gaps = 101/687 (14%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIS-TAA 65
           LR K   +P +PG Y  +D  G V+YVGKA +LR+R+ SYF            ++     
Sbjct: 5   LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDAGRGDQRAFVALLDGLLG 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D++  V  +E EA+ LE   IK++ PRFNVR RDDK +  L +     +PR++V R   +
Sbjct: 65  DLEVIVTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREK 124

Query: 126 R--GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           R  G RYFGPYS A +IR+T+ ++ R F +RTCS  VF   +   RPC+L  I +C APC
Sbjct: 125 RQPGARYFGPYSSASSIRETLRMVNRHFQLRTCSDHVFDHRK---RPCILYQIHRCPAPC 181

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTV 243
           V  +  EEYR   ED   F                              +RD +QA+   
Sbjct: 182 VYEVPAEEYRQSVEDAVEFXXXXXXXXXXXXXXXMAGAAEGLRFEEAARLRDQLQAVERS 241

Query: 244 MEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
           +EKQ V++ D  D DVI +  +  +  VQV  +R G+++  +     + ++    +++  
Sbjct: 242 LEKQRVLMSDRGDRDVIGLYREGPDLVVQVLSMRAGKLQDAQAHPF-REQEFPAEEILSS 300

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
           FL+  Y   D        P E+LV  EP   +A+   LS+RRG  V +  PQRG K  L+
Sbjct: 301 FLSLYYEHTD-------APDEILVPLEPVQAEALADVLSERRGRRVRLLTPQRGAKADLL 353

Query: 364 ETVLKNAEQTL-ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
           +   +NAEQ   A H+         R +              P  +EC+DIST QG   V
Sbjct: 354 DVARRNAEQGFRAWHEHDE-----RREQXXXXXXXXXXXXRPPRWMECYDISTFQGALAV 408

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
            S V  +DG   K+ YRR+ ++   G D D A ++EV++RR  R L E Q          
Sbjct: 409 GSGVSMKDGEPDKANYRRYKVKAVAGQD-DFAMLHEVVTRRLRRALGEGQL--------- 458

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-----------VAVCG 531
                            P+L+V+DGG+ Q+ AA  A  DLG+             V + G
Sbjct: 459 -----------------PDLIVIDGGKGQLNAALAAAKDLGVPTRPSPGNPDAPFVELVG 501

Query: 532 LAK-RL------------------------------------------EEVWLPGEEDPI 548
           LAK RL                                          E V+LPG +DP+
Sbjct: 502 LAKSRLVDGPXXXXXXXXXXXXXXXXXXXXXXXXXXEKGFVSELARSPERVFLPGRKDPV 561

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           +L + S  L+LL R+RDEAHRFAI++HR+ R +    SVL++IPG+G  R+ ALL+HFG+
Sbjct: 562 VLRQNSAELFLLARLRDEAHRFAITFHRKLRRERNFQSVLEEIPGIGEGRKRALLRHFGA 621

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIY 635
           +RR+ +AT  EIA+V G G R A  ++
Sbjct: 622 LRRVREATPEEIAQVEGFGPRQAAAVH 648


>UVRC_ERWCT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  341 bits (874), Expect = 1e-95
 Identities = 223/637 (35%), Positives = 330/637 (51%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D    VIYVGKAK+L+ RL+SYF+   A   +T+ ++ +   +D T+ 
Sbjct: 13  TVTSQPGVYRMYDAGNTVIYVGKAKDLKKRLASYFRSHVASR-KTEALVKSIKHIDVTIT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++  +  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPMIFLS-GDAHPRLTVHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+    A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +C  PCV G +  E+
Sbjct: 131 PFPNGNAVRETLILLQKLFPVRQCENSVY---RNRSRPCLQYQIGRCLGPCVSGLVSEED 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           YR   E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YRQQVEYVRLFLSGKDQQVLNQLISRMESASRDLRFEDAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GD  D DVI++A D   A V V ++R G++ G R +          G++V+ F+ Q Y  
Sbjct: 247 GDGEDLDVISVAFDAGMACVYVLFIRQGKVLGSRSYFPKVPGGTELGEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
            +   S   +P E+L+     D+D +   L+   G  V ++   RGD+   ++    NA 
Sbjct: 307 GN---SGRTLPTEILLDFTLPDKDLLTESLTAVAGRKVQIQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ++   T   +                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALVTKLSQQS---TIHQRLAALANVLQLPEIH--RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + L++S+                   
Sbjct: 419 GPLRSEYRRYNISGITPGD-DYAAMAQVLQRRYGKALDDSK------------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++V+DGG+ Q+  AQ   D L +        + G+AK       LE ++L
Sbjct: 459 -------IPDVIVIDGGKGQLGQAQAVFDSLQVSWDKNKPLLLGVAKGSDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
               + + LP  S  L+++Q +RD++H  AI  HR+KRAK    S L+ I G+GP RR  
Sbjct: 512 EATGEGMALPADSPALHVIQHIRDDSHDHAIGGHRKKRAKVKNTSTLELIEGVGPKRRQT 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA VPGI    A+ I+  L
Sbjct: 572 LLKYMGGLQPLMNASIEEIANVPGISHGLAEKIFHAL 608


>UVRC_DICNV RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  341 bits (874), Expect = 1e-95
 Identities = 221/631 (35%), Positives = 323/631 (51%), Gaps = 50/631 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           + T  GVY+ RD++G V+YVGKAKNLR RLS YFQ  + L  +T+ ++    D+  T   
Sbjct: 17  VSTLSGVYQMRDQNGTVLYVGKAKNLRQRLSHYFQK-TGLSVKTRALMRAVYDIQTTSTP 75

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           T           IK+Y P+FN+  RDDKSYPY+ ++   +FPR+ + RGAR+ G  +FGP
Sbjct: 76  TXXXXXXXXXXXIKQYQPKFNILLRDDKSYPYICLS-QHDFPRLFLYRGARKNG-DFFGP 133

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y    +    + +L +VF +R C    FK   +  RPCL   I +C APCVG+I  E Y 
Sbjct: 134 YPNVQSAHHALAILQKVFRLRPCLDSFFK---NRSRPCLQYQIKRCYAPCVGKISAEMYA 190

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ G +   L+                    +RD I  LRT+ +KQ++V+  
Sbjct: 191 QTVQHARDFLTGNSEHLLQTLTEHMLQASAAQQYERAAIVRDQISELRTIQQKQSMVVY- 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
           + + DV+A+A    +A VQV + R G     + +     E +  G +++ F+ Q Y    
Sbjct: 250 AANVDVLAVATAYGKACVQVLFFRDGHSVTSQAFFPKLPELLPAGAILQAFIGQFY---- 305

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                  +P ++++S    D DAV  +LS+     V +    R  ++  +    +NA   
Sbjct: 306 ---HQRPVPSQIVLSEALPDMDAVSEFLSQMSAHTVTLTTQPRAIRKKWLRMTQENARLN 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L  H +Q+ S      +              P R+EC DIS +QGE+TVAS VVF+   A
Sbjct: 363 LRLHLAQKLS----MHERFKALAQAFDWQKMPQRLECVDISHMQGEYTVASCVVFDRRGA 418

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
            KS+YRR+ I G  G D D AAM +VI RRF R L++ + V                   
Sbjct: 419 VKSDYRRYKINGITGGD-DYAAMKQVIKRRFAR-LKKGEGV------------------- 457

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDP 547
                 P++  VDGGR Q+  A    +++ IE V + G+AK       LE+ W P E  P
Sbjct: 458 -----MPDVFFVDGGRGQLQQAIAVFEEMQIEGVQLIGVAKGEGRKAGLEQFWFPHENRP 512

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
             LP  S+ + L+  +RDEAHRFAIS HRR R K +  S+L++IP +G  RR ALL+HFG
Sbjct: 513 RTLPADSQAMQLIIHIRDEAHRFAISAHRRGRDKKVRVSLLEEIPNIGRKRRQALLQHFG 572

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ++  L QA+  +I  VPGI  + A  IY  L
Sbjct: 573 NLAGLMQASPEDITRVPGISVKLAAQIYAAL 603


>UVRC_CLOB6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  341 bits (874), Expect = 1e-95
 Identities = 203/630 (32%), Positives = 331/630 (52%), Gaps = 30/630 (4%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVY  ++  G +IYVGKAK L+ R+  YFQ       + + M+    + ++ + 
Sbjct: 10  NLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKSQKHSEKVKAMVKNIEEFEYIIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E+EAL LE + IK+Y P++N+  +DDK YP++ VTL E+FPRV   R   + G +YFG
Sbjct: 70  DSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTRKVTKDGSKYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    +++D ++L+ + FP+RTC   + + A++  RPCL   I  C APC   I   EY
Sbjct: 130 PYVDGSSVKDIIELIKKTFPIRTCKKNIVEGAKAI-RPCLNYQIGLCKAPCAQYIKKSEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R + +D    ++G+    +                     +RD               L 
Sbjct: 189 REIIDDVIKLLSGKHLDIVENFKLNMEKAAGNLEFEKAAMLRDXXXXXXXXXXXXXXXLN 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + D I++  D  +   QVF++R G+I G   ++++   D ++  L+  FL + YGG 
Sbjct: 249 NFDNEDYISLYSDGKDTCFQVFFLRNGKIVGREHFIIEDTFDTNSSTLISNFLKEFYGG- 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVV--AWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                T  IP+ + V   P   D V+   WL+ ++ +   +++P +G+K+ +++ V KNA
Sbjct: 308 -----TAYIPKTIYV---PNIEDEVLLEQWLTLKKESKSTIKIPIKGEKKNILDLVEKNA 359

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
           + TL   K +   +                    P+RIE FDIS +QG  +V SMVVFE 
Sbjct: 360 KTTLENFKLKYLQEKALYDNVLKDLKNILRLQEEPIRIEAFDISNIQGFDSVGSMVVFEK 419

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
           G A+ S+YRRF I   +GAD D  +M E+++RRF   L E + + +      SG      
Sbjct: 420 GRAKPSDYRRFKINTVKGAD-DYKSMKEILTRRFQHGLSEIKSIQDRKLEFSSG------ 472

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEED 546
               +F+  P+L+++DGG+ Q+  A   L+   I ++ VCG+ K    R   +   GEE 
Sbjct: 473 ----KFSVFPDLILMDGGKGQINIALEVLNTFNI-NIPVCGMVKDNKHRTRGLIYNGEE- 526

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            II+ +    +  + RV+DE HRFAISYHR  R K    S+LDDIP +G  R+  LL +F
Sbjct: 527 -IIINKYGSVMKFITRVQDEVHRFAISYHRSLRGKNSFHSLLDDIPNIGEKRKKDLLFNF 585

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            S+  + +AT  E+  +  + +++A++I E
Sbjct: 586 KSIDNIKKATYEELLSISSMDKKSAESILE 615


>UVRC_SALPK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (873), Expect = 2e-95
 Identities = 225/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YTQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVC----GLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +     C    G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHCPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (873), Expect = 2e-95
 Identities = 225/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YTQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVC----GLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +     C    G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHCPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_PARUW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (873), Expect = 2e-95
 Identities = 224/631 (35%), Positives = 323/631 (51%), Gaps = 52/631 (8%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVY  ++E G V+YVGKAKNLR R+  YF            +++    ++  VV +
Sbjct: 12  PTLPGVYLMKNEEGEVLYVGKAKNLRQRVKQYFVPGRDGRLMIPYLVAKINYIETIVVTS 71

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMR--GARRRGVRYFG 132
           E EAL LE + IK++ PR+N   +DDKSY  L ++ N+ +  V+++R  G       YFG
Sbjct: 72  EKEALLLENNLIKQHKPRYNALLKDDKSYIALKISQNDAWATVRLVRYKGTPEPDGLYFG 131

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY+ A A R T+DLL R+FP+R CS   F R     RPCLL  + +C  PC  +    EY
Sbjct: 132 PYTSAQAARQTLDLLNRLFPLRQCSDQEFARRT---RPCLLYQMKRCVGPCTQKCTKGEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   +    F+ G+    L+                    +   I+ +   +E Q V   
Sbjct: 189 QQHLDRTIKFLRGQNKDVLKDLYEEMRLLSEQLEFEKANHLLRTIRYIEKTIESQYVDRP 248

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D I +        V +   RGG++ G R +  D + +    +L+  FL Q Y GA
Sbjct: 249 LGHDADAIGLFRYGEHVVVVLMIFRGGKLVGSRHFEFDNIIE-EDHELLTSFLLQHYEGA 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                 T IP E+L+ ++ +D   V   LS RR   V++++PQRG+K+AL+E   KNAE 
Sbjct: 308 ------TEIPSEILLPSKISDEHPVEEILSARREQKVNLQIPQRGEKKALIEIAQKNAE- 360

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
             A  K+Q+  + T R K              P RIECFD S + G   V+SMV F DGL
Sbjct: 361 --ALFKTQK-DEATLREKTLLEMQELLFLTNYPTRIECFDNSNIAGSEPVSSMVAFTDGL 417

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
                YR + ++     D D AAMYEV++RR+ R  EE+                     
Sbjct: 418 KDSKRYRTYRLKIGSKPD-DYAAMYEVLTRRYKRAKEENDM------------------- 457

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL---------EEVWLPG 543
                  P+LVVVDGG+ Q+  A +  ++L I  V + GLAK           E+V+   
Sbjct: 458 -------PDLVVVDGGKGQLNIAIKVFEELNITGVDLLGLAKEAGRHDKGMTAEQVFTCY 510

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           +++PI+L   S  L+LLQ++RDEAHR AIS+HR++R+K    S LDDIPG+GP +R  LL
Sbjct: 511 QKEPILLKANSPILFLLQKIRDEAHRVAISFHRKRRSKKTLKSALDDIPGIGPAKRKTLL 570

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTI 634
            HFGS++++  A  AE+ EV GI     + I
Sbjct: 571 THFGSLKKIELAADAELREVKGISAANIEAI 601


>UVRC_SALTY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (872), Expect = 2e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLSALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALTI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (872), Expect = 2e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YTQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALVTKLSQQ-STITQRLTALATVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALPB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (872), Expect = 2e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLSMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YTQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_PSEPF RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  340 bits (872), Expect = 2e-95
 Identities = 213/629 (33%), Positives = 332/629 (52%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAK+L+ RL+SYF+  + L P+T  ++   A V+ T+ + E E
Sbjct: 18  PGVYRMFDSDARLLYVGKAKSLKKRLASYFRK-TGLAPKTAALVGRIAQVETTITSNETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ + +FPR+ + RGA++   +YFGPY  A
Sbjct: 77  ALLLEQTLIKEWRPPYNILLRDDKSYPYVFLS-DGQFPRLSIHRGAKKAKGKYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +K      RPCL   I +C APCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFFVRQCEDSYYKNRT---RPCLQYQIKRCKAPCVGLVEPEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSHALTNELSTAMEEAAINLEFERAAELRDQIALLRRVQDQQSME-GGTGDI 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVIA   +   A V +  VRGGR+ G + +      +    +++  FL Q +  + + + 
Sbjct: 252 DVIAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMAAFLGQYFISSPERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D  A++  +   RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPSELIVNVVHEDFPALIEAIQALRGRELSISHRVRGTRARWQQLAVTNAEQALGAR 367

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R   +  R +              P R+EC+DIS   GE TVAS VVF    A KS+
Sbjct: 368 LANR-QHVAARFEALAEVLNLDEP---PQRLECYDISHSSGEATVASCVVFGPEGAIKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF++  E   ++                       
Sbjct: 424 YRRYNIEGVTAGD-DYAAMHQALTRRFSKLKEGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L    +   L 
Sbjct: 460 --PDILLVDGGKGQLSMARDVLNELAVPDLILLGVAKGATRKAGFETLYLNDAANEFTLR 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ + G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGPTRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LSRASIEEIAKAPGISKKLAESIYANLHS 606


>UVRC_SYNS3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 651

 Score =  340 bits (871), Expect = 3e-95
 Identities = 213/629 (33%), Positives = 324/629 (51%), Gaps = 26/629 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IPT+PG Y  RD   R++YVGK+K LR+R+ SYF+    L PR + M+    ++++ V +
Sbjct: 19  IPTEPGCYLMRDADDRLLYVGKSKTLRSRVRSYFRSSHDLSPRIRLMVRQICEIEFIVTD 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYF 131
           +E EAL LE + IK   P FNV  +DDK YPYL +T +E++P               R++
Sbjct: 79  SEAEALALESNLIKNQQPHFNVLLKDDKKYPYLCITWSEDYPXXXXXXXXXXXSPLDRFY 138

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R T+ L+ RVFP+R     ++       R CL   I +C   C  ++  E+
Sbjct: 139 GPYVDVGLLRRTLFLVKRVFPLRQRPRPLY-----PNRTCLNYSIGRCPGVCQEKVSSED 193

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  +         G +    +                    IRD +Q +  +   Q + L
Sbjct: 194 YHQILRKVAMVFQGRSDELRQLLNQQMERYAERLDFESAARIRDQLQGIDQLTADQKMSL 253

Query: 252 GD-STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            D S   DV+A+A+D   AA+Q+F +R G++ G  G+  D   D+  G ++++ + + Y 
Sbjct: 254 PDASVSRDVLAVAQDDHFAAIQLFQMRAGKLVGRLGFAAD-ATDLQAGLILQRVIEEHYS 312

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E    IP EVLV  E   +  +  WLS++R   V V  PQR  K  L++ V++NA
Sbjct: 313 QVDAVE----IPPEVLVQHELPQQRLIAEWLSEQRERKVQVLHPQRRQKADLIDLVMRNA 368

Query: 371 EQTLAR-HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           E  L R  +SQ    L                   P RIE +DIS +QG   VAS VVF 
Sbjct: 369 EFELGRARQSQEQQALANED-----LAQLLELATPPRRIEGYDISHIQGSDAVASQVVFI 423

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YRR+ I+ +    G   D  AM E++ RRF ++        +LD +    + 
Sbjct: 424 DGLPAKQHYRRYKIQSSSIQAGHSDDFMAMAEIMRRRFRKWARVKAEGADLDQVRRQSS- 482

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEVWLPGEE 545
             +          P++V++DGG+ Q++A   AL +L + ED+ VC LAK+ EE++LP  +
Sbjct: 483 --SSLNMDGLHDWPDVVMIDGGKGQLSAVMEALRELDLHEDLVVCSLAKQREEIFLPEAK 540

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+       G+ LL+R+RDEAHRFA+++HR++R + +  S L DIPGLGP R   LL H
Sbjct: 541 QPLESEPDQLGVSLLRRLRDEAHRFAVTFHRQQRGQRMKRSRLSDIPGLGPKRVRDLLAH 600

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTI 634
           F S+  +  A+  ++ + PG+G   A+ I
Sbjct: 601 FQSIDAIQLASVDQLHQAPGVGLSLAKQI 629


>UVRC_SALNS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (871), Expect = 3e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALG2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  340 bits (871), Expect = 3e-95
 Identities = 224/635 (35%), Positives = 334/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G ++ V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRSIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLEILF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALRD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 633

 Score =  339 bits (869), Expect = 5e-95
 Identities = 225/637 (35%), Positives = 320/637 (50%), Gaps = 46/637 (7%)

Query: 10  KPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDW 69
           K  ++PTDPGVY+F D+   V+YVGKAKNLR R+ +YFQ       R + M+  A DVD 
Sbjct: 15  KLDALPTDPGVYKFLDDEESVLYVGKAKNLRNRVRTYFQQSRQRDGRIEVMVQKAVDVDI 74

Query: 70  TVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVR 129
            V +TE EAL LE + IKE  PR+NV  RDDK+YPY+ +  NE FPRV   R  ++ G  
Sbjct: 75  IVTDTEAEALILENNQIKELQPRYNVNLRDDKTYPYICIK-NERFPRVFKTRTVKQDGSE 133

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGR--PCLLGYIDKCSAPCVGRI 187
           YFGPY+    +   +D +  VF +RTCS  + +    +G+   CL  +ID C APCVG+ 
Sbjct: 134 YFGPYADVSKMNSMMDAIRSVFQLRTCSLDLTEEKIEAGKYDVCLQHHIDNCKAPCVGKQ 193

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
              +Y    E     + G+T   +                     +RD ++AL+   ++Q
Sbjct: 194 SEADYMETIEQVKKLLNGQTQELMDLLKDEMQRQSDAHNFEEAARLRDQVKALKDYSQQQ 253

Query: 248 AVVLGDSTDCDVIA--IAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
            VV  D  D DV A  +  D+      +F VR G++ G+R   +  VE+ S  +L+   +
Sbjct: 254 KVVSQDFADRDVFALHVERDEDIGCGVLFQVREGKMIGKRHKFLRSVEERSDAELILSLV 313

Query: 306 AQTYGGADDEESTTAIPREVLVSAEP-----ADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
              Y  A+        P EVL+S +P      D  A+   L + +G  V ++VPQRG+K 
Sbjct: 314 ENYYAEAN------FYPEEVLLSHDPNDHPAQDTHALEELLRQEQGHQVPIKVPQRGEKA 367

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTR-SKXXXXXXXXXXXXXXPLRIECFDISTLQGE 419
           +L+     NA+  +   K+Q+      R  +              P R++  D+S   G+
Sbjct: 368 SLVRMATSNAKLQVGEWKTQQMKRERNRIPESIKALGEALNMEAPPRRVDGIDVSHHGGK 427

Query: 420 HTVASMVVFEDGLARKSEYRRFSIRGA-EGADSDVAAMYEVISRRFTRYLEESQRVGELD 478
            TVAS VVF D   RKS+YR + IR   EG   D  A                       
Sbjct: 428 ETVASCVVFTDATPRKSDYRTYKIRSTEEGTPDDYKAXXXXXXXXXXXXXXXD------- 480

Query: 479 TLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLE 537
                  P             P+LVV+DGG+ Q+++A   L ++G  D   V GLAKRLE
Sbjct: 481 ------GPW------------PDLVVIDGGKGQLSSAVEMLKEVGAFDRFPVIGLAKRLE 522

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           EV+ PG+ DP+ L + S  L LLQ+VRDEAHRFA++Y R++R K    S L DI G+GP 
Sbjct: 523 EVYRPGDSDPVFLAKDSPALQLLQKVRDEAHRFAVTYQRKRRKKKTLQSELLDIHGIGPK 582

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTI 634
               LL  FGS  ++ +A    +AEV  +G   A+TI
Sbjct: 583 TAKKLLGEFGSAAKVKEADEEALAEV--VGPAKAETI 617


>UVRC_SALEP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  339 bits (869), Expect = 5e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V EKQ V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTEKQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLEILF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALDC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  339 bits (869), Expect = 5e-95
 Identities = 224/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPVRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V E+Q V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTERQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALA4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  339 bits (869), Expect = 5e-95
 Identities = 223/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V E+Q V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTERQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHHPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_PSEP1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  339 bits (869), Expect = 5e-95
 Identities = 218/629 (34%), Positives = 326/629 (51%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RL+SYF+  + L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDGEARLLYVGKAKNLKKRLASYFRK-AGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ + EFPR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQNLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +       RPCL   I +C  PC   +  EEY     
Sbjct: 136 GAIRESLSLLQKAFSVRQCEDSYYANRT---RPCLQYQIKRCKGPCTDLVTAEEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G + +                       +RD I  LR V ++Q +  G S D 
Sbjct: 193 HSVMFLEGRSQQLGNELNAEMEKAAMALDFEKAAELRDQIALLRRVQDQQYIE-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVIA   +   A V +  VRGGR+ G + +      +    +++  FL+Q Y G  + E 
Sbjct: 252 DVIAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMAAFLSQYYLGNAERE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D +A+   L   RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGELIVNVVHEDFNAITEALHTLRGRELTISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -NARLANRQHMAARFEALAEVLGLDEVPQRLECYDISHSSGEATVASCVVFGPEGPIKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G    D D AAM++ ++RR+ R  +   ++                       
Sbjct: 424 YRRFNIEGVTAGD-DYAAMHQALTRRYGRIKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIILP 551
             P++++VDGG+ Q+  A+  +  LG  D+ + G+AK +      E ++L        L 
Sbjct: 460 --PDVLLVDGGKGQLNMARDVMQALGFTDLTLLGVAKGVTRKAGFETLYLNDVHHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+ G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSSALHLIQQIRDEAHRFAITGHRARRGKARRVSSLEDVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L +A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LNRASIDEIAKAPGISKKLAESIYASLHS 606


>UVRC_LEPBL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  339 bits (869), Expect = 5e-95
 Identities = 212/634 (33%), Positives = 321/634 (50%), Gaps = 54/634 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP--RTQTMISTAADVDWTVVNTE 75
           PG Y ++   G V+Y+GKAKNL  R+ +Y ++    HP  +T+ +     D+DW    TE
Sbjct: 21  PGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKEN---HPDIKTRALQKEIFDLDWIATGTE 77

Query: 76  VEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYS 135
            EAL LE + IK+++PRFNVR++DDK YPY+ V+L+E FP V + R  +  G RYFGPYS
Sbjct: 78  KEALILEATLIKKHNPRFNVRFKDDKKYPYICVSLSESFPMVYITRKLKDNGDRYFGPYS 137

Query: 136 YAWAIRDTVDLLLRVFPVR-TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
              + R+T+D++LR+FPVR T       + R   RPCL   + +C  PC G I VE+Y+ 
Sbjct: 138 DVKSTRETLDIILRIFPVRKTRQVLPLPKPR---RPCLNFDMGRCLGPCQGNIPVEDYKI 194

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           + +    F+ G+    +                      RD +Q ++   EKQ VV  + 
Sbjct: 195 VIDQVIQFLEGKKESLVGDLSIKMSASSNRMDFEKAARYRDMLQRIQNFREKQTVVSAEG 254

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            D DVI  A  + E  V +  VRGGR+  ++ + +  V D    +++  F    Y  A  
Sbjct: 255 GDEDVIGFARKKDEGQVILLEVRGGRLETKKSFPIQGVLDAEDSEILGAFFRDYYLNA-- 312

Query: 315 EESTTAIPREVLVSAEPADRDAVVA-WLSKRRGAAVDVRVPQRGDKRALMETVLKNAE-- 371
                 +P  + V A+  +  A V   L ++ G    ++ P+ GDKR+L++   KNAE  
Sbjct: 313 ----ALVPPLIFVPADIQEETAAVMDVLQEKTGFRPKLKSPRGGDKRSLLKIAEKNAELG 368

Query: 372 ---QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
              + LA H   + + L    +              P  IEC+DIS  QG   VAS V+F
Sbjct: 369 LTERLLATHYRDQTASLKEIQEMFSLEHP-------PHIIECYDISHFQGSEPVASGVMF 421

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
            +G   K  YR+++IRG +G + D   ++EVISRR  R   E                  
Sbjct: 422 VEGKPFKQGYRKYNIRGYKGIN-DPGMIHEVISRRLQRIANEESVF-------------- 466

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPI 548
                      P+L+V+DGG  Q+              + + GLAK+ EE++ PG+ +P 
Sbjct: 467 -----------PDLIVIDGGPTQLXXXXXXXXXXXXXRIPMIGLAKKREEIYFPGDNEPF 515

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I    S G+ LL+ +RDEAHRF +S+HR +R K    S++ ++P +G  R   LL+HF  
Sbjct: 516 IFDMNSSGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQNVPDIGLKRSKLLLRHFSG 575

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
            +++  AT  E+  VPGIGE  A+ I +R+   E
Sbjct: 576 EKKIEDATKEELLAVPGIGENLAEKILKRIRKKE 609


>UVRC_LEPBJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  339 bits (869), Expect = 5e-95
 Identities = 212/634 (33%), Positives = 321/634 (50%), Gaps = 54/634 (8%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP--RTQTMISTAADVDWTVVNTE 75
           PG Y ++   G V+Y+GKAKNL  R+ +Y ++    HP  +T+ +     D+DW    TE
Sbjct: 21  PGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKEN---HPDIKTRALQKEIFDLDWIATGTE 77

Query: 76  VEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYS 135
            EAL LE + IK+++PRFNVR++DDK YPY+ V+L+E FP V + R  +  G RYFGPYS
Sbjct: 78  KEALILEATLIKKHNPRFNVRFKDDKKYPYICVSLSESFPMVYITRKLKDNGDRYFGPYS 137

Query: 136 YAWAIRDTVDLLLRVFPVR-TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
              + R+T+D++LR+FPVR T       + R   RPCL   + +C  PC G I VE+Y+ 
Sbjct: 138 DVKSTRETLDIILRIFPVRKTRQVLPLPKPR---RPCLNFDMGRCLGPCQGNIPVEDYKI 194

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           + +    F+ G+    +                      RD +Q ++   EKQ VV  + 
Sbjct: 195 VIDQVIQFLEGKKESLVGDLSIKMSASSNRMDFEKAARYRDMLQRIQNFREKQTVVSAEG 254

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            D DVI  A  + E  V +  VRGGR+  ++ + +  V D    +++  F    Y  A  
Sbjct: 255 GDEDVIGFARKKDEGQVILLEVRGGRLETKKSFPIQGVLDAEDSEILGAFFRDYYLNA-- 312

Query: 315 EESTTAIPREVLVSAEPADRDAVVA-WLSKRRGAAVDVRVPQRGDKRALMETVLKNAE-- 371
                 +P  + V A+  +  A V   L ++ G    ++ P+ GDKR+L++   KNAE  
Sbjct: 313 ----ALVPPLIFVPADIQEETAAVMDVLQEKTGFRPKLKSPRGGDKRSLLKIAEKNAELG 368

Query: 372 ---QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
              + LA H   + + L    +              P  IEC+DIS  QG   VAS V+F
Sbjct: 369 LTERLLATHYRDQTASLKEIQEMFSLEHP-------PHIIECYDISHFQGSEPVASGVMF 421

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
            +G   K  YR+++IRG +G + D   ++EVISRR  R   E                  
Sbjct: 422 VEGKPFKQGYRKYNIRGYKGIN-DPGMIHEVISRRLQRIANEESVF-------------- 466

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPI 548
                      P+L+V+DGG  Q+              + + GLAK+ EE++ PG+ +P 
Sbjct: 467 -----------PDLIVIDGGPTQLXXXXXXXXXXXXXRIPMIGLAKKREEIYFPGDNEPF 515

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           I    S G+ LL+ +RDEAHRF +S+HR +R K    S++ ++P +G  R   LL+HF  
Sbjct: 516 IFDMNSSGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQNVPDIGLKRSKLLLRHFSG 575

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
            +++  AT  E+  VPGIGE  A+ I +R+   E
Sbjct: 576 EKKIEDATKEELLAVPGIGENLAEKILKRIRKKE 609


>UVRC_DESPS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  339 bits (869), Expect = 5e-95
 Identities = 220/632 (34%), Positives = 316/632 (50%), Gaps = 48/632 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           S P  PGVY   D   RVIYVGKAK+L  RL+SY +  S+ H +T  M+     V   + 
Sbjct: 11  STPHKPGVYLMLDAKARVIYVGKAKDLVKRLTSYTRHSSSEHNKTTVMLKKVEQVKTIIT 70

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            TE EAL LE S IK++ PR+N+  RDDK+YPY+AVT+ EE+PRV ++R  RR   RYFG
Sbjct: 71  TTEKEALILEASLIKKHKPRYNIILRDDKNYPYIAVTVGEEWPRVMMVRRKRRDNSRYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PYS A A+  T+ L+  +FP+R C     ++ R   RPCL   I KC APC G +  + Y
Sbjct: 131 PYSSATAMWATLKLIASLFPLRNCRG---EKLRPRTRPCLNRQIGKCLAPCTGNVSRKIY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +     + G++   L                      RD I+AL+T +EKQ V  G
Sbjct: 188 MENVDKILLLLQGKSRDLLAELKRQMLQASERLNFEQAGQFRDQIRALKTTLEKQLVAAG 247

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV          AV + +VR G + G R + ++    + +     Q L+QT    
Sbjct: 248 HGKNQDVFGYVRSGTTVAVNILFVRDGLVSGSRSFFIEDYFGLDS-----QVLSQTISQY 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
            D E  T  P+E+L+   P + + +  +L+      + +++PQRGD   L+E    NA Q
Sbjct: 303 YDRE--TPPPKEILLPFSPENFELLSEYLADFTTHILQIKIPQRGDSTILVEMANTNARQ 360

Query: 373 TLA-RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             A + K +R+     +S               P  IEC DIS + G+H + S+V F  G
Sbjct: 361 LFAEKEKKERSWQSLGKS-----IKEKLQLSRTPETIECLDISNISGQHAIGSLVCFSGG 415

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
            A KS +R + IR  EG D D   M EV+ RRF R ++E    G L              
Sbjct: 416 EANKSRFRHYKIRTIEGPD-DYGMMREVMERRFKRGIKE----GNL-------------- 456

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRL----EEVWLPGEED 546
                   PNL VVDGG+ Q+  A     +LGI  ++   G+AK      E+++ PG ++
Sbjct: 457 --------PNLFVVDGGKGQLGMAMAVARELGITNELDWIGIAKERHEEGEKLYKPGRKN 508

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           PI+LP  S  L  L R+RDE+HR+ I++HR+ R +A  +S LD+I G+G  R        
Sbjct: 509 PILLPAHSPVLLYLMRIRDESHRYGITFHRKLRNRATLSSELDEIEGIGDNRXXXXXXXX 568

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
                  +A+  ++ EV GIG   A+ IY  L
Sbjct: 569 XXXXXXXEASLQKLQEVEGIGPLLAKKIYTSL 600


>UVRC_ANAD2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 707

 Score =  339 bits (869), Expect = 5e-95
 Identities = 250/687 (36%), Positives = 351/687 (51%), Gaps = 101/687 (14%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTA-A 65
           LR K   +P +PG Y  +D  G V+YVGKA +LR+R+ SYF            ++     
Sbjct: 5   LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELLG 64

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D++  V  +E EA+ LE   IK++ PRFNVR RDDK +  L +     +PR++V R   +
Sbjct: 65  DLEVIVTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPRLEVRRAREK 124

Query: 126 R--GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
           R  G RYFGPYS A +IR+T+ ++ R F +RTCS  VF   +   RPC+L  I +C APC
Sbjct: 125 RQPGARYFGPYSSASSIRETLRMVNRHFQLRTCSDHVFDHRK---RPCILYQIHRCPAPC 181

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTV 243
           V  +  EEYR   ED   F                              +RD +QA+   
Sbjct: 182 VYEVAAEEYRQSVEDAVEFXXXXXXXXXXXXXXXMAGAAEGLRFEEAARLRDQLQAVERS 241

Query: 244 MEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
           +EKQ V++ D  D DVI +  +  +  VQV  +R G+++  +     + ++    +++  
Sbjct: 242 LEKQRVLMSDRGDRDVIGLYREGPDLVVQVLSMRAGKLQDAQAHPF-REQEFPDEEILSS 300

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
           FL+  Y   D        P E+LV  EP   +A+   LS+RRG  V +  PQRG K  L+
Sbjct: 301 FLSLYYEHTD-------APDEILVPLEPVQAEALADVLSERRGRRVRLLTPQRGAKADLL 353

Query: 364 ETVLKNAEQTL-ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
           +   +NAEQ   A H+                          P  +EC+DIST QG   V
Sbjct: 354 DVARRNAEQGFRAWHEHDE-----XXXXXXXXXXXXXXXXXPPRWMECYDISTFQGALAV 408

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
            S V  +DG   K+ YRR+ ++   G D D A ++EVI+RR  R L E Q          
Sbjct: 409 GSGVSMKDGEPDKANYRRYKVKAVAGQD-DFAMLHEVITRRLRRALGEGQL--------- 458

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-----------VAVCG 531
                            P+L+V+DGG+ Q+ AA  A  DLG+             V + G
Sbjct: 459 -----------------PDLIVIDGGKGQLNAALAAAKDLGVPTRPSPGNPDAPFVELVG 501

Query: 532 LAK-RL------------------------------------------EEVWLPGEEDPI 548
           LAK RL                                          E V+LPG +DP+
Sbjct: 502 LAKSRLVDGPSLGTXXXXXXXXXXXXXXXXXXXXXXEKGFVSELARSPERVFLPGRKDPV 561

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
           +L + S  L+LL R+RDEAHRFAI++HR+ R +    SVL++IPG+G  R+ ALL+HFG+
Sbjct: 562 VLRQNSAELFLLARLRDEAHRFAITFHRKLRRERNFQSVLEEIPGIGEGRKRALLRHFGA 621

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIY 635
           +RR+ +AT  EIA+V G G R A  ++
Sbjct: 622 LRRVREATPEEIAQVEGFGPRQAAAVH 648


>UVRC_SALSV RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  338 bits (868), Expect = 6e-95
 Identities = 223/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V E+Q V  
Sbjct: 188 YTQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTERQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALPC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  338 bits (868), Expect = 6e-95
 Identities = 223/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V E+Q V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTERQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SALCH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  338 bits (868), Expect = 6e-95
 Identities = 223/635 (35%), Positives = 333/635 (52%), Gaps = 54/635 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV- 250
           Y    E    F++G+  + L                     IRD IQA+R V E+Q V  
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLIARMEKASQDLAFEEAARIRDQIQAVRRVTERQFVSN 247

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            GD  D DVI +A D   A V V ++R G++ G R +          G++VE F+ Q Y 
Sbjct: 248 AGD--DLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYL 305

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                 +   +P E+L+    +D+  +   LS+  G  + V+   RGD+   ++    NA
Sbjct: 306 QGSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRRIHVQTKPRGDRARYLKLARTNA 362

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    SQ+ S +T R                  R+ECFDIS   GE TVAS VVF+ 
Sbjct: 363 ATALITKLSQQ-STITQRLTALAAVLKLPAIK----RMECFDISHTMGEQTVASCVVFDA 417

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               ++EYRR++I G    D D AAM +V+ RR+ + +EES+                  
Sbjct: 418 NGPLRAEYRRYNIAGITPGD-DYAAMNQVLRRRYGKAIEESKI----------------- 459

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVW 540
                    P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++
Sbjct: 460 ---------PDVILIDGGKGQLAQAKAVFAELDVPWDKHRPLLLGVAKGADRKAGLETLF 510

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
              E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP RR 
Sbjct: 511 FEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSTLETIEGVGPKRRQ 570

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 571 MLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_PSEPK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  338 bits (866), Expect = 1e-94
 Identities = 217/629 (34%), Positives = 326/629 (51%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RL+SYF+  + L P+T  +++  A V+ T+   E E
Sbjct: 18  PGVYRMFDGEARLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVARIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IKE+ P +N+  RDDKSYPY+ ++ + EFPR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQNLIKEWRPPYNILLRDDKSYPYVFLS-DGEFPRLGIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +       RPCL   I +C  PC   +  EEY     
Sbjct: 136 GAIRESLSLLQKAFSVRQCEDSYYANRT---RPCLQYQIKRCKGPCTDLVTAEEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G + +                       +RD I  LR V ++Q +  G S D 
Sbjct: 193 HSVMFLEGRSQQLGNELNAEMEKAAMALDFEKAAELRDQIALLRRVQDQQYIE-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVIA   +   A V +  VRGGR+ G + +      +    +++  FL+Q Y G  + E 
Sbjct: 252 DVIAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMAAFLSQYYLGNAERE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D +A+   L   RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGELIVNVVHEDFNAITEALHTLRGRELTISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -NARLANRQHMAARFEALAEVLGLDEVPQRLECYDISHSSGEATVASCVVFGPEGPIKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I      D D AAM++ ++RR+ R  +   ++                       
Sbjct: 424 YRRFNIEDVTAGD-DYAAMHQALTRRYGRIKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIILP 551
             P++++VDGG+ Q+  A+  + +LG  D+ + G+AK +      E ++L        L 
Sbjct: 460 --PDVLLVDGGKGQLNMARDVMQELGFTDLTLLGVAKGVTRKAGFETLYLNDVHHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+ G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSSALHLIQQIRDEAHRFAITGHRARRGKARRVSSLEDVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L +A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LNRASIDEIAKAPGISKKLAESIYASLHS 606


>UVRC_LEGPL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  338 bits (866), Expect = 1e-94
 Identities = 224/637 (35%), Positives = 341/637 (53%), Gaps = 53/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P++PG+YR  DE G V+YVGKA NL+ R++SYF   +    +T+ ++S    ++ +V  
Sbjct: 17  LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEISVTR 75

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR-RGVRYFG 132
           +E EAL LE + IK   P++NV  RDDKSYPY+ ++ + +FPRV++ R  ++     +FG
Sbjct: 76  SETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRVELYRSKKKPPSGNFFG 135

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+T+  + ++F +R C    FK ARS  RPCL   I +C+APCV  I  E Y
Sbjct: 136 PYPGVAAVRETIVTIQKIFKIRNCRDSYFK-ARS--RPCLQYQIKRCTAPCVHYISPENY 192

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   ED   F+ G+    L                     +RD I+ LR + E+Q VV  
Sbjct: 193 KLSVEDAIRFLQGKCQIILDELAERMKNAVSQLNFEEAAVLRDQIKNLRLIQEQQGVVQL 252

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGW-------VVDKVEDVSTGKLVEQFL 305
              D DVIAI      A +Q   +R G++   + +       V+D  E++    L +Q  
Sbjct: 253 RG-DADVIAIEVRPGFACIQCVTIREGQVLNSQSFFPTVPYAVLD--EELDANSLWQQTF 309

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            + + G    +++  IP  ++ +    +  ++   LS+RRG +  ++V  RG K   M+ 
Sbjct: 310 -EAFIGFYYLDTSERIPDLIITNQSITESRSLEYILSQRRGKSCKIQVNPRGVKSRWMDF 368

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
            + N   ++A + S+ +   T RS+                R+ECFDIS  QGE TVAS 
Sbjct: 369 AVNNLRISVAEYVSKHS---TIRSRYQALRQLLALDKNIE-RMECFDISHTQGEATVASC 424

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+    R SEYRRF+I G    D D AAM + ++RRF R +                 
Sbjct: 425 VVFDTEGPRPSEYRRFNIEGITPGD-DYAAMEQAVTRRFKRLI----------------- 466

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEV 539
             GA+         P+++++DGG+ QV+  +R L  LG+ED+ + G++K        E++
Sbjct: 467 --GAQ-------LLPDVLIIDGGKGQVSIVKRVLTSLGVEDITLLGVSKGPSRKAGWEKL 517

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L  E    +LP  S+ L+LLQ +RDEAHRFAI+ HR+KR K    S L+ I G+G  RR
Sbjct: 518 ILVNENREFVLPEDSKALHLLQHIRDEAHRFAITAHRKKRQKTRVESTLESIEGVGAKRR 577

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            ALL+ FG +R LA+A+  EI +V GI E+ A+ IYE
Sbjct: 578 QALLQRFGGLRELAKASLEEICKVQGISEQLAKRIYE 614


>UVRC_GRABC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 644

 Score =  338 bits (866), Expect = 1e-94
 Identities = 236/628 (37%), Positives = 333/628 (53%), Gaps = 39/628 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G  +YVGKA++L+ R++SY Q    L  R + M+S    ++    +
Sbjct: 40  LPDRPGVYRMLDGQGEALYVGKARSLKKRVASYTQ-IHRLPERLRRMVSETVSMEIVTTH 98

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR-RRGVRYFG 132
           T         + IK   PRFN+  RDDKSYP+L +T +  FP++   RGA+ R+   Y+G
Sbjct: 99  TXXXXXXXXXNLIKRLKPRFNIVLRDDKSYPWLMLTEDHAFPQIMKHRGAQTRKAASYWG 158

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ AWA+  TV  + R+F +R+CS  VF    +  RPCLL  I +CSAPCV RI  E+Y
Sbjct: 159 PFASAWAVNQTVTAMQRIFLLRSCSDSVFA---NRSRPCLLFQIRRCSAPCVDRISQEDY 215

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L +   AF++G      R                    IRD I+ L  V     V   
Sbjct: 216 AELVDQARAFLSGRGTEIQRDLARQMXXXXXXXXXXXXXXIRDRIRGLTHVQGTAVVNPA 275

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DVIA+ +D  ++ VQVF++RGG   G R +        +   ++  F+AQ Y   
Sbjct: 276 SIGNADVIAVWQDAGQSCVQVFFIRGGHNNGNRAFYPAHTSAETAQDVLGAFIAQFY--- 332

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           DD+           +    A+++ V   LS + G  V++ VP RG+KRA++     NA +
Sbjct: 333 DDKXXXXXXXXNHTI----AEQELVSEALSLKAGRRVELHVPVRGEKRAVVAHAETNARE 388

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L R  ++ A     +++              P RIE +D S + G +    MVV     
Sbjct: 389 ALERKLAESAG----QNRLLDGVAELFDLPTRPNRIEIYDNSHIMGTNPYGVMVVAGPEG 444

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             KS YR+FSIRG      D A M E++ RRF+R L+E            +  P+G    
Sbjct: 445 WNKSAYRKFSIRGPITPGDDFAMMREMLERRFSRGLKE-----------RAEGPEGE--- 490

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEE----VWLPGE-EDP 547
               A  P+LV++DGG  Q++A +  LD++G+ DV +  +AK  +      W   E + P
Sbjct: 491 ----ANWPDLVLIDGGAGQLSAVRGILDEIGVTDVKLVAIAKGPDRDAGREWFHTEGQAP 546

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
             LP     LY LQR+RDEAHRFAI+ HR  R+K L  S LDDI G+G  R+ ALL HFG
Sbjct: 547 FQLPPRDPVLYYLQRLRDEAHRFAITTHRAGRSKTLVRSELDDIDGIGAARKRALLNHFG 606

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIY 635
           S R + QA  A +   PGI + TA+ IY
Sbjct: 607 SARGVKQAGLAALEATPGISKETARRIY 634


>UVRC_CHLPD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 631

 Score =  338 bits (866), Expect = 1e-94
 Identities = 214/647 (33%), Positives = 328/647 (50%), Gaps = 47/647 (7%)

Query: 10  KPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDW 69
           K  S+P+ PGVY+F++  GRVIY+GKAKNLR R+ SYF++   L  +T  M+   AD++ 
Sbjct: 20  KVASLPSSPGVYQFKNAQGRVIYIGKAKNLRNRVRSYFRNPQQLFGKTLVMVGKIADIEV 79

Query: 70  TVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVR 129
            + ++EVEAL LE + IKE  PR+NV  +DDK+YPYL +T NE FPR+ V R  ++ G  
Sbjct: 80  IITSSEVEALILENNLIKELKPRYNVNLKDDKTYPYLVIT-NEPFPRILVTRQVKKDGST 138

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSG--RPCLLGYIDKCSAPCVGRI 187
           +FGPY+ A  +R  +D +  +FP+R+C   +     S G  + CL  +I KC  PC G +
Sbjct: 139 WFGPYTEARQLRSILDFIGSIFPIRSCKLRLSPENISRGKFKVCLDYHIHKCKGPCEGLL 198

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
             EEY  +  +    + G+T   +R                    ++  I +L+   E+Q
Sbjct: 199 TEEEYLLMIVEITRLLKGKTSATIRSLNERMLSFAKELKFEQAAELKTQIDSLKRYAERQ 258

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            VV  D+ D DV A+A    +    VF +R G++ G     ++  E VS   L+ + + +
Sbjct: 259 KVVTSDTLDRDVFAVASRNDDGCGVVFKIREGKLLGSERLYMNNTEGVSVQDLLARVVER 318

Query: 308 TYGGADDEESTTAIPREVLVSAE-PADRDAVVAWL-------SKRRGAAVDVRVPQRGDK 359
            Y      E+   +P E+ +  E PA+    +  L         ++   + + VP  G+K
Sbjct: 319 YY-----LETCNLLPDEIFLQTELPAEEKETLENLLISKISAEGKQKRTIRLTVPIIGEK 373

Query: 360 RALMETVLKNAEQTLARH--KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQ 417
             L++   +NA   L  +  + Q+  +                    P RIECFD S   
Sbjct: 374 AHLIQLCRENARHHLEEYLIQKQKRGEALREHSGLIALAELLHLPKTPNRIECFDNSHFH 433

Query: 418 GEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGEL 477
           G   V+SMV F  G A+KS+YR+F ++  +G+D D AAM+EV++RR++  L     +   
Sbjct: 434 GTDYVSSMVAFVHGKAKKSDYRKFKLKTVQGSD-DYAAMHEVLTRRYSGTLSVELPL--- 489

Query: 478 DTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLE 537
                                 P+L+VVDGG+ Q++ A + L  L + D+ V GLAKR+E
Sbjct: 490 ----------------------PDLIVVDGGKGQLSTAVKVLVSLKL-DIPVIGLAKRIE 526

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           E++ P   DP  LP+TS  L L+Q++RDEAHRFA++YH               I G+G  
Sbjct: 527 EIFTPHTSDPFNLPKTSPALKLIQQLRDEAHRFAVTYHXXXXXXXXXXXXXXXIQGIGEK 586

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
               LL+HFGSV  +  A   E+      G +TA  +Y     +E G
Sbjct: 587 TAQKLLRHFGSVDLIRTAGVDELR--AAAGNKTAALLYRFYHPLEEG 631


>UVRC_GEOLS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 604

 Score =  337 bits (865), Expect = 1e-94
 Identities = 228/643 (35%), Positives = 325/643 (50%), Gaps = 58/643 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           LR    S PT PGVY  RD  G ++YVGKA+NLR R+S+YF       P+ + +++    
Sbjct: 3   LRDSIRSFPTAPGVYLMRDATGTILYVGKARNLRQRVSNYFGATDG-RPQVRFLMARVTS 61

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           +++T+ +TE EAL LE + IK++ PR+N+  +DDK++  L + L E FPR  V+R   R 
Sbjct: 62  IEFTITDTEKEALLLENTLIKQHQPRYNLNLKDDKTFFSLRIDLTERFPRFTVVRKVSRD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G RYFGPY+ A A R+ +  L R+FP+R       K   +  RPCL   I +CSAPC   
Sbjct: 122 GARYFGPYASASAAREVLRQLQRMFPLRHYP---LKTCLNRSRPCLYHQIGQCSAPCHNL 178

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  EEY  L E    F+ G+    +                      RD ++A+ T +E 
Sbjct: 179 ITAEEYNLLVEGAVLFLEGKNKDLVSGFRQRMKEAAEGLHYEEAARWRDLLKAIDTTLEH 238

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +V     D D++ +A ++   A+ V +VRGG + G    V+     + T   +  F+ 
Sbjct: 239 QKMV-SQGGDSDILGLAGNEDSLAIAVLFVRGGSLSGST--VLHGSGGLDTSDTLATFIQ 295

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
             YG      +   IP E+L+        ++  WLS+ +G  V ++ P+RGDK  L+   
Sbjct: 296 YYYG------NERFIPDELLLPLSLDAGQSLEEWLSELKGKKVRLQQPKRGDKLNLVNLA 349

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            +NA+  LA   + R     T ++              P RIEC+DISTLQG H+V S V
Sbjct: 350 TRNAQAALAEKSATRQGIERTLAE----LQQKLALPRLPRRIECYDISTLQGRHSVGSGV 405

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
            F DGL  K  YRR+ IR ++G D D   + EV +RRF                    +P
Sbjct: 406 AFLDGLPDKERYRRYRIRESQGQD-DFGMLQEVFARRF--------------------SP 444

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAK----------- 534
           +  E+        P+LVVVDGG  Q+ +    L +LG+ E  AV  LAK           
Sbjct: 445 ERIEQWG-----LPDLVVVDGGIGQLNSTLSVLAELGLSERPAVVSLAKSRVKGDGKDIH 499

Query: 535 --RLEE-VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDI 591
             R EE V+LPG  +P+ L + S  L LL  +RDEAHRFAI YHRR R +    S L +I
Sbjct: 500 VERTEERVFLPGRRNPVRLRQDSAPLKLLAAIRDEAHRFAIGYHRRLRDRETLRSALREI 559

Query: 592 PGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTI 634
           PG+GP     LL  FGS+  +  AT  E+A V G+ +  A+ I
Sbjct: 560 PGVGPKLERLLLTRFGSLEGIQNATVEELATVAGVSQELARLI 602


>UVRC_ECO45 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  337 bits (865), Expect = 1e-94
 Identities = 218/637 (34%), Positives = 333/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGSTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM++V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMHQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGIGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ANAVT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 627

 Score =  337 bits (865), Expect = 1e-94
 Identities = 229/639 (35%), Positives = 338/639 (52%), Gaps = 44/639 (6%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  +   IP +PGVY  RD   R+IY+GK++ LR+R+ SYF++      R  TM     +
Sbjct: 17  LEARLSEIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGYNKTERIATMAKLVTE 76

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR-- 124
           +++ V +T           IK++ P FNV  +DDK YPY+ +T +E++PR+ + R  +  
Sbjct: 77  IEFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRIFITRKRQLG 136

Query: 125 RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
           +   +Y+GPY+ +  +R+ + +  R+F +R     +FK      RPCL   + +C   C 
Sbjct: 137 KEKDKYYGPYTDSGLLREILRISKRIFALRQRPQPLFK-----DRPCLNYDLGRCPGVCQ 191

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
             I  EEYR   +       G T   +                     IRD I  L+++ 
Sbjct: 192 QLISPEEYRKTVQKVAMVFQGRTQELIDILSEQMEKAAEALNFEVAARIRDQIAGLKSLT 251

Query: 245 EKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
            +Q V L D T   D            +Q+F +R G++ G   +V +       G ++++
Sbjct: 252 AEQKVSLPDDTVSRDXXXXXXXXXXXCIQLFQIRAGQLVGRLAFVAES--HAEPGAILQR 309

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
            L + Y  A+  E    IP E+LV  E  D + +   L++R+G  V +  PQR  K  L+
Sbjct: 310 VLEEHYQTAESVE----IPAEILVQHELPDAEILADVLTQRKGRKVTIFTPQRQVKAELI 365

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           E V +NA+  L R   Q+  D   ++                 RIE +DIS +QG + VA
Sbjct: 366 EMVERNAQYELQR--MQKLGDRNHQATQXXXXXXXXXXXXH--RIEGYDISHIQGSNAVA 421

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQ--RVGELD 478
           S VVF DGL  K  YR + I+      G   D A++ EVI RRF +Y E+ Q  RVG  D
Sbjct: 422 SQVVFIDGLPAKQNYRHYKIKNPTVTIGHSDDFASLAEVIQRRFRKYAEDPQLSRVGNPD 481

Query: 479 TLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLE 537
                                P+L+++DGG+ Q+++    L ++ + ED+ V  LAKR E
Sbjct: 482 W--------------------PDLIMIDGGKGQLSSVVAVLQEMNLLEDLRVISLAKRRE 521

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
           E++LPGE  P+       G+ LL+R+RDEAHRFA+S+HR++R+  L  S LD+IPGLG  
Sbjct: 522 EIFLPGESQPLKTDAEQPGVQLLRRLRDEAHRFAVSFHRQQRSDKLKRSRLDEIPGLGHH 581

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           R+  LL HF SV  + QAT A+IAEVPGIG   AQ IY+
Sbjct: 582 RQKQLLAHFRSVDYIRQATPAQIAEVPGIGPHLAQAIYD 620


>UVRC_JANSC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 631

 Score =  337 bits (864), Expect = 2e-94
 Identities = 231/632 (36%), Positives = 347/632 (54%), Gaps = 45/632 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  D   RV+YVGKA+ L+ R++SY +  S   PR   MI   A + +   
Sbjct: 31  TLDMSPGVYRMLDSQSRVLYVGKARALKRRVASYAKP-SGHSPRIARMIRDTASMMFXXX 89

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                      + IK+  P+FNV  RDDKS+P + V+    FP+++  RG+++    YFG
Sbjct: 90  XXXXXXXXXXQNLIKQLKPKFNVLLRDDKSFPNILVSDEHAFPQIKKHRGSKKEKGSYFG 149

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ A A+  T++ L +VF +R C+  VF+   S  RPCLL  I +CS PCVG I  E+Y
Sbjct: 150 PFASAGAVNRTLNQLQKVFLLRNCTDAVFE---SRTRPCLLYQIKRCSGPCVGHISEEDY 206

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
            A  +D   F+ G++    R                              V   Q +   
Sbjct: 207 GASVKDAVRFLKGDSTDLQRQLADGMAAASEAMEFEXXXXXXXXXXXXTNVQSAQGINPQ 266

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DVIA+  +  +A VQVF++R  +  G R +      D+   +++E FL Q Y   
Sbjct: 267 GVKEADVIALHMEGGQACVQVFFIRANQNWGNRDFYPRVGADIEEPEVLEAFLGQFY--- 323

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D +E     P+++L+S      D +V  LS +RG  V++ VPQRG+K  L++   +NA +
Sbjct: 324 DQKEP----PKQLLLSHPVESMDLMVDALSGKRGTKVEILVPQRGEKAELVDGARRNARE 379

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           +L R    + ++   + K              P R+E +D S +QG H V +M+V     
Sbjct: 380 SLGR----KMAETQAQGKXXXXXXXXXXXXXPPKRVEVYDNSHIQGAHAVGAMIVAGPEG 435

Query: 433 ARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             KS+YR+F+I+G       D   M EV++RRF R L+E                   +R
Sbjct: 436 YLKSQYRKFNIKGGSLTPGDDFGMMKEVLTRRFARLLKEDP-----------------DR 478

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEE 545
           +   +   P+L+++DGG  Q++A +  +DDLG++DV   G+AK +      EE + PG+ 
Sbjct: 479 ETEAW---PDLLLIDGGAGQISAVKEIMDDLGVDDVPFIGVAKGIDRDQGKEEFYRPGQ- 534

Query: 546 DPII-LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            P+  L R    LY +QR+RDEAHRFAI  HR KR+KA++A+ LDD+PG+G  R+ ALL 
Sbjct: 535 -PVFALKRNDPVLYFVQRMRDEAHRFAIGAHRAKRSKAVSATPLDDVPGVGAGRKRALLA 593

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           HFGS + +A+A  +++  V G+ E  AQ IY+
Sbjct: 594 HFGSAKAVARANLSDLTAVDGVSEGLAQKIYD 625


>UVRC_PSEPW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  337 bits (863), Expect = 2e-94
 Identities = 215/629 (34%), Positives = 326/629 (51%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RL+SYF+  + L P+T  ++   A V+ T+   E E
Sbjct: 18  PGVYRMFDSETRLLYVGKAKNLKKRLASYFRK-TGLAPKTAALVGRIAQVETTITANETE 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE + IK++ P +N+  RDDKSYPY+ ++ + +FPR+ + RGA++   RYFGPY  A
Sbjct: 77  ALLLEQNLIKQWRPPYNILLRDDKSYPYVFLS-DGQFPRLGIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +       RPCL   I +C  PCVG +  EEY     
Sbjct: 136 GAIRESLSLLQKAFSVRQCEDSYYANRT---RPCLQYQIKRCKGPCVGLVDAEEYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G + +                       +RD I  LR V ++Q +  G S D 
Sbjct: 193 HSVMFLEGRSQQLGNELNAEMEKAAMALNFEKAAELRDQIALLRRVQDQQYME-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +    +++  FL+Q Y G  + E 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMAAFLSQYYLGNAERE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D  A+   L   RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPGELIVNVVHEDFAAISEALQTLRGRELTISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -NARLANRQHMAARFEALAEVLGLDEVPQRLECYDISHSSGEATVASCVVFGPEGPLKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G    D D AAM++ ++RR+ R  +   ++                       
Sbjct: 424 YRRFNIEGVTAGD-DYAAMHQALTRRYGRIKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIILP 551
             P++++VDGG+ Q+  A+  + +L   D+ + G+AK +      E ++L        L 
Sbjct: 460 --PDVLLVDGGKGQLNMAREVMQELAFTDLTLLGVAKGVTRKAGFETLYLNDVAHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             +  L+L+Q++RDEAHRFAI+ HR +R KA   S L+D+ G+GP RR  LLKHFG ++ 
Sbjct: 518 GDNPALHLIQQIRDEAHRFAITGHRARRGKARRVSSLEDVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L +A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LNRASIDEIAKAPGISKKLAESIYASLHS 606


>UVRC_PROMT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 640

 Score =  337 bits (863), Expect = 2e-94
 Identities = 206/647 (31%), Positives = 333/647 (51%), Gaps = 30/647 (4%)

Query: 1   MTVRPTLRPKPG------SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALH 54
           M + P +R K         IP DPG Y  +D   R++YVGK+K LR R+ SYF+  + L 
Sbjct: 1   MELTPLIRDKSRLSDFLKDIPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELS 60

Query: 55  PRTQTMISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEF 114
           PR   M+   AD++  V + E EAL LE + IK + P FNV  +DDK YPY+ +T  +++
Sbjct: 61  PRISLMVRQVADIELIVTDNESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKY 120

Query: 115 PRVQVMRGARRRGV--RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCL 172
           PR+ + R  R+R +  +Y+GPY   + +R T+  + ++FP+R     ++K      R CL
Sbjct: 121 PRIFLTRKRRQRQLKDKYYGPYVDVYLLRQTLFSIKKLFPLRQRRIPLYK-----DRTCL 175

Query: 173 LGYIDKCSAPCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXX 232
              I +C   C   I  E+Y+   +       G T                         
Sbjct: 176 NYSIGRCPGVCQEEISSEDYKNTLKRVEMIFQGRTDELRILLEKQMISFSESLKFEEAGS 235

Query: 233 IRDDIQALRTVMEKQAVVLGDSTDC-DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDK 291
           +RD ++ +  + E Q +++ DS+ C D+IA+A ++  ++VQ+F +R G++ G  G+  D 
Sbjct: 236 VRDQLKGIDRLYESQKMIIPDSSVCRDIIAMASEENISSVQIFQMRSGKLIGRLGYFSDN 295

Query: 292 VEDVSTGKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDV 351
             + ++ ++++Q +   Y   D  E    IP E+LV  +  +   +  WLS+ +   V++
Sbjct: 296 -SNFNSSQILQQVIENHYSNVDPVE----IPSEILVQHQLVNNILISDWLSEIKKQKVNI 350

Query: 352 RVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECF 411
            VP+R  K  +++ V KNA   L R K  +  +L                   P RIEC+
Sbjct: 351 NVPKRSRKAEIIKLVEKNANLELQRIKQSQDKNLV----ELDDLTNILDLENIPKRIECY 406

Query: 412 DISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYL 468
           DIS +QG   VAS VVF DG+A +  YRR+ I+      G   D  +M EVI+RRF R+ 
Sbjct: 407 DISHIQGSDAVASQVVFIDGIAARQHYRRYKIKSPNIKIGHSDDFESMAEVITRRFRRWA 466

Query: 469 EESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDV 527
              +  G++D L  +   + +               +DGG+ Q+++   AL+ L + +++
Sbjct: 467 RFKEEGGDIDALLSN---ESSXXXXXXXXXXXXXXXIDGGKGQLSSVVAALEGLKLDQNL 523

Query: 528 AVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASV 587
            V  LAK+ EEV++P  +  ++      G+ LL+R+RDEAHRFAI++H            
Sbjct: 524 NVISLAKKKEEVFIPKVKQSLVTESNQPGMLLLRRLRDEAHRFAITFHXXXXXXXXXXXX 583

Query: 588 LDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTI 634
           L++IPGLGP R   LL+HF S+  +  AT +E++  PG+G  TA  I
Sbjct: 584 LNEIPGLGPQRIKLLLEHFRSIEAIQMATFSELSSTPGLGRSTAVVI 630


>UVRC_PROM1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 640

 Score =  337 bits (863), Expect = 2e-94
 Identities = 202/628 (32%), Positives = 327/628 (52%), Gaps = 24/628 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP DPG Y  +D   R++YVGK+K LR R+ SYF+  + L PR   M+   AD++  V +
Sbjct: 20  IPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELSPRISLMVRQVADIELIVTD 79

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYF 131
            E EAL LE + IK + P FNV  +DDK YPY+ +T  +++PR+ + R  R+R +  +Y+
Sbjct: 80  NESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKYPRIFLTRKRRQRQLKDKYY 139

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY   + +R T+  + ++FP+R     ++K      R CL   I +C   C   I  E+
Sbjct: 140 GPYVDVYLLRKTLFSIKKLFPLRQRRIPLYK-----DRTCLNYSIGRCPGVCQEEISSED 194

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +       G T                         +RD ++ +  + E Q +++
Sbjct: 195 YKNTLKRVEMIFQGRTDELRILLEKQMISFSESLKFEEAGSVRDQLKGIDRLYESQKMII 254

Query: 252 GDSTDC-DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            DS+ C D+IA+A ++  ++VQ+F +R G++ G  G+  D   + ++ ++++Q +   Y 
Sbjct: 255 PDSSVCRDIIAMASEENISSVQIFQMRSGKLIGRLGYFSDN-SNFNSSQILQQVIENHYS 313

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E    IP E+LV  +  +   +  WLS+ +   V++ VP+R  K  +++ V KNA
Sbjct: 314 NVDPVE----IPSEILVQHQLVNNILISDWLSEIKKQKVNINVPKRSRKAEIIKLVEKNA 369

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L R K     +L                   P RIEC+DIS +QG   VAS VVF D
Sbjct: 370 NLELQRIKQSHDKNLV----ELDDLTNILDLENIPKRIECYDISHIQGSDAVASQVVFID 425

Query: 431 GLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           G+A +  YRR+ I+      G   D  +M EVI+RRF R+    +  G+++ L  +   Q
Sbjct: 426 GIAARQHYRRYKIKSPNIKIGHSDDFESMAEVITRRFRRWARFKEEGGDINALLSN---Q 482

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEVWLPGEED 546
            +               +DGG+ Q+++   AL++L + +++ V  LAK+ EEV++P  + 
Sbjct: 483 SSXXXXXXXXXXXXXXXIDGGKGQLSSVVAALEELKLDQNLNVISLAKKKEEVFIPNVKQ 542

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            ++      G+ LL+R+RDEAHRFAI++H            L++IPGLGP R   LL+HF
Sbjct: 543 SLVTESNQPGMLLLRRLRDEAHRFAITFHXXXXXXXXXXXXLNEIPGLGPQRIKLLLEHF 602

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTI 634
            S+  +  AT +E++  PG+G  TA  I
Sbjct: 603 RSIEAIQMATFSELSSTPGLGRSTAVVI 630


>UVRC_SILPO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  336 bits (862), Expect = 3e-94
 Identities = 238/626 (38%), Positives = 350/626 (55%), Gaps = 44/626 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   RV+YVGKA+NL+AR+S+Y +   +  PR + MI   A + +        
Sbjct: 30  PGVYRMLDAQARVLYVGKARNLKARVSNYARPGHS--PRIERMIRETASMMFXXXXXXXX 87

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                 + IK+  P++NV  RDDKS+P + V  +  F +++  RGA++    YFGP++ A
Sbjct: 88  XXXXXQNLIKQLKPKYNVLLRDDKSFPNILVAKDHSFAQIKKHRGAKKEKGTYFGPFASA 147

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+  T++ L + F +R C+  VF+   S  RPCLL  I +CSAPCVG I  ++Y A  +
Sbjct: 148 GAVNRTLNQLQKAFLLRNCTDAVFE---SRTRPCLLYQIKRCSAPCVGLISDQDYAAAVK 204

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
           D   F++G + R                                TV   Q +      + 
Sbjct: 205 DAERFLSGRSTRVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTVQGTQGINPRGVAEA 264

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A+  +  +A VQVF++R  +  G R +     EDVS  +++E FL Q Y   D++E 
Sbjct: 265 DVVALHLENGQACVQVFFIRANQNWGNRDFYPRVGEDVSAAEVMEAFLGQFY---DNKEP 321

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
               PR++++S    + D +   LS++ G  V++ VPQRG+K  L+   L+NA ++LAR 
Sbjct: 322 ----PRQLILSDAIENADLMTEALSEKAGRKVELLVPQRGEKAELVSGALRNARESLAR- 376

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
              R S+  T++K              P RIE +D S +QG + V  M+V       K++
Sbjct: 377 ---RMSESATQTKLLGGLAEAFDLDGPPQRIEVYDNSHIQGTNAVGGMIVAGPEGFLKNQ 433

Query: 438 YRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRF 496
           YR+F+IRG +     D   M EV++RRFTR L+E       D   + G            
Sbjct: 434 YRKFNIRGDDLTPGDDFGMMKEVLTRRFTRLLKE-------DPDRDKG------------ 474

Query: 497 AYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEEDPIIL 550
              P+L+++DGG  QV+A    +   G++D+ + G+AK +      EE    G+  P  L
Sbjct: 475 -LWPDLLLIDGGAGQVSAVHEIMMAHGVQDIPMVGVAKGIDRDHGKEEFHRTGQR-PFAL 532

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
            R    LY +QR+RDEAHRFAI  HR KRAKA++A+ LDDIPG+G  R+ ALL HFGS +
Sbjct: 533 KRNDPVLYFIQRLRDEAHRFAIGTHRAKRAKAVSATPLDDIPGVGAARKRALLAHFGSAK 592

Query: 611 RLAQATAAEIAEVPGIGERTAQTIYE 636
            +++A  A++  V G+    AQ IY+
Sbjct: 593 AVSRADLADLTAVEGVSAGLAQKIYD 618


>UVRC_LEGPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  336 bits (862), Expect = 3e-94
 Identities = 221/637 (34%), Positives = 338/637 (53%), Gaps = 53/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P++PG+YR  DE G V+YVGKA NL+ R++SYF   +    +T+ ++S    ++ +V  
Sbjct: 17  LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEISVTR 75

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR-RGVRYFG 132
           +E EAL LE + IK   P++NV  RDDKSYPY+ ++ + +FPR+++ R  ++     +FG
Sbjct: 76  SETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPPSGNFFG 135

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+T+  + ++F +R C    FK ARS  RPCL   I +C+APCV  I  E Y
Sbjct: 136 PYPGVAAVRETIVTIQKIFKIRNCRDSYFK-ARS--RPCLQYQIKRCTAPCVHYISPENY 192

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   ED   F+ G+    L                     +RD I+ LR + E+Q VV  
Sbjct: 193 KLSVEDAIRFLQGKCQIILDALAERMKQAVNQLNFEEAAVLRDQIKNLRLIQEQQGVVQL 252

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGW-------VVDKVEDVSTGKLVEQFL 305
              D DVIAI      A +Q   +R G++   + +       V+D  E++    L +Q  
Sbjct: 253 RG-DADVIAIEVRPGFACIQCVTIREGQVLNSQSFFPTVPYAVLD--EELDANSLWQQTF 309

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            + + G    ++T  IP  ++ +    +  ++   LS+RRG +  ++V  RG K   M+ 
Sbjct: 310 -EAFIGFYYLDTTERIPDLIITNQSITESRSLEYILSQRRGKSCKIQVNPRGVKSRWMDF 368

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
            + N   ++A + S+ +   T RS+                R+ECFDIS  QGE TVAS 
Sbjct: 369 AVNNLRISVAEYVSKHS---TIRSRYQALKQLLALDKNIE-RMECFDISHTQGEATVASC 424

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+    R SEYRRF+I G    D D AAM + ++RRF R ++                
Sbjct: 425 VVFDTEGPRPSEYRRFNIEGITPGD-DYAAMEQAVTRRFKRLIDAQ-------------- 469

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEV 539
                         P+++++DGG+ QV+  +R L  LG+ED+ + G++K        E++
Sbjct: 470 ------------LLPDVLIIDGGKGQVSIVKRVLTSLGVEDITLLGVSKGPSRKAGWEKL 517

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L  E    +LP  S+ L+LLQ +RDEAHRFAI+ HR+KR K    S L+ I G+G  RR
Sbjct: 518 ILVNENREFVLPEDSKALHLLQHIRDEAHRFAITAHRKKRQKTRVESTLESIEGVGAKRR 577

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            ALL+ FG +R LA+A   EI +V GI E+ A+ I+E
Sbjct: 578 QALLQRFGGLRELAKAPLEEICKVQGISEQLAKRIHE 614


>UVRC_PROMP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 656

 Score =  336 bits (861), Expect = 4e-94
 Identities = 206/636 (32%), Positives = 332/636 (52%), Gaps = 24/636 (3%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ +   IP   G Y F+D    ++Y+GK+K LR R+SSYF +++ L PR   M+    +
Sbjct: 32  LKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKTLRNRVSSYFNNYAELSPRLSLMVRQITE 91

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           ++  V ++E EAL LE + IK   P FN+  +DDK YPYL +T +E++PR+ + R  R R
Sbjct: 92  IEIIVTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEQYPRIFITRKRRNR 151

Query: 127 GV--RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
               RY+GPY     +R T+ ++ ++FP+R     V+K      R CL   I +C   C 
Sbjct: 152 NNFDRYYGPYVDVGLLRKTLFIIKKIFPLRQRPRPVYK-----DRTCLNYSIGRCPGVCQ 206

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
             I  E+Y+   +       G                           IRD I  L+ + 
Sbjct: 207 EIISSEDYKKTMKQVSMIFQGRNDDLEVFLERKMNQYSNDLEFENAAKIRDQISGLKLLT 266

Query: 245 EKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
           E Q + + DS+ + D+  I  +   +++Q+F +R G++ G  G+   K+++    +++++
Sbjct: 267 ESQKISIPDSSINRDIFGIVSENNISSIQIFQMRSGKLIGRIGYT-QKIDNSDETEILQR 325

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
            L + Y   +  E    IP E+L+       + +  WLS+ R   V + +P+R  K   +
Sbjct: 326 VLEEHYINVEGVE----IPSEILLQFNLPKHNTIEEWLSELRQKKVKLIIPKRNKKFETV 381

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           E VLKNA+  L R      + +                   P RIE +DIS +QG   VA
Sbjct: 382 EMVLKNAKLELERI----LNGIQDNESSIEDLTQILELTNQPRRIEGYDISHIQGTDPVA 437

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           S VVF DG+  K  YR++ I+      G   D A++YEVI RRF ++ +     G++ +L
Sbjct: 438 SQVVFIDGIPSKQNYRKYKIKDPNIFIGHSDDFASIYEVIYRRFKKWSKFKIDGGDISSL 497

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEV 539
            +    + +  +       P+L+++DGG+ Q+ AA +AL  L + E+V +C LAK+ EE+
Sbjct: 498 QDK---KKSTLENDLLTDWPDLIMIDGGKGQLNAALKALTQLDLHEEVNICSLAKKNEEI 554

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           ++PG    +   +  +GL LL+RVRDEAHRFA+S+HR KR+  +  S L  IPGLGP R 
Sbjct: 555 FIPGFSKSLDTDQNQKGLLLLRRVRDEAHRFALSFHRNKRSARMNRSQLSQIPGLGPSRI 614

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
             LL+HF S+  +  A+  E+++V G+G  +A  IY
Sbjct: 615 KDLLEHFNSIDAIRIASREELSKVKGLGMHSANDIY 650


>UVRC_PROMM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 667

 Score =  336 bits (861), Expect = 4e-94
 Identities = 219/630 (34%), Positives = 321/630 (50%), Gaps = 26/630 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PG Y  RD   R++YVGK+K LR R+ SYF+  S   PR + M+   A++++ V +
Sbjct: 41  IPAEPGCYLMRDVEDRLLYVGKSKCLRNRVRSYFRSSSDHGPRIRLMVRQIAEIEFIVTD 100

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR--RRGVRYF 131
           +E E+L LE + IK   P FNV  +DDK YPYL +T +EE+P            +  R++
Sbjct: 101 SEAESLVLESNLIKNQQPHFNVLLKDDKKYPYLCITWSEEYPXXXXXXXXXXXNKNDRFY 160

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R T+ L+ R FP+R        R     R CL   I +C   C  +I  ++
Sbjct: 161 GPYVDVGLLRRTLLLVKRSFPLRQRP-----RPLHQDRTCLNYSIGRCPGVCQQKITPQD 215

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  +         G                           IRD I+ L  + E Q + L
Sbjct: 216 YHQVLRKVAMVFQGRNQELKVLLEKQMERYSDRMDYESAANIRDQIKGLEQLTEGQKMSL 275

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            DS+   DV+AIA D   AAVQ+F +R G++    G+  D V D + G ++++ + + Y 
Sbjct: 276 PDSSVSRDVLAIASDHRVAAVQLFQMRAGKLVNRLGFTADAV-DQTLGSVLQRVIEEHYS 334

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E    +P EVLV      ++ +V WLS+ RG  V +  PQR  K  L+E V +NA
Sbjct: 335 QVDAVE----VPPEVLVQYSLPQQELLVDWLSEHRGRRVQISCPQRQAKAELIELVERNA 390

Query: 371 EQTLARHKS-QRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
              L+R KS Q+  +L T                 P RIE +DIS +QG   VAS VVF 
Sbjct: 391 VFELSRAKSGQQQQELATED-----LAQLLELTTQPRRIEGYDISHIQGSDAVASQVVFI 445

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YR           G   D  AM E++ RRF R+    Q     + L      
Sbjct: 446 DGLPAKQHYRXXXXXXXXXXXGHSDDFMAMAEIMRRRFRRWARVKQEGSNFENLQRCS-- 503

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEVWLPGEE 545
            G+  +       P++V++DGG+ Q+++A  AL +L + ED+ VC LAK+ E++++PG+ 
Sbjct: 504 -GSALQTDGLNDWPDVVMIDGGKGQLSSAMEALRELDLHEDLVVCSLAKKHEQIFVPGQS 562

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+       G+ LL+R+RDEAHRFA+SYHR++R   +  S L DIPGLGP R   LL H
Sbjct: 563 KPLDSDPDQLGVVLLRRLRDEAHRFAVSYHRQQRGVRMNRSRLTDIPGLGPRRVRDLLAH 622

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           F S+  +  A+  +I++ PG+G   A  ++
Sbjct: 623 FQSIDAIQLASVQQISQAPGLGPALALQVW 652


>UVRC_LEGPH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  336 bits (861), Expect = 4e-94
 Identities = 220/637 (34%), Positives = 338/637 (53%), Gaps = 53/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P++PG+YR  DE G V+YVGKA NL+ R++SYF   +    +T+ ++S    ++ +V  
Sbjct: 17  LPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEISVTR 75

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR-GVRYFG 132
           +E EAL LE + IK   P++NV  RDDKSYPY+ ++ + +FPR+++ R  ++     +FG
Sbjct: 76  SETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPPSGNFFG 135

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+T+  + ++F +R C    FK ARS  RPCL   I +C+APCV  I  E Y
Sbjct: 136 PYPGVAAVRETIVTIQKIFKIRNCRDSYFK-ARS--RPCLQYQIKRCTAPCVHYISPENY 192

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   ED   F+ G+    L                     +RD I+ LR + E+Q VV  
Sbjct: 193 KLSVEDAIRFLQGKCQIILDELAERMKQAVSQLNFEEAAVLRDQIKNLRLIQEQQGVVQL 252

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGW-------VVDKVEDVSTGKLVEQFL 305
              D DVIAI      A +Q   +R G++   + +       V+D  E++    L +Q  
Sbjct: 253 RG-DADVIAIEVRPGFACIQCVTIREGQVLNSQSFFPTVPYAVLD--EELDANSLWQQTF 309

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            + + G    +++  IP  ++ +    +  ++   LS+RRG +  +++  RG K   M+ 
Sbjct: 310 -EAFIGFYYLDTSERIPDLIITNQSITESRSLEYILSQRRGKSCKIQINPRGVKSRWMDF 368

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
            + N   ++A + S+ +   T RS+                R+ECFDIS  QGE TVAS 
Sbjct: 369 AVNNLRISVAEYVSKHS---TIRSRYQALKQLLALDKNIE-RMECFDISHTQGEATVASC 424

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+    R SEYRRF+I G    D D AAM + ++RRF R ++                
Sbjct: 425 VVFDTEGPRPSEYRRFNIEGITPGD-DYAAMEQAVTRRFKRLIDVQLL------------ 471

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEV 539
                         P+++++DGG+ QV+  +R L  LG+ED+ + G++K        E++
Sbjct: 472 --------------PDVLIIDGGKGQVSIVKRVLTSLGVEDITLLGVSKGPSRKAGWEKL 517

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L  E    +LP  S+ L+LLQ +RDEAHRFAI+ HR+KR K    S L+ I G+G  RR
Sbjct: 518 ILVNENREFVLPEDSKALHLLQHIRDEAHRFAITAHRKKRQKTRVESTLESIEGVGAKRR 577

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            ALL+ FG +R LA+A   EI +V GI E+ A+ IYE
Sbjct: 578 QALLQRFGGLRELAKAPLEEICKVQGISEQLAKRIYE 614


>UVRC_ECOK1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  336 bits (861), Expect = 4e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGSTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGIGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_TRIEI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 622

 Score =  335 bits (860), Expect = 5e-94
 Identities = 218/637 (34%), Positives = 320/637 (50%), Gaps = 53/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP  PGVY  RD   R++Y+GK+K LR R+ SYF+D      R   MI    ++++ V +
Sbjct: 22  IPQTPGVYLMRDRSDRILYIGKSKKLRNRVRSYFRDGKNHTHRISLMIQQIVEIEFIVTD 81

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR--RRGVRYF 131
           T           +K++ P FNV  +DDK YPYL +T +E++PR+ + R  R  +   RY+
Sbjct: 82  TXXXXXXXXXXXVKQHQPYFNVLLKDDKKYPYLCITWSEDYPRIFITRKRRLGKAKDRYY 141

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R+T+ L+ R+FP+R     +FK      R CL   I +C   C   I  EE
Sbjct: 142 GPYVDTRLLRNTLHLVKRIFPLRQRPKPLFK-----DRSCLNYDIGRCPGVCQELITPEE 196

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  + +       G TG  +                     IRD I+ L ++   Q V L
Sbjct: 197 YHKIVQRVAMIFQGRTGELIDILNTQMEKEAEALNFEKAAFIRDQIRGLNSLNADQKVSL 256

Query: 252 GDS-TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVD-----KVEDVSTGKLVEQFL 305
            D     D IA+A +   A VQ+F +R G++ G  G++ +       E+   G ++++ L
Sbjct: 257 PDDRVSRDAIALAGNHQIACVQLFQIRAGKLVGRLGFIAEIPDLGTAENQELGVILQRVL 316

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
              Y   +  E    IP E++V  E  + + +  WL++++G  V++ VPQR  K  L+E 
Sbjct: 317 ESHYQIVESVE----IPTEIIVQNELPESNFLQNWLTEKKGKKVEIFVPQRQGKAELIEM 372

Query: 366 VLKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           V KNAE  L R    S R ++  T                 P RIE +DIS +QG   VA
Sbjct: 373 VKKNAEYELLRLAKMSDRNNEAMT------DLAEILDLPELPHRIEGYDISHIQGSDAVA 426

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           S VVF DGL  K  YR + I+  E   G   D A+M EVI RRF  Y  E Q   +    
Sbjct: 427 SRVVFIDGLPAKQHYRHYKIKNPEVRSGHSDDFASMAEVIGRRFRDY--EKQTTTD---- 480

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEV 539
                              P+L+++DGG+ Q++A    ++++ I E+V V  LAK+ EE+
Sbjct: 481 ------------------KPDLIMIDGGKGQLSAVVAVMEEMNILEEVRVVSLAKQREEI 522

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           +LPGE +P+       G+ LL+R+RDEAHRFA+S+H            LD+IPGLG  R+
Sbjct: 523 FLPGESEPLRTDAEQPGVQLLRRLRDEAHRFAVSFHXXXXXXXXXXXXLDEIPGLGQHRQ 582

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
             LL HF SV  +  AT  ++AEV G+G + AQ IY+
Sbjct: 583 KLLLGHFHSVDYIRMATVEQLAEVSGVGPKLAQQIYD 619


>UVRC_MESSB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 653

 Score =  335 bits (860), Expect = 5e-94
 Identities = 219/629 (34%), Positives = 325/629 (51%), Gaps = 31/629 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  +  G V+YVGKA++L+ R+++Y Q     + R + MI   A +++ V  
Sbjct: 42  LPNAPGVYRMVNTEGDVLYVGKARSLKKRVTNYAQGRGHSN-RIERMIRETATMEFVVTR 100

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     + IK   PRFNV  RDDKS+PY+ +T N   P +   RGAR R   YFGP
Sbjct: 101 XXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGNHPAPGIFKHRGARSRRGDYFGP 160

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   S  RPCLL  I +CS PC   I VE+Y 
Sbjct: 161 FASAGAVGRTINSLQRAFLLRTCTDSVFE---SRTRPCLLYQIKRCSGPCTREISVEDYA 217

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L ++   F++G +                          RD + AL  V   Q +    
Sbjct: 218 TLVKEAKDFLSGRSSTVKAEIATAMQEASQALDFERAAIYRDRLAALSHVQSHQGINPQG 277

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AI ++  +  +QVF+ R G+  G R +       +  G+++  FLAQ Y   D
Sbjct: 278 LEEADVFAIHQEGGQTCIQVFFFRTGQNWGNRAYFPKADPALGHGEVLGSFLAQFY---D 334

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      PR +L+S    D+D +   LS R G  V V VP RG+K+ L +  L+NA + 
Sbjct: 335 DKPC----PRLILLSHPVEDQDLLAEALSARAGRKVQVSVPARGEKKDLTDHALQNAREA 390

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ +++++              P RIE +D S + G + V +M+V      
Sbjct: 391 LGR----RLAETSSQARLLEGLAETFGLEAAPRRIEVYDNSHIMGTNAVGAMIVAGPEGF 446

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR AE     D   M EV+ RRF R ++E          G  G    AE  
Sbjct: 447 VKNQYRKFNIRSAEITPGDDFGMMREVMQRRFARLIKEQ---------GLPGNGSEAEDS 497

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLE-----EVWLPGEED 546
              F   P+L+++DGG+ Q++A ++ LDDLGI D V   G+AK ++     E +      
Sbjct: 498 DASFPAWPDLILIDGGQGQMSAVRQILDDLGIADLVTAIGVAKGVDRDAGRERFFMEGRP 557

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P  LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL HF
Sbjct: 558 PFTLPPRDPVLYFVQRLRDEAHRFAIGSHRARRKKEMVKNPLDEIAGIGPGRKRALLHHF 617

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           G+ + +++A   ++ EV GI E  A+ IY
Sbjct: 618 GTAKAVSRAAVEDLMEVGGISESIARLIY 646


>UVRC_ECOUT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (860), Expect = 5e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGIGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOSM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (860), Expect = 5e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGIRPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SODGM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 214/637 (33%), Positives = 333/637 (52%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVY   D  G VIYVGKAK+L+ RL+SYF+   A   +T+ ++ +   +D T+ 
Sbjct: 13  TVTSQPGVYSMYDLSGTVIYVGKAKDLKKRLASYFRAQVASR-KTEALVKSIHHIDVTIT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+   RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDAHPRITSHRGAKHAKGDYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+++T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVKETLALLQKLFPIRQCEDSVY---RNRSRPCLQYQIGRCLGPCVAGLVSDEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   E    F++G+  + L                      RD IQA+R V EKQ  V 
Sbjct: 188 YQQQVEYVRLFLSGKDQQVLNQLVERMELASRALNFEDAAHARDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GD  D DVI ++ D   A V V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GDREDLDVIGVSFDAGMACVHVLFIRQGKVLGSRSYFPKVPVGTELAEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                S   +P E+L+     ++  + A LS++ G  + ++   RGD+   ++    NA 
Sbjct: 307 GSQMRS---LPGEILLDFTLPEKTLLAASLSEQAGRKIQIQTQPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ++   T   +                R+ECFDIS   GEHT+AS V+F+  
Sbjct: 364 TALVTKLSQQS---TVHQRLAALAELLGIQAIN--RMECFDISHTMGEHTIASCVIFDGN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
            + ++EYRR++I G    D D AAM +V+ RR+ + LEE +                   
Sbjct: 419 GSVRAEYRRYNIEGITPGD-DYAAMDQVLRRRYGKALEEKKI------------------ 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------LEEVWL 541
                   P++V++DGG+ Q+  A+   + L +      V + G+AK       LE ++L
Sbjct: 460 --------PDVVIIDGGKGQLGMAKAVFEQLEVPWDKSRVVLLGVAKGVDRKAGLETLFL 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
               + + LP  S  L+++Q +RD++H  AI+ HR KRAK    S L+ I G+GP RR +
Sbjct: 512 QPHGEGMALPPDSPALHVIQHIRDDSHNHAITGHRNKRAKVKNTSALELIEGVGPRRRQS 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI    A+ I+  L
Sbjct: 572 LLKYMGGLQPLRNASVEEIAQVPGISGALAEKIFNAL 608


>UVRC_SHISS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_SHIB3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGNDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALISKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOSE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOLU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOLI RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOLC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGVDRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOL6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOHS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECODH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECOBW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO8A RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO81 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO7I RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO5E RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO57 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO55 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO27 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_ECO24 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  335 bits (859), Expect = 7e-94
 Identities = 218/637 (34%), Positives = 332/637 (52%), Gaps = 58/637 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ I+
Sbjct: 569 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 605


>UVRC_LEGPC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  334 bits (857), Expect = 1e-93
 Identities = 219/637 (34%), Positives = 337/637 (52%), Gaps = 53/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PG+YR  DE G V+YVGKA NL+ R++SYF   +    +T+ ++S    ++ +V  
Sbjct: 17  LPGEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNT-GVKTRALVSQIKSIEISVTR 75

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR-RGVRYFG 132
           +E EAL LE + IK   P++NV  RDDKSYPY+ ++ + +FPR+++ R  ++     +FG
Sbjct: 76  SETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPPSGNFFG 135

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+T+  + ++F +R C    FK ARS  RPCL   I +C+APCV  I  E Y
Sbjct: 136 PYPGVAAVRETIVTIQKIFKIRNCRDSYFK-ARS--RPCLQYQIKRCTAPCVHYISPENY 192

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   ED   F+ G+    L                     +RD I+ LR + E+Q VV  
Sbjct: 193 KLSVEDAIRFLQGKCQIILDELAERMKQAVSQLNFEEAAVLRDQIKNLRLIQEQQGVVQL 252

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGW-------VVDKVEDVSTGKLVEQFL 305
              D DVIAI      A +Q   +R G++   + +       V+D  E++    L +Q  
Sbjct: 253 RG-DADVIAIEVRPGFACIQCVTIREGQVLNSQSFFPTVPYAVLD--EELDANSLWQQTF 309

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            + + G    +++  IP  ++ +    +  ++   LS+RRG +  ++V  RG K   M+ 
Sbjct: 310 -EAFVGFYYLDTSERIPDLIITNQSITESRSLEYILSQRRGKSCKIQVNPRGVKSRWMDF 368

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
            + N   ++A + S+ +   T +S+                R+ECFDIS  QGE TVAS 
Sbjct: 369 AVNNLRISVAEYVSKHS---TIKSRYQALKQLLALDKNIE-RMECFDISHTQGESTVASC 424

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+    R SEYRRF+I G    D D AAM + ++RRF R ++                
Sbjct: 425 VVFDTEGPRPSEYRRFNIEGITPGD-DYAAMEQAVTRRFKRLIDAQ-------------- 469

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEV 539
                         P+++++DGG+ QV+  +R +  LG+ED+ + G++K        E++
Sbjct: 470 ------------LLPDVLIIDGGKGQVSIVKRVITSLGVEDITLLGVSKGPSRKAGWEKL 517

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            L  E    +LP  S+ L+LLQ +RDEAHRFAI+ HR+KR K    S L+ I G+G  RR
Sbjct: 518 ILVNENREFVLPEDSKALHLLQHIRDEAHRFAITAHRKKRQKTRVESTLESIEGVGTKRR 577

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            ALL+ FG +R LA+A   EI +V GI E+ A+ IYE
Sbjct: 578 QALLQRFGGLRELAKAPLEEICKVQGINEQLAKRIYE 614


>UVRC_NEIMA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 617

 Score =  334 bits (856), Expect = 1e-93
 Identities = 217/637 (34%), Positives = 335/637 (52%), Gaps = 50/637 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYRF DE G+V+YVGKA NL+ R+S YFQ  +   PR   M+     ++ T+ 
Sbjct: 19  NLPKLPGVYRFFDEGGKVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVHHIETTIT 77

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +E EAL LE ++IK  SP++N+ +RDDKSYPYL ++   ++P++   RG  ++  +YFG
Sbjct: 78  RSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKKPNQYFG 136

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  + A+RD++ +L +VF +RTC   VF+      RPCLL  I +C+APCVG I  E+Y
Sbjct: 137 PYPNSNAVRDSIQILQKVFMLRTCEDSVFEHR---DRPCLLYQIKRCTAPCVGHISEEDY 193

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL- 251
           R        F+ G+T    R                     RD IQAL  +   Q +   
Sbjct: 194 RDSVRQAATFLNGKTDELTRTLQHKMQTAAANLQFEEAARYRDQIQALGIMQSNQFIDSK 253

Query: 252 --GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQFLAQ 307
              +  D D++A+A       V    +RGGR  G++ +  D   D         E F+AQ
Sbjct: 254 NPNNPNDIDLLALAVSDGLVCVHWVSIRGGRHVGDKSFFPDTKNDPEPNGQDYAEAFVAQ 313

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y G    +        ++++  P   DA+   L    G  +       G+++  ++   
Sbjct: 314 HYLGKSKPD--------IIINNFPVP-DALKEALEGEHGKQMQFVTKTIGERKVWLKMAE 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+  +A+ + Q+++    + +                R+ECFDIS  QGE T+AS VV
Sbjct: 365 QNAQMAIAQRRLQQSNQ---QHRIDELAKILGMDSDGLNRLECFDISHTQGEATIASCVV 421

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           +++   + S+YRR++I  A+  D D AAM EV++RR+ + ++E++  GE           
Sbjct: 422 YDEQNIQPSQYRRYNITTAKPGD-DYAAMREVLTRRYGK-MQEAEANGETVKW------- 472

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWL 541
                       P+ V++DGG+ Q+  A    ++LG+  + + G+AK       +EE+ L
Sbjct: 473 ------------PDAVLIDGGKGQIGIAVSVWEELGLH-IPLVGIAKGPERKAGMEELIL 519

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
           P   +   LP  S  L+LLQ VRDE+HRFAI+ HR+KR KA   S L DIPG+G  RR A
Sbjct: 520 PFTGEVFRLPPNSPALHLLQTVRDESHRFAITGHRKKRDKARVTSSLSDIPGVGSKRRQA 579

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LL  FG +R +  A+  ++ +V GI +  A+TIYE L
Sbjct: 580 LLTRFGGLRGVIAASREDLEKVEGISKALAETIYEHL 616


>UVRC_CALS8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 593

 Score =  334 bits (856), Expect = 1e-93
 Identities = 214/637 (33%), Positives = 331/637 (51%), Gaps = 52/637 (8%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL+ K  ++PT PGVY  +DE+G+VIYVGKA NLR R+  YFQ+ S + P+T+ M+    
Sbjct: 3   TLQEKLANLPTTPGVYMMKDENGKVIYVGKAVNLRNRVRQYFQN-SDMTPKTRLMVKKIK 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V +TEVEAL LE + IKEY P++NV  RDDK+Y Y+ +T NE FPR+   R   +
Sbjct: 62  DFEYIVTDTEVEALILECNLIKEYRPKYNVLLRDDKNYQYIKIT-NEMFPRLVTTRKVEK 120

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G +YFGPY   ++++ T++LL  +F +RTC    F      GRPCL  YI++C   C G
Sbjct: 121 DGAKYFGPYVSGYSVKQTIELLKSLFMLRTCKRK-FPDQLGKGRPCLNFYIERCLGVCKG 179

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            I  EEY+ L E     ++G+    +                     I++ I +L  ++ 
Sbjct: 180 DIPEEEYQKLVEKAVKVLSGKGDEIVEELKKKMFEYADNLMFEKAQEIKNKITSLEQIIT 239

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQ V+  D    DVI  AED     + V  +R G++  +  +V+   E+V      E+FL
Sbjct: 240 KQKVIYADDRSEDVINYAEDSSNICIVVLVIRNGKLINKEEFVLKNDEEV-----FERFL 294

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y          ++P+E+++  E  + + +   + K  G    + VP++G+K+ L+E 
Sbjct: 295 EQYYS------DVVSVPKEIILPHEVGNGENIEKMIEKLYGFKAKIVVPKQGEKKQLLEM 348

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             KNAE +L     QR  +    +                 +IE +DIS L G   V ++
Sbjct: 349 AKKNAEISLVN--KQRIENYYIEALLHLKNLLGIEHDIE--KIESYDISNLAGADNVGTL 404

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVFEDG   K  YR+F ++  EG D D+ ++ EV++RRFT  LE+  R+           
Sbjct: 405 VVFEDGKFNKDLYRKFKLKSFEGQD-DIRSVKEVLTRRFTN-LEKHGRL----------- 451

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWL 541
                         P+L+++DGG+ QV AA   L  LG  ++ V G+ K    +  ++  
Sbjct: 452 --------------PDLILIDGGQNQVNAAVEVLRSLGF-NIPVAGMVKDDRHKTRDLIY 496

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
            G+E  + + R S    L+  +++E HRFA+ YHR  R K L  S+LD+I G+G  R+  
Sbjct: 497 KGQE--LNIQRDSLVFKLISTIQEETHRFAVKYHRELRKKHLYESILDEIEGIGEKRKIK 554

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           L + FGS+  L +A+  EI +   I    A  I E++
Sbjct: 555 LFRIFGSIDNLRKASIEEIVKAADIPYDIALKIKEKI 591


>UVRC_ERWT9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  333 bits (854), Expect = 3e-93
 Identities = 220/643 (34%), Positives = 329/643 (51%), Gaps = 64/643 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+       +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRGNLGSR-KTEALVALIEQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYPY+ ++ +   PR+   RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSADHH-PRLASHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLSLLQKIFPVRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVTEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    +    F++G+  + L                     +RD IQA+R V EKQ  V 
Sbjct: 188 YARQIDYVRLFLSGKDDQVLNQLVARMEQASGDLRFEEAGRLRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI ++ D   A + V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 NQGDDMDVIGVSFDSGMACLHVLFIRQGKVLGSRSYFPKVPGGTELAEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P ++L+     ++D + A L+   G  V ++   RGD+   ++    NA 
Sbjct: 307 GSQART---LPSDILIDFTLPEKDLLAASLTALSGRRVSIQSKPRGDRARYLKLARTNAA 363

Query: 372 QTL----ARHKS--QRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             L    A+H +  QR + L    K                R+ECFDIS   GE TVAS 
Sbjct: 364 TALITRLAQHSTIHQRLAALAQTLKLPAIG-----------RMECFDISHTMGEQTVASC 412

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+     +SEYRR++I G    D D AAM +V+ RR+ + +EES+             
Sbjct: 413 VVFDANGPLRSEYRRYNISGITPGD-DYAAMNQVLRRRYGKAIEESKI------------ 459

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAKR------ 535
                         P+++V+DGG+ Q+A A+     L +        + G+AK       
Sbjct: 460 --------------PDVIVIDGGKGQLAQAKEVFAQLDVTWDKSHPLLLGVAKGTDRKAG 505

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LE ++L  E +   LP  S  L+++Q +RD++H  AI+ HR KRAK    S L+ I G+G
Sbjct: 506 LETLFLEPEGEGFSLPPDSPALHVIQHIRDDSHNHAITGHRNKRAKVKNTSALETIEGIG 565

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           P RR  LLK+ G ++ L  A+  EIA VPGI    A+ I+  L
Sbjct: 566 PKRRQMLLKYMGGLQPLINASKEEIARVPGISTALAEKIFYAL 608


>UVRC_DESAH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 606

 Score =  333 bits (854), Expect = 3e-93
 Identities = 218/642 (33%), Positives = 329/642 (51%), Gaps = 51/642 (7%)

Query: 5   PTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTA 64
           P++  +  S P +PGVY  +D+ G +IYVGKA NL+ RL+SYF   +    +T  ++   
Sbjct: 3   PSVLERYQSAPQNPGVYLMKDKRGTIIYVGKALNLKKRLASYFARETGHDMKTGVLLKKV 62

Query: 65  ADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR 124
            D D  V  TE EAL LE + IK++SPR+NV  +D KSYP L +  ++ FP ++V+R   
Sbjct: 63  VDFDLIVTATEHEALILESTLIKKHSPRYNVILKDGKSYPCLRIDTSKPFPALEVVRKIG 122

Query: 125 RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
                YFGPYS   ++R T+  + ++F +R C    F    +  RPCL   I+ C   C 
Sbjct: 123 DDNAVYFGPYSSVQSVRSTIKQVNKIFKLRKCRDVQF---ANRTRPCLNYQINACLGACC 179

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
            R+  +EY  +  D   F+ G     +                     IRD I A++T +
Sbjct: 180 NRVSRQEYARVVGDVILFLKGRAPDLINRLKFEMQTEADLEHFERAAQIRDTILAIQTTL 239

Query: 245 EKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQF 304
           E+Q            IA A +  +A V + +VR G + G R +  D        ++++ F
Sbjct: 240 ERQXXXXXXXXXXXXIACAINGEKAVVTILFVRSGNLVGSRNYPFDTGLS-GVPEILDAF 298

Query: 305 LAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALME 364
           +   Y      E +  IP ++L++ +  +   V   L ++RG  V + VP+RGDKR L+E
Sbjct: 299 VRHYY------ERSLFIPGQILIAEKIENHGLVQDLLIEKRGKRVSLVVPERGDKRRLVE 352

Query: 365 TVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
             L NA++ L ++ S +     T +               P RIECFD S + G   V+S
Sbjct: 353 MALVNAQKELEKNLSIQNEAWETLT----ALQTILGMSVYPRRIECFDNSNMAGTDPVSS 408

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           MVVF DGLA KSEYR+F IR A+  D D A M EV++RR                L  + 
Sbjct: 409 MVVFVDGLACKSEYRKFIIRDAKEND-DYACMTEVLTRR----------------LSSTE 451

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKR-------L 536
           AP             P+L+VVDGG+ Q++ A   L  LG+E+   V GLAK+        
Sbjct: 452 APL------------PDLLVVDGGKGQLSMAVAVLKSLGLENRFQVAGLAKKDAKLGEVY 499

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           ++++LPG  +P+      + LYL+QR+RDEAHRFAI++ R++R+K    SVLD +PG+G 
Sbjct: 500 DKIYLPGRANPVNTRGALKALYLVQRLRDEAHRFAITFQRKRRSKRAGTSVLDAVPGIGK 559

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            R+  L+  +  + R+ QAT  E+A +PG+    AQ +   L
Sbjct: 560 KRKQVLMTTYKGISRMGQATVEELASLPGMTLAAAQQVKSAL 601


>UVRC_KLEP3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  333 bits (853), Expect = 3e-93
 Identities = 221/637 (34%), Positives = 329/637 (51%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++  A +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVALIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FPVR C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPVRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F+AG+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLAGKDDQVLTQLIARMEKASQSLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A +   A V V ++R G++ G R +          G++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFEAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     D+  +   LS+  G  ++V+   RGD RA          
Sbjct: 307 GSQMRT---LPGEILLDFSLGDKTLLAESLSELAGRRINVQTKPRGD-RARYXXXXXXXX 362

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                    + S +  R +                R+ECFDIS   GE TVAS VVF+  
Sbjct: 363 XXXXXXXXXQQSTIHQRLQALATVLELPAVK----RMECFDISHTMGEQTVASCVVFDSN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              ++EYRR++I G    D D AAM +V+ RR+ + ++E++                   
Sbjct: 419 GPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDENK------------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++++DGG+ Q+A A+    +L +        + G+AK       LE ++ 
Sbjct: 459 -------IPDVILIDGGKGQLAQAKAVFAELDVPWDKHHPLLLGVAKGSDRKAGLETLFF 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E +   LP  S  L+++Q +RDE+H  AIS HR+KRAK  + S L+ I G+GP RR  
Sbjct: 512 EPEGEGFSLPPDSPALHVIQHIRDESHDHAISGHRKKRAKVKSTSSLETIEGVGPKRRQM 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L QA+  EIA+VPGI    A+ I+  L
Sbjct: 572 LLKYMGGLQGLQQASVEEIAKVPGISHGLAEKIFYSL 608


>UVRC_LEPIC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  332 bits (852), Expect = 4e-93
 Identities = 211/638 (33%), Positives = 317/638 (49%), Gaps = 52/638 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP--RTQTMISTAADVDWT 70
           ++   PG Y ++ + G V+YVGKAKNL  R+ SY ++    HP  +T+ +     D+DW 
Sbjct: 16  NLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKEN---HPDVKTKVLQREIFDLDWI 72

Query: 71  VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRY 130
              TE EAL LE + IK+++PRFNVR +DDK YPY+ V+L+E +P V V R  +  G RY
Sbjct: 73  ATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRY 132

Query: 131 FGPYSYAWAIRDTVDLLLRVFPVR-TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGV 189
           FGPYS   + R+T+D++LR+FPVR T                 +G   +C  PC G I V
Sbjct: 133 FGPYSDVKSTRETLDIILRIFPVRKTRQVXXXXXXXXXXXNFDMG---RCLGPCQGNIPV 189

Query: 190 EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV 249
           E+Y+ + +    F+ G     +                      RD +Q ++   EKQ V
Sbjct: 190 EDYKVIIDQVIQFLEGRKESLVSDLNIKMSNASERLDFEKAARYRDMLQRIQNFREKQTV 249

Query: 250 VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
           V  +  D DVI  A  Q E  V +  +RGGR+  ++ + +  V D    +++  F    Y
Sbjct: 250 VSLEGGDEDVIGFARKQDEGQVILLEIRGGRLETKKSFPIQGVLDAENSEILGAFFRDYY 309

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
             A        IP ++     P     V+  L ++ G    ++ P+ GDKR+L++   KN
Sbjct: 310 LNASLVPPCIFIPADIQDEVIP-----VIDVLQEKTGFRPKIKFPKGGDKRSLLKIAEKN 364

Query: 370 AE-----QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
           AE     + LA H   + + L    +              P  IEC+DIS  QG   VAS
Sbjct: 365 AELGLSERLLATHYRDQTASLKEIQEMFSLERL-------PHIIECYDISHFQGSQPVAS 417

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
            V+F +G   K  YR+++IRG EG + D   ++EVISRR  R + E              
Sbjct: 418 GVMFVEGKPFKQGYRKYNIRGYEGIN-DPGMIHEVISRRLQRIINEE------------- 463

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGE 544
                          P+L+V+DGG  Q+              + + GLAK+ EE++ PGE
Sbjct: 464 ------------GVFPDLIVIDGGLTQLTKXXXXXXXXXXXXIPMVGLAKKREEIFFPGE 511

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            +P I    S G+ LL+ +RDEAHRF +S+HR +R K    S++ ++P +G  R   LL+
Sbjct: 512 NEPFIFDMNSPGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQEVPDIGFKRSKLLLQ 571

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           HF   +++ +AT  E+  VPGIGE  A+ I ++L   E
Sbjct: 572 HFSGEKKIEEATKEELLLVPGIGENLAEKILKQLQKKE 609


>UVRC_ACIBY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  332 bits (852), Expect = 4e-93
 Identities = 220/645 (34%), Positives = 339/645 (52%), Gaps = 63/645 (9%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           RP +     ++   PGVY+   + G ++YVGKAKNL+ R+SSYF   +  HP+TQ +++ 
Sbjct: 6   RPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVAR 64

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
             D++  V  +E EAL LE + IK++ P +N+  RDDKSY Y+ V+ ++ +PR+   RG 
Sbjct: 65  IYDIETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGK 124

Query: 124 RRRGV-RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
            +  + ++FGPY  A++ RDT+ +L ++F VR C    F + +   RPCL   I +CSAP
Sbjct: 125 GKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQCENSYFSQRK---RPCLQYQIKRCSAP 181

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           CVG +  E+Y+    +   F+ G+T    +                     RD +  LR 
Sbjct: 182 CVGLVSPEDYKEDVNNSIRFLQGDTKELNQELIAKMEQAAADLEFEKAVFYRDRLSLLRE 241

Query: 243 VMEKQAV--VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
           V  +QAV  V G++   D++AIA       VQ+ +VR GR+ G + +  D + D   G++
Sbjct: 242 VQAQQAVFKVKGEA---DILAIAYQAGVTCVQIMHVRNGRMLGGKSYFPDMLGD-DLGQM 297

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
           +  F+A  Y    DE     +P E++V+    DR  +   L+++ G  V ++   R  + 
Sbjct: 298 LSDFMANFYFQVADE-----VPSELIVNTALPDRKELEEALAQQFGKKVQIKSSVRETRA 352

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
             +E    N +  +   K Q ++ L    +                RIECFDIS   GE 
Sbjct: 353 EWLELAEMNVQHAI---KGQLSNHLELNERFHQLEQVVGRPID---RIECFDISHTMGEA 406

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            +AS VVF+ G ARK +YR+F+I+     D D AAM + ++RR+ +              
Sbjct: 407 PIASCVVFDQGGARKRDYRQFAIQDITAGD-DYAAMRQALTRRYKK-------------- 451

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540
                           A  P+L+++DGG+ Q+  A   + +LG+E   V G++K   E  
Sbjct: 452 ----------------AMLPDLLLIDGGKGQLHMAMEVMQELGLEAFMV-GVSKG--EGR 492

Query: 541 LPGEED-------PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
            PG E         I LP  S+ L+L+Q+VRDEAHRFAI+ HR KR K  + SVL+ IPG
Sbjct: 493 KPGLETLHFTDGTKIQLPEDSKALHLIQQVRDEAHRFAITKHRAKRDKRRSTSVLEAIPG 552

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LGP RR  LL HFG ++ + +A+  E+  VPG+GE  A+TIY+ L
Sbjct: 553 LGPKRRRDLLTHFGGIQGVLKASEKELTVVPGLGEVMARTIYKIL 597


>UVRC_SYNP6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 643

 Score =  332 bits (851), Expect = 6e-93
 Identities = 235/630 (37%), Positives = 333/630 (52%), Gaps = 26/630 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVY  RD   R++Y+GK+K LR+R+ SYF+D   L+PR   M+    +++  V +
Sbjct: 23  LPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNPRINLMVRQVCEIEIIVTD 82

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV---RY 130
           T           IK++ P FNV  +DDK YPYL +T ++++PR+ + R  RR G    RY
Sbjct: 83  TXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSDDYPRIFITR-KRRLGNSRDRY 141

Query: 131 FGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVE 190
           +GPY     +R T+ L+ R+FP+R     +FK      R CL   I +C   C   I  +
Sbjct: 142 YGPYVDTRLLRHTLFLVKRLFPLRQRPQPLFK-----DRTCLNYDIGRCPGVCQSLIRPD 196

Query: 191 EYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV 250
           +YR   +       G +   +                     IRD I+ L  +  +Q V 
Sbjct: 197 DYRKTLQKVAMIFQGRSSELVELLEAQMLQAAENLEFEKAAKIRDQIRGLEGLGAEQKVQ 256

Query: 251 LGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
           L D     D IA+A D+  A +Q+F +R G++ G  G+V              + L + Y
Sbjct: 257 LPDDRISRDAIALAMDEQHACIQLFQIRAGKLVGRLGFVXXXXXXXXXXXXX-RVLEEHY 315

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
              D  E    IP+EVLV  +  + + +  WLS+RRG  V++  PQR  K  L+  V +N
Sbjct: 316 ASVDSVE----IPQEVLVQHDLPEAELLEVWLSERRGRKVEILSPQRQIKADLIAMVERN 371

Query: 370 AEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           AE  LAR  +Q++++  T S                     +DIS +QG   VAS VVF 
Sbjct: 372 AEYELAR--TQQSAERHTASXXXXXXXXXXXXXXXXXX--GYDISHIQGSDAVASQVVFI 427

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YRR+ IR  E   G   D A++ EV+              GE  +L  S   
Sbjct: 428 DGLPAKQHYRRYKIRNPEVRAGHSDDFASLAEVL-HXXXXXXXXXXXXGE--SLAPSEQR 484

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVA-VCGLAKRLEEVWLPGEE 545
           QG+  +    A  P+LV++DGG+ Q++A               +C LAK+ EE++LPG  
Sbjct: 485 QGSLLRPDDLADFPDLVMIDGGKGQLSAXXXXXXXXXXXXXXKLCSLAKKREEIFLPGAS 544

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           DP+       G+ LL+R+RDEAHRFA+S+HR+KR + +  S LDDIPGLG  R+  LL H
Sbjct: 545 DPLPTDAEQPGVQLLRRLRDEAHRFAVSFHRQKRTERMRRSRLDDIPGLGHKRQKELLAH 604

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           F S+  L  AT  +IAEVPGIG   AQ I+
Sbjct: 605 FRSIDYLRLATPEQIAEVPGIGAVLAQQIW 634


>UVRC_SYNE7 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 643

 Score =  332 bits (851), Expect = 6e-93
 Identities = 235/630 (37%), Positives = 333/630 (52%), Gaps = 26/630 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVY  RD   R++Y+GK+K LR+R+ SYF+D   L+PR   M+    +++  V +
Sbjct: 23  LPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNPRINLMVRQVCEIEIIVTD 82

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV---RY 130
           T           IK++ P FNV  +DDK YPYL +T ++++PR+ + R  RR G    RY
Sbjct: 83  TXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCITWSDDYPRIFITR-KRRLGNSRDRY 141

Query: 131 FGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVE 190
           +GPY     +R T+ L+ R+FP+R     +FK      R CL   I +C   C   I  +
Sbjct: 142 YGPYVDTRLLRHTLFLVKRLFPLRQRPQPLFK-----DRTCLNYDIGRCPGVCQSLIRPD 196

Query: 191 EYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV 250
           +YR   +       G +   +                     IRD I+ L  +  +Q V 
Sbjct: 197 DYRKTLQKVAMIFQGRSSELVELLEAQMLQAAENLEFEKAAKIRDQIRGLEGLGAEQKVQ 256

Query: 251 LGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
           L D     D IA+A D+  A +Q+F +R G++ G  G+V              + L + Y
Sbjct: 257 LPDDRISRDAIALAMDEQHACIQLFQIRAGKLVGRLGFVXXXXXXXXXXXXX-RVLEEHY 315

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
              D  E    IP+EVLV  +  + + +  WLS+RRG  V++  PQR  K  L+  V +N
Sbjct: 316 ASVDSVE----IPQEVLVQHDLPEAELLEVWLSERRGRKVEILSPQRQIKADLIAMVERN 371

Query: 370 AEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           AE  LAR  +Q++++  T S                     +DIS +QG   VAS VVF 
Sbjct: 372 AEYELAR--TQQSAERHTASXXXXXXXXXXXXXXXXXX--GYDISHIQGSDAVASQVVFI 427

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YRR+ IR  E   G   D A++ EV+              GE  +L  S   
Sbjct: 428 DGLPAKQHYRRYKIRNPEVRAGHSDDFASLAEVL-HXXXXXXXXXXXXGE--SLAPSEQR 484

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVA-VCGLAKRLEEVWLPGEE 545
           QG+  +    A  P+LV++DGG+ Q++A               +C LAK+ EE++LPG  
Sbjct: 485 QGSLLRPDDLADFPDLVMIDGGKGQLSAXXXXXXXXXXXXXXKLCSLAKKREEIFLPGAS 544

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           DP+       G+ LL+R+RDEAHRFA+S+HR+KR + +  S LDDIPGLG  R+  LL H
Sbjct: 545 DPLPTDAEQPGVQLLRRLRDEAHRFAVSFHRQKRTERMRRSRLDDIPGLGHKRQKELLAH 604

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           F S+  L  AT  +IAEVPGIG   AQ I+
Sbjct: 605 FRSIDYLRLATPEQIAEVPGIGAVLAQQIW 634


>UVRC_SHEHH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  332 bits (851), Expect = 6e-93
 Identities = 214/635 (33%), Positives = 331/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D    VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S  A++D TV 
Sbjct: 13  TVTSSPGVYRMYDAKAVVIYVGKAKDLKKRLSSYFRK-NLTNVKTQALVSHIANIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ N + PR+   RG +R    YFG
Sbjct: 72  HSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHKHPRLAYHRGPKRDKGLYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ LL ++FP+R C    +K   S  RPCL   I +CSAPCVG++ +E+Y
Sbjct: 131 PYPNGGAVRESLHLLQKIFPIRQCDDLYYK---SRSRPCLQYQIGRCSAPCVGKVSLEDY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +        F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 QEQVRLATLFLKGKDHQVMSVLVGKMEQAASDMRYEQAALYRDQITALRRVSEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
            S D DVI        A   + ++R G+I G R +      +    +++  F+ Q Y  +
Sbjct: 247 ASGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPKVPVNTEVSEVLRSFMLQFYLNS 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D +  T   P+E+L+S    ++D +   +   +   V+++   RG++ + +   L NA  
Sbjct: 307 DSQRLT---PKEILISEPFEEQDELAKAIQAAQNKKVEIKTQVRGERASFLRLALTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +    + R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AV----NTRLSHKNTIEQRFLLLEEAIESTNKIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G    D D AAM + I+RRF             D +  SG        
Sbjct: 420 PSKADYRRYNITGITPGD-DYAAMKQAITRRF-------------DKISSSGKI------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDD--LGIEDV-AVCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  + +++   + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGIGQLRIAQKVVDEKFVALDNAPTLIGVAKGEGRKPGLETLIYGE 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E+   LP  S  L+L+Q +RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 513 NEESFTLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ++ G ++ +  A+ +E+ +VPGI    AQTI++ L
Sbjct: 573 QYLGGLQEVKGASVSELVKVPGISLEMAQTIHDAL 607


>UVRC_PHOLL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  332 bits (851), Expect = 6e-93
 Identities = 218/643 (33%), Positives = 331/643 (51%), Gaps = 64/643 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+       +T++++     +D TV 
Sbjct: 13  TVTSQPGVYRMYDTSGTVIYVGKAKDLKKRLASYFRA-QVTSRKTESLVKNIVQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYPY+ ++  ++ PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSA-DKHPRLAMYRGAKHFKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+    A+R+++ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  +E
Sbjct: 131 PFPNTHAVRESLILLQKLFPIRQCEDSVY---RNRSRPCLQYQIGRCLGPCVKGLVSEDE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F++G+  + L                      RD IQA+R V E+Q  V 
Sbjct: 188 YQQQVDYIRLFLSGKDQQVLTRLIERMEQASQQLKFEDAARYRDQIQAVRQVTERQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           G   D DVI++A D   A + V ++R G++ G R +        +  ++V+ FL Q Y  
Sbjct: 247 GTDDDLDVISVAFDAGMACLHVLFIRQGKVLGSRSYYPKIPTGTTLDEIVQTFLGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     ++D +   LS+  G  + ++   RGDK   ++    NA 
Sbjct: 307 GSQNRT---LPSEILLDFTLPEKDILSDSLSEISGRKIHIQTRPRGDKARYLKLARTNAT 363

Query: 372 QTLARHKS------QRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             L+   S      QR   LT   K                R+ECFDIS   GE TVAS 
Sbjct: 364 IALSTRLSQQSTIHQRLDSLTKLVKLAKIQ-----------RMECFDISHTMGEQTVASC 412

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF+     +SEYRR++I G    D D AAM +V+ RR+ + L+ES+             
Sbjct: 413 VVFDSNGPLRSEYRRYNISGITPGD-DYAAMNQVLRRRYGKALDESK------------- 458

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAK------R 535
                         P+++ +DGG+ Q+A A      L +E       + G+AK       
Sbjct: 459 -------------IPDIIFIDGGKGQLAQAIDVFQSLDVEWDKTRPQLIGVAKGSDRKAG 505

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LE ++   E+  I LP  S  L+++Q +RDE+H  AI+ HR++R+K    S L+ I G+G
Sbjct: 506 LETLFFATEDKSIALPPDSPALHVIQHIRDESHNHAITGHRQRRSKVRNTSTLESIEGVG 565

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           P RR  LLK+ G ++ L  A+  EIA+VP I    A+ IY  L
Sbjct: 566 PKRRQMLLKYMGGLQPLRNASVEEIAKVPTISYALAEKIYNAL 608


>UVRC_MYXXD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 646

 Score =  332 bits (851), Expect = 6e-93
 Identities = 213/640 (33%), Positives = 318/640 (49%), Gaps = 57/640 (8%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L  K  ++PT+PGVY  +D  G+VIYVGKA NLR+R+ SYF            +     D
Sbjct: 5   LLEKLDALPTEPGVYLMKDRRGQVIYVGKAINLRSRVRSYFNRTGDTRVFVSLLDQLLGD 64

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           ++  +V+               + PRFNV  +DDK +  L +   + +PR++V+R   R 
Sbjct: 65  LETVLVSNXXXXXXXXXXXXXXHRPRFNVLLKDDKQFISLRLDRTQPYPRLEVVRKYERD 124

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G RYFGPYS A AIR+T+ ++ R F +RTC+  V    +   RPCLL  I +C APCV  
Sbjct: 125 GARYFGPYSSAGAIRETLRVVNRFFRLRTCTDHVLANRK---RPCLLHQIGRCPAPCVYP 181

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+Y    ++   F+ G+ G  +                     IRD + A+   +E+
Sbjct: 182 VPQEDYHRSVDEVVMFLEGKAGELVEGLRLRMKRAAQELKFEEAARIRDQLNAIERSLER 241

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q V   D  D DV A   +       V +VR GR+ G + +     ++    +L+  F+ 
Sbjct: 242 QKVATTDFKDQDVFAFHREGDRILFYVLWVRQGRLNGGQAFPFGS-QEFPDEELIASFVN 300

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
             Y     ++ +                  + A L++R+G  V V VP+RG+K  L++  
Sbjct: 301 LYY-----DQGSFXXXXXXXXXXXXDGTGGLEALLTERKGERVRVLVPKRGEKLDLVKMA 355

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            KNAEQ     +  +    T  S+              P R+ECFDIS  QG   VAS V
Sbjct: 356 AKNAEQAFVERRRTKDETDTVLSRLQQRLGLRNF----PCRMECFDISHFQGSAIVASQV 411

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
              DG A KS YR++ I+  E  D D A+MYEVISRR  + LE++               
Sbjct: 412 AVTDGDADKSRYRKYKIKTLEKQD-DFASMYEVISRRLKKGLEDNDL------------- 457

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL---------- 536
                        P+L+V+DGG+ Q+A+A  A+ D+G+E V V GLAK            
Sbjct: 458 -------------PDLLVIDGGKGQLASAHAAMKDVGVESVDVVGLAKSRDLEVFDRDAE 504

Query: 537 -----EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDI 591
                E +++ G +DPI+L + S  +++L R+RDEAHRFAI++ ++   K+   S L+DI
Sbjct: 505 SARSPERIFVVGRKDPIVLSQNSAEMFMLTRMRDEAHRFAITFQKQVLRKSRVRSALEDI 564

Query: 592 PGLGPVRRAALLKHFGSVRRLAQATAAEIAEV--PGIGER 629
           PG+G  RR  LL+HFGS++R+  A+  E+AEV  P + ER
Sbjct: 565 PGVGETRRKQLLRHFGSLKRVGDASIEELAEVVGPAMAER 604


>UVRC_NITEC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 604

 Score =  332 bits (850), Expect = 7e-93
 Identities = 213/634 (33%), Positives = 318/634 (50%), Gaps = 52/634 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P+ PGVYR  +  G VIYVGKA +LR R+SSYFQ  S L PR Q M+S    ++ TV 
Sbjct: 14  TLPSQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQK-SNLSPRIQLMVSQITGIETTVT 72

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +           IK  +PR+N+ +RDDKSYPYL +T N  FPR+   RGA     +YFG
Sbjct: 73  RSXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYLLLT-NHAFPRLAFYRGALDNRHQYFG 131

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P+  A  ++ ++ LL +VF +RTC   VF       RPCLL  I +CSAPCV  I  E Y
Sbjct: 132 PFPNAGVVKSSIQLLQKVFRLRTCENSVFNNRT---RPCLLHQIKRCSAPCVNLITPEAY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R        F+ G+    L+                     RD +QALR + EKQ V   
Sbjct: 189 REDVNSAALFLQGKQDEVLKTIEQKMFEASDRQAYEQAVLFRDQMQALRMIQEKQFVDSS 248

Query: 253 DSTDCDVIAIAE--DQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            + D DVIA     D+   AV +  +R GR  G++ +      + S   ++E F++Q Y 
Sbjct: 249 RALDADVIACTTGTDKHTVAVNLVMIRSGRHLGDKTFFPQNTHEDSISTVLEAFVSQHY- 307

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                    ++P  +++  +      +   LS++ G  V + +   G++R  ++   +NA
Sbjct: 308 ------LNRSVP-PLIILGKKIRVTLLQKLLSEQAGHKVTLTINPIGERRKWLDMATENA 360

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
           +  L + + Q+AS      +                RIECFDIS   GE T+AS VV++ 
Sbjct: 361 QLALRQKQIQQASQ-----EDRLQALQEVLNLPGLARIECFDISHTMGEATMASCVVYDH 415

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
              R  EYRR++I G    D D AAM +V+ RR+ +   E  ++                
Sbjct: 416 YAMRNGEYRRYNITGITPGD-DYAAMRDVLQRRYAKIAMEEGKL---------------- 458

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGE 544
                    P+L+++DGG+ Q+  A   + +LG+ D+ + G+AK       LE++ LP +
Sbjct: 459 ---------PDLILIDGGKGQIGVASEVMIELGLNDIPLVGVAKGEARKPGLEQLILPWQ 509

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
           E+ + LP     L+L+Q++RDEAHRFAI  HR KRAK    S L+ I G+G  RR  LL 
Sbjct: 510 EETLHLPNDHPALHLIQQIRDEAHRFAIQGHRAKRAKTRKTSSLEQIAGIGSKRRQNLLT 569

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            FG ++ +  A+  E+ +  G+    A+ IY  L
Sbjct: 570 RFGGLKGVKNASIEELQQTEGVSRALAEKIYREL 603


>UVRC_IDILO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  332 bits (850), Expect = 7e-93
 Identities = 213/624 (34%), Positives = 321/624 (51%), Gaps = 46/624 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  DE G VIYVGKAK+LR R+SSYF++      +TQ ++   A +D TV NTE E
Sbjct: 23  PGVYRMYDESGDVIYVGKAKDLRKRVSSYFRE-KVDRMKTQVLVKQIASMDVTVTNTEAE 81

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
           AL LE S+IK+Y PR+NV  RDDKSYPY+ +T + + P++   RGARR    YFGP+   
Sbjct: 82  ALILENSFIKKYRPRYNVLLRDDKSYPYIILT-SHQHPKLGFHRGARRAKGDYFGPFPNG 140

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            A+R++++LL ++FP+R C    + RAR+  RPCL   + +C APCV     +EY     
Sbjct: 141 SAVRESLNLLQKLFPIRQCDDSYY-RART--RPCLQYQLKRCLAPCVNVCTDDEYNEQVA 197

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G+  + +                      RD I ALR   E+ +V  G   + 
Sbjct: 198 LAKQFLQGKNQQVIDELMNKMEQASTDLDFERAARFRDQIAALRKTQERNSVT-GSQQEL 256

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DVI +A       VQ+ ++R   ++G R +      D    +++  FL Q Y     + +
Sbjct: 257 DVIGLARGNGMTTVQMLFIRDNHLQGSRSYFPKVPTDTPDDEVLRAFLLQFYLS---DTA 313

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              IPREV++  +    + +   +S      V ++   RGDKR       KNA   L   
Sbjct: 314 GRKIPREVVLPVDVQPDNVLAEVMSDALSQPVKLQSSVRGDKRQYQSLAQKNAVNALESR 373

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            +Q++    T ++                R+ECFDIS   G+ TVAS VVF+    +KS+
Sbjct: 374 LNQQS----TMNRRTQALQQVLEFGVPIQRMECFDISHTMGQQTVASCVVFDQNGPKKSD 429

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM + +++R+    E+                           
Sbjct: 430 YRRYNITGITPGD-DYAAMSKALAKRYDNAKEQGNI------------------------ 464

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P+++ +DGG+ Q+A A+   +D G E   + G+AK       LE + + G  + I L 
Sbjct: 465 --PDILFIDGGKGQLAQAENYFNDWGKEAPVLIGVAKGESRKPGLETLIMAGSHETIPLS 522

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
           + +  L+L+Q +RDE+HRFAI+ HR+KRAK    S L+ I G+G  RR A+LK+ G ++ 
Sbjct: 523 KDASALHLIQHIRDESHRFAITGHRQKRAKVKKTSTLEQIDGVGAKRRQAILKNLGGLQE 582

Query: 612 LAQATAAEIAEVPGIGERTAQTIY 635
           +  A+  ++A VPGI    A+ IY
Sbjct: 583 VKNASIDKLASVPGISRSLAEKIY 606


>UVRC_NITMU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 606

 Score =  331 bits (848), Expect = 1e-92
 Identities = 236/646 (36%), Positives = 339/646 (52%), Gaps = 77/646 (11%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P+ PGVYR  +  G+VIYVGKA +L+ R+SSYFQ  + L PRTQ M+S  A ++ TV  
Sbjct: 16  LPSQPGVYRMMNSAGQVIYVGKAIDLKKRVSSYFQK-NGLAPRTQLMVSQIAGIETTVTR 74

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK  +PR+N+ +RDDKSYPY+ ++    FPR+   RG   +   YFGP
Sbjct: 75  SXXXXXXXXXXXIKSLNPRYNILFRDDKSYPYVILS-GHRFPRLGFHRGPLDKKHHYFGP 133

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  A  +R+++ LL +VF +RTC   VF    +  RPCLL  I +CS PCV  +  E Y 
Sbjct: 134 FPNAGMVRESIQLLQKVFRIRTCEDSVFS---NRTRPCLLYQIKRCSGPCVDLVSEEVYA 190

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
             A D   F+ G+    L+                     RD IQ+LR + E+Q V  G 
Sbjct: 191 EDARDAELFLQGKQTEVLKSITRKMHXXXXXXXXXXXXLFRDQIQSLRKICERQFVDSGR 250

Query: 254 STDCDVIA-IAEDQ--LEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
           + D D++A +AE+       V +  VRGGR  G++ +     E      + E FLAQ Y 
Sbjct: 251 ALDADIVACVAENNGGGRVCVNLAMVRGGRHLGDKSFFPQNAEGYDLATVAEAFLAQHY- 309

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                    +IP ++++  E   R+++ A L+++ G  V + V   G +R  +E   +NA
Sbjct: 310 ------LNRSIP-DLIIVGERVPRESLQALLTQQAGHKVIINVNPIGSRRVWLEMATENA 362

Query: 371 ----EQTLAR--------HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQG 418
               EQ L R               D+T  S                 RIECFDIS   G
Sbjct: 363 ALALEQMLGRXXXXXXXXXXXXXXXDMTGLS-----------------RIECFDISHTMG 405

Query: 419 EHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELD 478
           E T+AS VV+++   R SEYRR++I      D D AAM +V+SRR+ +  E         
Sbjct: 406 EATIASCVVYDNFGMRNSEYRRYNITDITPGD-DYAAMRDVLSRRYHKIAE--------- 455

Query: 479 TLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK---- 534
             GE                 P+L+++DGGR Q+ AA   + +LG+ D  + G+AK    
Sbjct: 456 --GEGNL--------------PDLILIDGGRGQINAALEVMVELGLNDANLVGVAKGEER 499

Query: 535 --RLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIP 592
              LE++  PG + P+ L +   GL+L+Q++RDEAHRFAI  HR K  KA  +S L+ I 
Sbjct: 500 KPGLEQLIFPGVKKPLQLSKDHPGLHLIQQIRDEAHRFAIYGHRAKLGKARVSSSLEQIA 559

Query: 593 GLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           G+G  RR +LL  FG ++ +  A+  E+ +  GI    A+ IY  L
Sbjct: 560 GIGAKRRQSLLARFGGLKGVRTASIEELQQADGISRALAEKIYREL 605


>UVRC_LEPIN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  331 bits (848), Expect = 1e-92
 Identities = 210/638 (32%), Positives = 317/638 (49%), Gaps = 52/638 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP--RTQTMISTAADVDWT 70
           ++   PG Y ++ + G V+YVGKAKNL  R+ SY ++    HP  +T+ +     D+DW 
Sbjct: 16  NLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKEN---HPDVKTKVLQREIFDLDWI 72

Query: 71  VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRY 130
              TE EAL LE + IK+++PRFNVR +DDK YPY+ V+L+E +P V V R  +  G RY
Sbjct: 73  ATGTEKEALILEATLIKKHNPRFNVRLKDDKKYPYICVSLSEPYPMVYVTRKLKDNGDRY 132

Query: 131 FGPYSYAWAIRDTVDLLLRVFPVR-TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGV 189
           FGPYS   + R+T+D++LR+FPVR T                 +G   +C  PC G I V
Sbjct: 133 FGPYSDVKSTRETLDIILRIFPVRKTRQVXXXXXXXXXXXNFDMG---RCLGPCQGNIPV 189

Query: 190 EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV 249
           E+Y+ + +    F+ G     +                      RD +Q ++   EKQ V
Sbjct: 190 EDYKVIIDQVIQFLEGRKESLVSDLNIKMSNASERLDFEKAARYRDMLQRIQNFREKQTV 249

Query: 250 VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
           V  +  D DVI  A  Q E  V +  +RGGR+  ++ + +  V D    +++  F    Y
Sbjct: 250 VSLEGGDEDVIGFARKQDEGQVILLEIRGGRLETKKSFPIQGVLDAENSEILGAFFRDYY 309

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
             A        IP ++     P     V+  L ++ G    ++ P+ GDKR+L++   KN
Sbjct: 310 LNASLVPPCIFIPADIQDEVIP-----VIDVLQEKTGFRPKIKFPKGGDKRSLLKIAEKN 364

Query: 370 AE-----QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
           AE     + LA H   + + L    +              P  IEC+DIS  QG   VAS
Sbjct: 365 AELGLSERLLATHYRDQTASLKEIQEMFSLERL-------PHIIECYDISHFQGSQPVAS 417

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
            V+F +G   K  YR+++I+G EG + D   ++EVISRR  R + E              
Sbjct: 418 GVMFVEGKPFKQGYRKYNIQGYEGIN-DPGMIHEVISRRLQRIINEE------------- 463

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGE 544
                          P+L+V+DGG  Q+              + + GLAK+ EE++ PGE
Sbjct: 464 ------------GVFPDLIVIDGGLTQLTKXXXXXXXXXXXXIPMVGLAKKREEIFFPGE 511

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            +P I    S G+ LL+ +RDEAHRF +S+HR +R K    S++ ++P +G  R   LL+
Sbjct: 512 NEPFIFDMNSPGMKLLRHLRDEAHRFGVSHHRSRRNKETMRSLIQEVPDIGFKRSKLLLQ 571

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           HF   +++ +AT  E+  VPGIGE  A+ I ++L   E
Sbjct: 572 HFSGEKKIEEATKEELLLVPGIGENLAEKILKQLQKKE 609


>UVRC_ACIBS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  331 bits (848), Expect = 1e-92
 Identities = 219/645 (33%), Positives = 338/645 (52%), Gaps = 63/645 (9%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           RP +     ++   PGVY+   + G ++YVGKAKNL+ R+SSYF   +  HP+TQ +++ 
Sbjct: 6   RPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVAR 64

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
             D++  V  +E EAL LE + IK++ P +N+  RDDKSY Y+ V+ ++ +PR+   RG 
Sbjct: 65  IYDIETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGK 124

Query: 124 RRRGV-RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
            +  + ++FGPY  A++ RDT+ +L ++F VR C    F + +   RPCL   I +CSAP
Sbjct: 125 GKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQCENSYFSQRK---RPCLQYQIKRCSAP 181

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           CVG +  E+Y+    +   F+ G+T    +                     RD +  LR 
Sbjct: 182 CVGLVSPEDYKEDVNNSIRFLQGDTKELNQELIAKMEQAAADLEFEKAVFYRDRLSLLRE 241

Query: 243 VMEKQAV--VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
           V  +QAV  V G++   D++AI        VQ+ +VR GR+ G + +  D + D   G++
Sbjct: 242 VQAQQAVFKVKGEA---DILAITYQAGVTCVQIMHVRNGRMLGGKSYFPDMLGD-DLGQM 297

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
           +  F+A  Y    DE     +P E++V+    DR  +   L+++ G  V ++   R  + 
Sbjct: 298 LSDFMANFYFQVADE-----VPSELIVNTALPDRKELEEALAQQFGKKVQIKSSVRETRA 352

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
             +E    N +  +   K Q ++ L    +                RIECFDIS   GE 
Sbjct: 353 EWLELAEMNVQHAI---KGQLSNHLELNERFHQLEQVVGRPID---RIECFDISHTMGEA 406

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            +AS VVF+ G ARK +YR+F+I+     D D AAM + ++RR+ +              
Sbjct: 407 PIASCVVFDQGGARKRDYRQFAIQDITAGD-DYAAMRQALTRRYKK-------------- 451

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540
                           A  P+L+++DGG+ Q+  A   + +LG+E   V G++K   E  
Sbjct: 452 ----------------AMLPDLLLIDGGKGQLHMAMEVMQELGLEAFMV-GVSKG--EGR 492

Query: 541 LPGEED-------PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
            PG E         I LP  S+ L+L+Q+VRDEAHRFAI+ HR KR K  + SVL+ IPG
Sbjct: 493 KPGLETLHFTDGTKIQLPEDSKALHLIQQVRDEAHRFAITKHRAKRDKRRSTSVLEAIPG 552

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LGP RR  LL HFG ++ + +A+  E+  VPG+GE  A+TIY+ L
Sbjct: 553 LGPKRRRDLLTHFGGIQGVLKASEKELTVVPGLGEVMARTIYKIL 597


>UVRC_HAHCH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  330 bits (846), Expect = 2e-92
 Identities = 205/630 (32%), Positives = 323/630 (51%), Gaps = 46/630 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           + T PGVYR  D  G V+YVGKA+NL+ R+SSYF++ + +  +T+ ++   AD++ T+ +
Sbjct: 16  LTTRPGVYRMMDARGEVLYVGKARNLKNRVSSYFRN-TGVSIKTRALVEKIADIEITITH 74

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYF 131
           +E EAL LE + IK   P +N+  RDDKSYPY+ ++ ++E+P +   R  +++    R+F
Sbjct: 75  SETEALLLEQNLIKTLKPPYNILLRDDKSYPYIYLSSHDEYPSLTFRRVRQKKTGKGRFF 134

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY+ A A+R+++ LL ++F +R C    F    +  RPCL   I +CSAPCVG I  + 
Sbjct: 135 GPYTSAAAVRESLALLQKIFRIRQCEDSFFS---NRSRPCLQHQIGRCSAPCVGLIDPQS 191

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y         F+ G     +                     +RD +  LR V E+QA+  
Sbjct: 192 YAEDMSHATMFLEGRNPEIINETIQQMEVASAQLDFERAAVLRDQVDYLRRVQEQQAIE- 250

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           G + D D  A++       V   ++R GR+ G + + + +  +   G L+  FL Q Y G
Sbjct: 251 GVARDIDAFALSSSLELVVVHGLFIRAGRVVGSKSFYLSERLESDDGDLLSSFLNQYYFG 310

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
              E +   +P+E+  +    D+DA+ A   +     V +    R ++   +     NA 
Sbjct: 311 ---EHAIYGLPQEITTTVGLTDKDALKAAFKEVFNRNVRIEHNVRSNRAEWLHLAQTNAN 367

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
           Q L+     + + L                     R+ECFD+S   GE TVAS VVF   
Sbjct: 368 QALSTRMQSQDAQLQRWQSFCDALNLEASVK----RVECFDVSHTFGEATVASCVVFGPE 423

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
            A K  YRR++I+     D D  AM + ++RR+++  +    +                 
Sbjct: 424 GAIKDLYRRYNIKDVPAGD-DYHAMEQALTRRYSKLKDSDVGL----------------- 465

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
                   P+++++DGG+ Q+  A +  D+L I  V + G+AK       +E +++  + 
Sbjct: 466 --------PDIILIDGGKGQLGIAHQVFDELQITGVTLIGVAKGVTRKPGMETLFISADN 517

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             + LP  S  L+L+Q++RDEAHRFAI+ HR +R K  T SVLD +PG+GP RR  LL +
Sbjct: 518 SILNLPGDSTALHLIQQIRDEAHRFAITGHRNQRNKKRTQSVLDAVPGIGPKRRRDLLNY 577

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           FGSVR + +A+  EI  VPGI E  AQTIY
Sbjct: 578 FGSVRNIERASLEEIKRVPGISEVIAQTIY 607


>UVRC_ACAM1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 626

 Score =  330 bits (846), Expect = 2e-92
 Identities = 228/642 (35%), Positives = 329/642 (51%), Gaps = 43/642 (6%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           R  L  +   IP +PGVY  RD +  ++Y+GK+K LR R+ SYF+      PR + M+  
Sbjct: 14  RDRLEARLKEIPPEPGVYFMRDANDDILYIGKSKKLRNRVRSYFRQIQDHPPRIELMVHQ 73

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
            AD+++ V +T           IK++ P FNV  +DDK YPYL VT ++ +PR+ + R  
Sbjct: 74  VADIEFIVTDTXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYLCVTWSQTYPRIFITRKR 133

Query: 124 R--RRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSA 181
           R  +   +Y+GPY   W +R T+ L+ R+FP+R     +FK      RPCL   I +C  
Sbjct: 134 RLGKAQDKYYGPYVDVWQLRQTLRLVKRLFPLRQRRKPLFK-----DRPCLNYEIGRCPG 188

Query: 182 PCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALR 241
            C   I  E YR + +       G T   +                     +RD I+ L+
Sbjct: 189 VCQALITPEAYRQILQKVVMIFQGRTSELINTLSLQMEQAAEDLNFEQAARLRDQIKGLQ 248

Query: 242 TVMEKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKL 300
            +   Q V L D T                VQ+F +R GR+ G  G++ D  +  S G +
Sbjct: 249 GLGVDQKVALPDDTVSRXXXXXXXXXXXXCVQLFQIRSGRLVGRLGFMAD-AQSGSLGMI 307

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
           ++  L   YG A+  E    +P E+LV  E  + + + ++LS+R+   V +  PQR  K 
Sbjct: 308 LQHVLEAHYGSAEPVE----LPLEILVQTELPETELLASYLSQRKERKVSITCPQRQIKA 363

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
            L+E V +NA+  LAR  +Q++ D T                    RIEC+DIS +QG  
Sbjct: 364 ELIEMVERNAQYELAR--TQKSRDRTXXXXXXXXXXXXXXXXXH--RIECYDISHIQGSD 419

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRY--LEESQRVG 475
            VAS VVF DGL  K  YRR+ IR      G   D A++ EV+ RRF +Y    E  R G
Sbjct: 420 AVASQVVFIDGLPAKQHYRRYKIRNPNVKAGHSDDFASLAEVLHRRFRQYHLSPEQPRQG 479

Query: 476 ELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG-IEDVAVCGLAK 534
             D                     P+LVV+DGG+ Q++A   +L  +  +ED+ +  LAK
Sbjct: 480 TSDW--------------------PDLVVIDGGKGQLSAVLESLTKIEVVEDLQIISLAK 519

Query: 535 RLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGL 594
           + EE++ PGE  P+       G+ L++R+RDEAHRFAIS+H             DDIPGL
Sbjct: 520 QREEIFQPGESQPLPTDPEQPGVQLIRRLRDEAHRFAISFHXXXXXXXXXXXXXDDIPGL 579

Query: 595 GPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G  R+  LL  F S+  + +A+  ++  VP IG + AQ IY+
Sbjct: 580 GHHRQKELLAAFRSIDYIREASPEQLKAVPTIGPQLAQKIYD 621


>UVRC_PELCD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  330 bits (845), Expect = 3e-92
 Identities = 228/649 (35%), Positives = 330/649 (50%), Gaps = 69/649 (10%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT  GVY  + E G V YVGKAKNLR+RL SYF +     P+ + ++    D++  V +T
Sbjct: 10  PTASGVYLMKGEAGTVFYVGKAKNLRSRLRSYFSEHGDNRPQIRFLLKRVHDIETIVTDT 69

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
           E EAL LE + IK+Y PR+N+  RDDK+Y  L +   +EFP +Q++R  RR G  YFGPY
Sbjct: 70  EKEALILENTLIKKYRPRYNINLRDDKTYLSLRLDPRQEFPMLQLVRRVRRDGALYFGPY 129

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           + + A+R T+  + R+FP+R      ++  RS  RPCL   I +CSAPC G+I  E+Y+ 
Sbjct: 130 ASSTAVRATLQEIYRIFPLR---RHPWESCRSRSRPCLYYQIGQCSAPCHGKISAEDYQR 186

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L +   A +AG     +                     +RD ++A+   +E+Q VV    
Sbjct: 187 LVDGALALLAGRESEVVESLQHQXXXXXXXXXXXXXXXLRDQLRAIEQTVERQKVVEAGG 246

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERG----WVVDKVEDVSTGKLVEQFLAQTYG 310
            D DV+ +  +  E  + + +VR G++   R     W +D+ E +ST      FL + YG
Sbjct: 247 GDQDVVGLHREGGEVELAILFVREGKVIDRRSYNLEWRLDEEELLST------FLQRFYG 300

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                     IP  VL+   P   + +  WLS++RG  V V  P RG +R L+    +N 
Sbjct: 301 ------RDVCIPDRVLLPFLPEGSEVLAEWLSEQRGKKVQVLAPLRGTRRKLVALAARNX 354

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
                              +              P RIECFDIS +QG  +V SM V  D
Sbjct: 355 XXXXXXXXXXXXXXQGVLEE----IARRLHLTRFPHRIECFDISNVQGRFSVGSMAVLSD 410

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
           G   K  YR F IR  EG+D                           D            
Sbjct: 411 GEPDKGAYRHFRIRSVEGSD---------------------------DYASXXXXXXXXX 443

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------------- 536
                    P+ +++DGG+ Q+      LD+L +   + V G+AK               
Sbjct: 444 XXXXXXXXXPDFILMDGGKGQLNIVCTVLDELNLTGRIDVAGIAKSRVMANVRGKAVERS 503

Query: 537 -EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
            E  +LPG ++ + L + S  L++L+R+RDEAHRFAI++HR+ R ++   SVL++IPG+G
Sbjct: 504 EERFFLPGRKNSVNLRQGSPALFMLERLRDEAHRFAITHHRKLRRRSTLGSVLEEIPGVG 563

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY----ERLTS 640
             RR ALLKHFGS++ +  A+  E+  +PG+    A+ I+    ER TS
Sbjct: 564 EKRRKALLKHFGSLKAVQAASLDELRAMPGLPAALAERIHAAFQERKTS 612


>UVRC_ACTSZ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  329 bits (843), Expect = 5e-92
 Identities = 218/640 (34%), Positives = 327/640 (51%), Gaps = 57/640 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P DPGVYR  D+   VIYVGKAK+L+ RLSSYF+  +    +T+ +++          
Sbjct: 10  NVPHDPGVYRMFDKTDTVIYVGKAKDLKKRLSSYFRP-NLSSKKTEALVAXXXXXXXXXX 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                AL LE+++IK + PR+NV  RDDKSYPY+ +T  E  PR+   RGA++    YFG
Sbjct: 69  XXXXXALLLEHNYIKTFQPRYNVLLRDDKSYPYILLT-KERHPRIAAYRGAKKIQGEYFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY +A A+R+T+ LL ++FP+R C   V+K   +  RPCL   I +C APCV G +  EE
Sbjct: 128 PYPHAGAVRETLSLLQKLFPIRQCENSVYK---NRSRPCLQYQIGRCCAPCVAGYVTDEE 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+A  E    F+ G+  + L                      RD IQA+R V+EKQ V  
Sbjct: 185 YQAQVEYARLFLQGKDQQVLDHLIAKMETASRALDFENAARFRDQIQAVRAVIEKQFVSN 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D D+I+IA     A VQV ++R G++ G R +      +    +L   F+ Q Y  
Sbjct: 245 DRLDDMDIISIAYRHGVACVQVLFIRQGKVLGNRSYFPKVPANTDLSELTATFVGQFYLQ 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
           A    +   +P  ++V  +   ++ +   LS++ G  V ++   +G K   +     NA+
Sbjct: 305 AHQGRT---VPNSIVVDHKLEAKEEIEQLLSEQAGRKVSIQDNAKGSKSKYLSLAQMNAK 361

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L   K + ++ ++ R +                R+ECFDIS   GE T+AS VVF D 
Sbjct: 362 AALTL-KLKESTLISERYRALRELLDMDKIN----RMECFDISHTMGEQTIASCVVFNDA 416

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KSEYRRF+I G  G D D AAM + + +R+ R L   +                   
Sbjct: 417 GPFKSEYRRFNIEGITGGD-DYAAMEQALKKRYDRDLTPEK------------------- 456

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKRLEEVWLPGEEDP 547
                   P+++ +DGG+ Q+  A +A  +L ++       + G+AK ++       ++ 
Sbjct: 457 -------IPDIIFIDGGKGQLNRALKAFGELNVKWDKNRPHLIGIAKGVDR---RAGQET 506

Query: 548 IILPRTSE---------GLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           +IL +T            L+L+Q +RDE+H  AIS HR+KR KA T S L+ I G+GP R
Sbjct: 507 LILSKTGREVNLDPDNLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGPKR 566

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           R ALLK+ G ++ +  AT  EIA VPGI    A+ I+E L
Sbjct: 567 RQALLKYLGGMQGVKNATLEEIASVPGISRALAEIIFETL 606


>UVRC_SILST RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 635

 Score =  328 bits (842), Expect = 6e-92
 Identities = 206/630 (32%), Positives = 330/630 (52%), Gaps = 44/630 (6%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D   RV+YVGKA+NLRAR+S+Y +       R +TMIS  + + +   
Sbjct: 37  TLDSSPGVYRMLDHESRVLYVGKARNLRARVSNYTRPGHT--QRIETMISQTSRMMFXXX 94

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                      + IK+  P++NV  RDDKS+PY+ V+ N  FP+++  RGAR+       
Sbjct: 95  XXXXXXXXXXQNLIKQLKPKYNVLLRDDKSFPYIMVSKNHAFPQLKKHRGARKGKXXXXX 154

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
                  +  T++ L + F +R C+  +F+      RPCL   I +CS PCVG+I   +Y
Sbjct: 155 XXXXXXXVNRTLNQLQKAFLLRNCTDTMFENRT---RPCLQYQIKRCSGPCVGKISQADY 211

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
                D   F+AG + +                       +RD I+AL  V   Q +   
Sbjct: 212 ADSVRDAERFLAGRSTKIQEELGAEMQAASEAMEYERAAALRDRIKALTQVQSAQGINPR 271

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
             ++ D+I +  +   A VQVF++R  +  G + +     ED+S  +++E F+ Q Y   
Sbjct: 272 GVSEADIIGLHLENGLACVQVFFIRANQNWGNQDFYPRVAEDMSAAEVMEAFIGQFYDNK 331

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D       +PR++++S +  + D +   LS++    V++ VPQRG+K  L+ + ++NA +
Sbjct: 332 D-------VPRQLILSDDIENADLMAVALSEKARRKVEIVVPQRGEKTELVASAVRNARE 384

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           +LAR  S+ A    T++K              P RIE +D S +QG + V  M+V     
Sbjct: 385 SLARRMSESA----TQAKLLRGIADAFGLEAPPNRIEVYDNSHIQGTNAVGGMIVMGPEG 440

Query: 433 ARKSEYRRFSIRGAEG-ADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             K+ YR+F+I+  E  A  D   M  V++RRF+R L+E                   +R
Sbjct: 441 FMKNAYRKFNIKDGEVIAGDDFGMMKAVLNRRFSRLLKEDP-----------------DR 483

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL------EEVWLPGEE 545
           +   +   P+L+++DGG  QV+A    +++ G++D+ + G+AK +      EE + PGE 
Sbjct: 484 QKGMW---PDLLLIDGGAGQVSAVAEIMEEHGVQDIPMVGVAKGVDRDHGKEEFYRPGE- 539

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           +   L R    LY +QR+RDEAHRFAI  HR KRAK+L A+ LDDIPG+G  R+ ALL H
Sbjct: 540 NAFALQRNDPVLYFIQRMRDEAHRFAIGTHRAKRAKSLVANPLDDIPGVGARRKKALLTH 599

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           FGS + +++A  +++  V G+ +  A+TIY
Sbjct: 600 FGSAKAVSRANLSDLKAVDGVSDALAETIY 629


>UVRC_BORA1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  328 bits (842), Expect = 6e-92
 Identities = 239/632 (37%), Positives = 337/632 (53%), Gaps = 46/632 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G V+YVGKA++L+ R+SSYFQ   A  PR   M+S    ++ TV  
Sbjct: 14  LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKTLA-SPRIAQMVSKVVRLEVTVTR 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E EAL LE + IK   PR+N+ +RDDKSYPYL +T +E +PR+   RG+  +  +YFGP
Sbjct: 73  SEAEALILENNLIKSLRPRYNILFRDDKSYPYLLITAHE-WPRIAYYRGSTSKRGQYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  +WA+R+T+ +L +VF +RTC   VF    +  RPCLL  I +CS PCV  I  E+YR
Sbjct: 132 YPNSWAVRETIQILQKVFRLRTCEDTVFA---NRSRPCLLYQIGRCSGPCVQAIDAEDYR 188

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ GE    +                     +RD + +L  V+ +Q +    
Sbjct: 189 RDVQRAARFLNGEAREVMDEIEARMQQASGELRFEEAAVLRDQMGSLSKVLHQQTMENVG 248

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA+A    +  V +  VRGGR  G++ +     +     ++ E F+AQ Y    
Sbjct: 249 GEDTDVIAVASAGGKVCVNLAMVRGGRHLGDKPFFPSHADGEEAAQVQEAFIAQHY---- 304

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
              +   +P  ++ S    D D ++  LS++ G    V    +G +R+ +E   KNAE  
Sbjct: 305 ---ADNVLPPVLVCSHALPDVD-LIGLLSEQAGTRCRVLTRPQGVRRSWLEQAQKNAEMA 360

Query: 374 LARHKSQR-ASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
           LAR  ++  A    T S                 RIECFDIS   GE T AS VVF    
Sbjct: 361 LARALTESGARAARTLSXXXXXXXXXXXXXXXXXRIECFDISHTAGEATQASCVVFLHHD 420

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            + S YRR++I G    D D AAM +V++RRF +  +           GE  AP      
Sbjct: 421 MQPSLYRRYNIVGITPGD-DYAAMRQVLTRRFAKVTD-----------GE--APM----- 461

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEED 546
                  P LV++DGG+ QV  A++   +LG++  A+ G+AK       LE +       
Sbjct: 462 -------PGLVLIDGGKGQVEVARQVFVELGLDIGALVGVAKGEGRKVGLETLVFADARA 514

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           P+ L + S  L L+ +VRDEAHRFAI+  R KRAK    S L++I G+G  RR  LL  F
Sbjct: 515 PLALGKASAALMLIAQVRDEAHRFAITGMRAKRAKTRNVSRLEEIEGVGAKRRQRLLARF 574

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           G +  +  A+  ++A V GI    A+ IY+ L
Sbjct: 575 GGLSGVTSASIEDLASVDGISMDLAERIYDAL 606


>UVRC_PROMH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  328 bits (841), Expect = 8e-92
 Identities = 219/637 (34%), Positives = 326/637 (51%), Gaps = 54/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           + + PGVYR  D  G VIYVGKAK+L+ RLSSYF+       +T+ ++   A++D TV +
Sbjct: 14  VTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRA-QVNSRKTEALVKCIANIDVTVTH 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           TE EAL LE+S+I+ Y PR+NV  RDDKSYPY+ ++ ++  PR+   RGA+     YFGP
Sbjct: 73  TETEALLLEHSYIQRYQPRYNVLLRDDKSYPYIYLSADKH-PRLASYRGAKHAKGEYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           +  + A+R+T+ L+ ++FP+R C   V+   R+  RPCL   I +C APCV G +  EEY
Sbjct: 132 FPNSLAVRETLALMQKLFPIRQCEDSVY---RNRSRPCLQYQIGRCLAPCVKGYVSDEEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV-L 251
                    F++G+  + +                     IRD I A+R V EKQ V  +
Sbjct: 189 AQQVNYVRLFLSGDDSQVIEGLIKRMEEASQALRFEEAARIRDQIHAVRQVTEKQFVANI 248

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GD  D DVI++A +   A V V + R G++ G R +      + S  ++V+ F+ Q Y  
Sbjct: 249 GD--DLDVISVAFNGAIACVYVLFFRQGKVLGSRSYFPKVPANTSLDEVVQTFIGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+     D+  +   +S   G  + ++   RGD RA          
Sbjct: 307 GS---AIRTLPTEILLDFNLEDKTILAESISSIAGRKIHIQTKPRGD-RARYXXXXXXXX 362

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                 K    S ++ R                  R+ECFDIS   GE TVAS VVF+  
Sbjct: 363 XXXXXXKQVEQSTISQRYNSLMSLLEMKEIK----RMECFDISHTMGEQTVASCVVFDMN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KSEYRR++I G    D D AAM +V++RR+ + LEES+                   
Sbjct: 419 GPLKSEYRRYNISGITPGD-DYAAMNQVLTRRYGKSLEESKI------------------ 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q+A A      L ++       + G+AK       LE ++ 
Sbjct: 460 --------PDIIFIDGGKGQLAQAIDVFQSLDVDWDKSHPKLIGVAKGSDRKAGLETLFF 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E + + LP  S  L+L+Q +RDE+HR AI+ HR++RAK    S L+ I G+GP RR  
Sbjct: 512 KPEGEGVALPSDSPALHLIQHIRDESHRHAITGHRQRRAKVKNTSSLESIEGVGPKRRQM 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VP I    A+ I+  L
Sbjct: 572 LLKYMGGLQALRDASVEEIAKVPTISTALAEKIFNAL 608


>UVRC_ZYMMO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 664

 Score =  327 bits (839), Expect = 1e-91
 Identities = 208/635 (32%), Positives = 334/635 (52%), Gaps = 48/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYR  D  G ++YVGKA+ LR R+++Y Q  S L  R Q M+S    +     
Sbjct: 60  TLPLRPGVYRMYDSKGNILYVGKARALRNRVANYTQ-ISGLSRRIQRMVSQTRSMTIVTT 118

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLN---EEFPRVQVMRGARRRGVR 129
            TE EAL LE   IK Y P +N+  RDDKS+PY+ +  +    +FP +Q  RG +R   +
Sbjct: 119 VTESEALLLEAQLIKRYRPPYNILLRDDKSFPYILLKEDGTFPQFPSLQRHRGVKRAKGK 178

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGV 189
           Y+GP++ A ++  T++ L ++F +R+CS   F+  +   RPCLL  I +CSAPCVGRI  
Sbjct: 179 YYGPFASADSVTLTLNSLQKLFLLRSCSDSFFRNRK---RPCLLYQIKRCSAPCVGRISE 235

Query: 190 EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV 249
           ++YR LA D   F+AG++    +                     RD ++AL  +   Q++
Sbjct: 236 DDYRDLAVDTRDFLAGKSTHVQKKLVTAMEQASNDLNYELAAVYRDRLKALAFIQSHQSI 295

Query: 250 VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTY 309
             G+  + D+  I      A +QVF++R  +  G   + ++ +++     +++ FL Q Y
Sbjct: 296 NSGNLRNADIFGIECRAGLACIQVFFIRNRQNWGHHAYYLNHIDEQPLEDVMQSFLGQFY 355

Query: 310 GGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKN 369
                       P+++L +  P+D++ +   LS +R   V    PQRG+ + L++  ++N
Sbjct: 356 -------EDKIAPKDILTNYLPSDKNVLEDALSSQRDYRVKFYQPQRGELKKLVDQAVRN 408

Query: 370 AEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           A++ + R    R ++ +T+ +              P RIE +D S + G + V  M+V  
Sbjct: 409 AKEAIDR----RLAEASTQKQLLKEMVNLFHLDKIPDRIEVYDNSHIMGSNMVGGMIVAG 464

Query: 430 DGLARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
               R++ YR+F+I+        D   M EV++RRF+R                      
Sbjct: 465 PEGFRRNSYRKFNIKSPSINPGDDFEMMREVLTRRFSRL--------------------- 503

Query: 489 AERKAPRFAYP--PNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLE-----EVWL 541
            ER  P  +    P+L+++DGG+ QV A +  L + GI D+A+ G++K  +     E + 
Sbjct: 504 -ERSDPDHSSSEWPDLLLIDGGKGQVHAVKDILAEQGISDIAIVGISKGPDRNAGREHFH 562

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             +     LP  S  L+ LQR+RDEAHRFAI  HR KRAK LT+S LD++PG+GP R+ A
Sbjct: 563 LVDGSEYALPPNSGLLFYLQRLRDEAHRFAIGTHRAKRAKNLTSSPLDEVPGIGPSRKKA 622

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           LL HFG+ R +  A+ +E+ +V GI    A+ IY+
Sbjct: 623 LLLHFGTARDVKNASLSELEKVNGISSAIARQIYD 657


>UVRC_NEIG1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 617

 Score =  327 bits (839), Expect = 1e-91
 Identities = 216/637 (33%), Positives = 329/637 (51%), Gaps = 50/637 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYRF DE G V+YVGKA NL+ R+S YFQ  +   PR   M+     ++ T+ 
Sbjct: 19  NLPKLPGVYRFFDEGGNVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVRHIETTIT 77

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +E EAL LE ++IK  SP++N+ +RDDKSYPYL ++   ++P++   RG  +   +YFG
Sbjct: 78  RSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKNPNQYFG 136

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  + A+RD++ +L +VF +RTC   VF+      RPCLL  I +C+APCVG I  E+Y
Sbjct: 137 PYPNSNAVRDSIQVLQKVFMLRTCEDSVFEHR---DRPCLLYQIKRCTAPCVGHISEEDY 193

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL- 251
                    F+ G+T    R                     RD IQAL  +   Q +   
Sbjct: 194 CDSVRQAATFLNGKTDELTRTLQHKMQTAAANLQFEEAARYRDQIQALGIIQSNQFIDSK 253

Query: 252 --GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQFLAQ 307
              +  D D++A+A       V    +RGGR  G++ +  D   D         E F+AQ
Sbjct: 254 NPNNPNDIDLLALAVSDGLVCVHWVSIRGGRHVGDKSFFPDTKNDPEPNGQDYAEAFVAQ 313

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y G    +        +++S  P   DA+   L    G  +       G+++  ++   
Sbjct: 314 HYLGKSKPD--------IIISNFPVP-DALKEALEGEHGKQMQFVTKTIGERKVWLKMAE 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+  + +   Q+++    + +                R+ECFDIS  QGE T+AS VV
Sbjct: 365 QNAQMAITQRHLQQSNQ---QHRIDELAKILGMNSDGINRLECFDISHTQGEATIASCVV 421

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           +++   + S+YRR++I  A+  D D AAM EV++RR+ +       + E +  GES    
Sbjct: 422 YDEQNIQPSQYRRYNITTAKPGD-DYAAMREVLTRRYGK-------IQEAEANGES---- 469

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWL 541
                       P++V++DGG+ Q+  A    ++LG+  + + G+AK       +EE+ L
Sbjct: 470 ---------VKWPDVVLIDGGKGQIGVAVSVWEELGLH-IPLVGIAKGPERKAGMEELIL 519

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
           P   +   LP  S  L+LLQ VRDE+HRFAI+ HR+KR KA   S L DIPG+G  RR A
Sbjct: 520 PFTGELFRLPPNSPALHLLQTVRDESHRFAITGHRKKRDKARVTSSLGDIPGVGSKRRQA 579

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LL  FG +R +  A+  ++ +V GI +  A+TIY  L
Sbjct: 580 LLTRFGGLRGVIAASREDLEKVEGISKALAETIYNHL 616


>UVRC_ACIC5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 645

 Score =  327 bits (838), Expect = 2e-91
 Identities = 235/668 (35%), Positives = 345/668 (51%), Gaps = 63/668 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K  ++PT PGVY +++  G VIYVGKAKNLR+R+ SY  + S  + +T +++  A D
Sbjct: 3   LQEKIRTLPTGPGVYLYKNADGEVIYVGKAKNLRSRVRSYLLEASQANAKTGSLMREAVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           +D+  V  E EAL LE + IK+  PRFNV  RDDK+YPY+ +TL + +P+V V R  R+ 
Sbjct: 63  LDYITVGNEHEALALENNLIKQRKPRFNVLLRDDKTYPYVKLTLGDRYPKVFVTRRLRKD 122

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G  Y+GP+         VDL+ R F + +C   +   +R   R CL  YI +C  PCV  
Sbjct: 123 GAAYYGPFFPGNLAYRIVDLIHRSFLLPSCKVDL---SRYHARACLQYYIKRCLGPCVKH 179

Query: 187 IGV-EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +   E YR    D   F+ G      R                     RD +  L  + E
Sbjct: 180 LTTPEAYREAVRDAQWFLEGRGADLERSLEVRMXXXXXXXXXXXXXKYRDLLVTLHQLQE 239

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKV-EDVSTGKLVEQF 304
           KQ V         V     +    AV +F++RGG++   R +  +++ E +  G   E+ 
Sbjct: 240 KQRVASXXXXXXXVFGYHYENGMLAVNLFHMRGGKMVDRREFFWEELPEFMEEGAQEEEV 299

Query: 305 LAQTYGGADDEE--------------------STTAIPREVLVSAEPADRDAVVAWLSKR 344
           L     G  + +                        +PR + V    ADR+A+   L+++
Sbjct: 300 LPAQAEGRGEVQVELRFEPGAFFSALLKQIYIEQPYVPRSIYVPVNFADREALAGLLAEQ 359

Query: 345 RGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSK-XXXXXXXXXXXXX 403
               +++ VPQRGDKR+L++   +NA Q+      QR   +    K              
Sbjct: 360 THHRIELAVPQRGDKRSLVDLAGQNARQSY----EQRFRVMQPNQKAIQEALQDALMLEE 415

Query: 404 XPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRR 463
            P RIECFDIS +QG  TVASMVV+E+G  +K++YR+F I+   G D D A+M EV++RR
Sbjct: 416 LPRRIECFDISHIQGAETVASMVVWENGAMKKADYRKFQIKTVSGVD-DFASMREVLTRR 474

Query: 464 FTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLG 523
           + R +EE Q +                         P+++++DGG  Q+          G
Sbjct: 475 YRRVIEEKQAM-------------------------PDVILIDGGIGQLRXXXXXXXXXG 509

Query: 524 IEDVAVCGLAKRLEEVWLPGEED-PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKA 582
                V  +AKR E ++L G ED PI+L R S  L+L+QR+RDE+HRFAI+YHR++R   
Sbjct: 510 QTTQTVASIAKREEIIYLYGHEDEPIVLERRSPVLHLVQRIRDESHRFAIAYHRKRREMR 569

Query: 583 LTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
              S L +IPG+G   R  LL+HFGS+R + +A    +  V  +   TA+ I        
Sbjct: 570 DRDSELLEIPGVGTRTRTRLLEHFGSLRGVRKADVEALTAV--VPRPTAEAIAAHFQ--- 624

Query: 643 GGQRTQPE 650
            G++ +PE
Sbjct: 625 -GEKAEPE 631


>UVRC_PHOPR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 616

 Score =  327 bits (837), Expect = 2e-91
 Identities = 218/638 (34%), Positives = 322/638 (50%), Gaps = 54/638 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  D  G VIYVGKAK+L+ RLSSYF+  +    +T+ ++     VD TV 
Sbjct: 18  TVTHQPGVYRMYDAVGDVIYVGKAKDLKKRLSSYFR-INVAGEKTRALVKNICKVDVTVT 76

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y P++NV  RDDKSYPY+ ++ N   PR+ + RG ++R   YFG
Sbjct: 77  HTETEALILEHNYIKLYLPKYNVLLRDDKSYPYIFLS-NHHHPRLSIHRGTKKRKGEYFG 135

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVE-E 191
           PY  A A+R+++ L+ ++FP+R C   V+    +  RPCL+  I +C APCV  +  E +
Sbjct: 136 PYPDAGAVRESLHLMQKLFPIRQCEDSVYA---NRSRPCLMYQIGRCLAPCVKELITEKD 192

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y         F+ G+  + +                      RD IQALR V E+Q V  
Sbjct: 193 YEDQVSFARLFLQGKDRQVIASLVEKMEQASQSLNFEQAATFRDQIQALRRVQEQQFVSH 252

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI IA     A +   Y+R G+I G R +      D    +++  F+ Q Y  
Sbjct: 253 DSEDDLDVIGIAHQNGMACIHALYIRQGKILGSRSYFPKMPSDAELTEVLSSFITQFYL- 311

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVA-WLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             ++     IP  +++     D  AV+   LS   G  ++++V  RG++   ++    NA
Sbjct: 312 --NQAEGRVIPSVIILGENLGDDAAVITETLSDIAGRKIELKVNPRGNRARYLKLAQTNA 369

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
              L    S + +     S+                R+ECFDIS   GE TVAS VVF  
Sbjct: 370 MTALTSKLSHKMTIHERFSELRKALNLETIS-----RMECFDISHTMGEKTVASCVVFNQ 424

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               K +YRR++I G  G D D AAM +V+ RR+                   G P   E
Sbjct: 425 EGPFKQDYRRYNITGITGGD-DYAAMGQVLERRY-------------------GKPMEPE 464

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALD---DLGIEDVAVCGLAKRLEE-------VW 540
           +        P+++ +DGGR Q++ A   +    D   +   + G+AK +         ++
Sbjct: 465 KI-------PDIIFIDGGRGQLSRAYNVVKPFMDEWPKQPLLIGIAKGVTRKAGLETLIF 517

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
           + GEE    LP  S  L+L+Q +RDE+H  AIS HR +RAK    S L+D+ G+GP RR 
Sbjct: 518 ITGEE--FSLPSDSPALHLIQHIRDESHNHAISGHRAQRAKVRKRSALEDVEGIGPKRRQ 575

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ALLK  G +  L +A+  EIA+VPGI +  A+ IY+ L
Sbjct: 576 ALLKFMGGLHELKRASREEIAKVPGISKALAEKIYDAL 613


>UVRC_ACIAD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  326 bits (836), Expect = 3e-91
 Identities = 216/643 (33%), Positives = 330/643 (51%), Gaps = 59/643 (9%)

Query: 4   RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIST 63
           RP +     ++   PGVYR   + G ++YVGKAKNL+ R+SSYF   +  HP+TQ +++ 
Sbjct: 6   RPHIEKILANMTQLPGVYRMLGKDGELLYVGKAKNLKNRVSSYFVK-TIEHPKTQALVAR 64

Query: 64  AADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGA 123
             D++  V  +E EAL LE + IK++ P +N+  RDDKSY Y+ V+ ++ +PR+   RG 
Sbjct: 65  IHDIETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSSDKPYPRIASGRGK 124

Query: 124 RRRGV-RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
            +  + ++FGPY  A++ RDT+ +L ++F VR C    F + +   RPCL   I +CSAP
Sbjct: 125 GKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQCENSYFAQRK---RPCLQYQIKRCSAP 181

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           CVG I  E+Y+   ++   F+ G+T    +                     RD +  LR 
Sbjct: 182 CVGLISPEDYKQDVDNSIRFLQGDTKELNQELIAKMEEAAEQLAFEKAMFYRDRLGLLRE 241

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
           V  +QA V     + D++AIA       VQ+ YVR GR+ G + +  D + D   G+++ 
Sbjct: 242 VQAQQA-VFKIKGEADILAIAFQAGVTCVQIMYVRNGRMLGGKSYFPDMLSD-DLGQMLS 299

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRAL 362
            F+A  Y    DE     +P E++V+ E  DR  +   L  +    + ++   R  +   
Sbjct: 300 DFIANFYFQVADE-----VPSELIVNVELPDRKELEQALQTQFDKKIQIKHKVRETRAEW 354

Query: 363 METVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
            E  + N +  +   K Q ++ L    +                RIECFDIS   GE T+
Sbjct: 355 QELAIMNVQHAI---KGQLSNHLELNERFHQLEQVVGRPVD---RIECFDISHTMGEATI 408

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
           AS VVF+ G ARK +YR+F I      D D AAM + ++RR+ +++              
Sbjct: 409 ASCVVFDQGGARKRDYRQFGIEDITAGD-DYAAMRQALTRRYKKHI-------------- 453

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLP 542
                            P+L+++DGG+ Q+  A   +  LG+ D  + G++K   E   P
Sbjct: 454 ----------------VPDLLLIDGGKGQLHMAMEVMQTLGL-DAFMVGVSK--GEGRKP 494

Query: 543 GEE-------DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           G E         I LP   + L+L+Q+VRDEAHRFAI+ HR KR K    SVL+ IPGLG
Sbjct: 495 GLETLHFTDGSKIQLPEDHKALHLIQQVRDEAHRFAITKHRAKRDKRRAGSVLEVIPGLG 554

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           P RR  LL HFG ++ + +A+  E+  V G+G   A+TIY+ L
Sbjct: 555 PKRRRDLLTHFGGIQGVLKASEKELMLVSGLGPSMARTIYKIL 597


>UVRC_SHESH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  326 bits (835), Expect = 4e-91
 Identities = 214/635 (33%), Positives = 327/635 (51%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  DE G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S  A++D TV 
Sbjct: 13  TVSSSPGVYRMYDEEGTVIYVGKAKDLKKRLSSYFR-VNLPNVKTQALVSHIANIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y PR+NV  RDDKSYPY+ ++ + + PR+   RG +R    YFG
Sbjct: 72  HSETDALILENDYIKQYMPRYNVLLRDDKSYPYILLS-DHKHPRLAYHRGPKRDKGSYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ LL ++FP+R C    +K   S  RPCL   I +CSAPCV ++  EEY
Sbjct: 131 PYPNGGAVRESLHLLQKIFPIRQCDDLYYK---SRSRPCLQYQIGRCSAPCVNKVSDEEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 AVQVKLASLFLKGKDLQVMTELVSKMEASALALEYEQAASYRDQIAALRRVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
            S D DVI        A   + ++R G+I G R +      +    +++  F+ Q Y  +
Sbjct: 247 TSGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPSVPAETELDEVLSAFMIQFYLNS 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   +P+E+L+S    D   +   +       V+++   R ++   +   + NA  
Sbjct: 307 DSQRT---VPKEILLSHGFDDLPELERAIQTALEKKVEIKTNVRSERANFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +    + R S   T  +                R+ECFDIS   GE TVAS VVF+   
Sbjct: 364 AV----NTRLSHKNTVEQRFLLLEEALEVSTLIQRMECFDISHTMGESTVASCVVFDREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G    D D AAM + I+RRF +          +D  G+          
Sbjct: 420 PNKADYRRYNINGITPGD-DYAAMKQAITRRFDK----------IDKNGKI--------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE---DVAVCGLAKR------LEEVWLPG 543
                  P+L+ +DGG  Q+  AQ+ +D+  ++      + G+AK       LE +    
Sbjct: 460 -------PDLLFIDGGTGQLRIAQKIVDEKFVDIDKTPMLIGVAKGEGRKPGLETLIYGE 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    +P  S  L+L+Q +RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 513 NEQSFTIPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ++ G ++ +  A+ AE+A+VPGI    AQTI++ L
Sbjct: 573 QYLGGIQEVKGASVAELAKVPGISLEMAQTIHDSL 607


>UVRC_SHEPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  326 bits (835), Expect = 4e-91
 Identities = 211/635 (33%), Positives = 329/635 (51%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D    VIYVGKAK+L+ RLSSYF+   A + +TQ ++S  A++D TV 
Sbjct: 13  TVTSSPGVYRMYDAKDAVIYVGKAKDLKKRLSSYFRKNLA-NVKTQALVSHIANIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ N + PR+   RG +R   +YFG
Sbjct: 72  HSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHQHPRLAYHRGPKRDKGQYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   I +CSAPCV  +  E+Y
Sbjct: 131 PYPNGGAVRESLHLMQKIFPIRQCDDLYYK---SRSRPCLQYQIGRCSAPCVDLVSEEDY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +        F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 QEQVRLATLFLKGKNQQVMSVLVQKMEQASSDMRYEQAALYRDQITALRRVSEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
            S D DVI        A   + ++R G+I G R +      +    +++  F+ Q Y  +
Sbjct: 247 ASGDMDVIGAYYASGVACFHLLFIREGKIFGSRSYYPKVPVNTEVSEVLRSFMLQFYLNS 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D +  T   P+E+L+S    ++  +   +   +   V+++   RG++ + +   L NA  
Sbjct: 307 DSQRLT---PKEILISDAFEEQAELADAIQSAQNKKVEIKTQVRGERASFLRLALTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +    + R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AV----NTRLSHKNTIEQRFLLLEEAIESTNKIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G    D D AAM + I+RRF +  E+ +                    
Sbjct: 420 PSKADYRRYNITGITPGD-DYAAMKQAITRRFDKITEKGKI------------------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDD--LGIEDV-AVCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  + +++   + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGIGQLRIAQKVVDEQFVALDNAPTLIGVAKGEGRKPGLETLIYGE 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E+   LP  S  L+L+Q +RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 513 SEESFSLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLETIAGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ++ G ++ +  A+ +E+A+VPGI    AQTI++ L
Sbjct: 573 QYLGGLQEVKGASVSELAKVPGISLEMAQTIHDAL 607


>UVRC_PASMU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  326 bits (835), Expect = 4e-91
 Identities = 214/637 (33%), Positives = 324/637 (50%), Gaps = 51/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++  D GVYR  DE   VIYVGKAK+L+ RLSSYF+   +   +T+ ++S  A +D T+ 
Sbjct: 10  NVSHDAGVYRMYDEKDTVIYVGKAKDLKKRLSSYFRTHLS-SKKTEALVSAIARIDTTIT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E EAL LE+++IK Y PR+NV  RDDKSYPY+ +T  E  PR+   RG+++    YFG
Sbjct: 69  SSETEALLLEHNYIKTYQPRYNVLLRDDKSYPYILLTA-ERHPRISAYRGSKKIKGEYFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY +A A+R+T+ LL ++FP+R C   V+    +  RPCL   I +C+APCV G +  E 
Sbjct: 128 PYPHASAVRETLSLLQKLFPIRQCENAVYN---NRSRPCLQYQIGRCAAPCVAGYVTDEA 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F+ G+  + L                     IRD IQA+R VMEKQ V  
Sbjct: 185 YLQQVELARLFLQGKDQQVLEHLIHKMEQASLALDFEEAARIRDQIQAVRAVMEKQFVST 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D D+++IA     A VQV ++R G++ G R +      + +  +L   F+ Q Y  
Sbjct: 245 ERLDDMDILSIAYQLGIACVQVLFIRQGKMLGNRSYFPKVPANTTLSELTATFVGQFYLQ 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
           A    S   IP  ++V               ++ G  V ++   +G+K   ++    NA+
Sbjct: 305 AHQGRS---IPHRIIVDHXXXXXXXXXXXXXQQAGRKVHIQDNTKGEKSKYLQLAKMNAQ 361

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L     Q     +T  K                R+ECFDIS   GE T+AS VVF   
Sbjct: 362 SALVTQLKQ-----STLLKERYQALQAILQLGEIRRMECFDISHTMGEQTIASCVVFNQD 416

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G    D D AAM + + +R+ + LE+ +                   
Sbjct: 417 GPLKSDYRRFNITGITAGD-DYAAMEQALLKRYDKPLEQEKI------------------ 457

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKRLE-----EVWLP 542
                   P+++ +DGG+ Q+  A +    L ++       + G+AK ++     E  + 
Sbjct: 458 --------PDVIFIDGGKGQLNRALQTFSKLNVKWDKNQPHLIGVAKGIDRKAGLETLIL 509

Query: 543 GEEDPII-LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
            ++  I+ LP     L+L+Q +RDE+H+ AIS HR+KR +A   S L+ + G+G  RR  
Sbjct: 510 SKQGKILHLPSDHLALHLIQHIRDESHQHAISGHRKKRQQAFLQSGLESVEGVGAKRRQT 569

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ + +AT  EIA VPGI +  A+ IY+ L
Sbjct: 570 LLKYLGGMQGVKKATLDEIASVPGISKALAERIYDAL 606


>UVRC_ENTS8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  326 bits (835), Expect = 4e-91
 Identities = 214/640 (33%), Positives = 325/640 (50%), Gaps = 58/640 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++   ++D TV 
Sbjct: 13  TVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIHNIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYPY+ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLS-GDTHPRLAIHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  E+
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEED 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F+AG+  + +                     +RD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLAGKDDQVINQLVSRMEQASQNLAFEEAARLRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
            +  D DVI +A +   A + V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NNGDDLDVIGVAFESGMACLHVLFIRQGKVLGSRSYYPKVPNGTELAEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+                  G  V+V+   RGD+            
Sbjct: 307 GSQMRT---LPGEILLDFXXXXXXXXXXXXXXIAGRRVNVQTRPRGDRARYXXXXXXXXX 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
                  SQ+++    LT  ++                R+ECFDIS   GE TVAS VVF
Sbjct: 364 XXXXXXXSQQSTISQRLTALAQALHLPEIK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +EES+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIEESK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+  A+    +L +        + G+AK       LE 
Sbjct: 459 ----------VPDIILIDGGKGQLGQAKSVFAELDVPWDKHHPLLLGVAKGSDRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++L  E +   LP  S  L+++Q +RDE+H  AI+ HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFLEPEGEGFALPPDSPALHVIQHIRDESHNHAITGHRKKRAKVKNTSTLETIEGIGPKR 568

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           R  LLK+ G ++ L  A+  EIA+VPGI +  A+ IY  L
Sbjct: 569 RQMLLKYMGGLQPLLNASVEEIAKVPGISQALAEKIYYSL 608


>UVRC_CLOD6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 605

 Score =  325 bits (834), Expect = 5e-91
 Identities = 198/625 (31%), Positives = 324/625 (51%), Gaps = 41/625 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P++PGVY  +D++  +IYVGKA +L+ R+  YFQ       + ++M+      ++ + +
Sbjct: 11  LPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFQSSKNHTSKVKSMVKNIYKFEYIITD 70

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E+EAL LE + IK Y P++NV  RDDK+YPY+ VT NE++PR+  +R   +   +YFGP
Sbjct: 71  SELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKDKAKYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y+   A+ DT++L+   +P+R+C   + K  ++  RPCL  +I+KC  PC G +  EEY 
Sbjct: 131 YTNITAVNDTLELISSTYPIRSCKIDIDKAIKNKTRPCLNLHINKCLGPCTGNVSKEEYG 190

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV-VLG 252
            + E+    ++G                            RD I++L  +++KQ +    
Sbjct: 191 KMIEEIIMCLSGXXXXXXXXXXXXXNESSMNFRFEEAAVYRDKIKSLEEMIQKQKIDATV 250

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV+A+A    EA VQVF++R G+I G   ++++ V D     ++  F+ Q Y   
Sbjct: 251 SDLNQDVVAMARAHNEACVQVFFIRNGKIVGREHFILEGVMDSPRASILSSFVKQFYNEQ 310

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           +       IP+                    ++G  V +RVPQ+G+K++L+E V KNA +
Sbjct: 311 E------YIPKXXXXXXXXXXXXXXXXXXXXKKGQKVTIRVPQKGEKKSLVEMVRKNAVE 364

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L +                            P+RIE +DIS +QG  ++ SMVV+ +  
Sbjct: 365 YLEKFSDMNKRKYEKSIGALEELKQILNLEKLPIRIEAYDISNIQGVDSIGSMVVYTNAK 424

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR+ I+   G  +D  +M E++ RR         + G L               
Sbjct: 425 KDKKEYRRYKIKTVIG-PNDYDSMAEIVDRRL--------KHGNL--------------- 460

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGEEDPIIL 550
                  P+L+++DGG+ QV+A ++ L +L   D+ + G+ K  +     L  +E  I L
Sbjct: 461 -------PDLILLDGGKGQVSAVKKVL-ELNDVDIPLWGMYKDDKHRTKGLICKEKEIEL 512

Query: 551 PRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVR 610
            +T+     +  +++E H +AI+YHR  R KALT S+LDDI G+G  R+ +LL HF  V 
Sbjct: 513 DKTTNLYRFIASIQEEVHNYAITYHRSLRNKALTKSILDDIQGIGEKRKKSLLNHFKDVD 572

Query: 611 RLAQATAAEIAEVPGIGERTAQTIY 635
            + +AT  E+ EV G+ +  A  +Y
Sbjct: 573 AIKKATMEELLEVDGMNKSIADNVY 597


>UVRC_SHEPW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  325 bits (833), Expect = 7e-91
 Identities = 211/635 (33%), Positives = 330/635 (51%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D    VIYVGKAK+L+ RLSSYF+  +  + +TQ +++  A++D T+ 
Sbjct: 13  TVTSSPGVYRMYDVDNIVIYVGKAKDLKKRLSSYFRK-NLTNVKTQALVARIANIDVTIT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ N + PR+   RG +R   +YFG
Sbjct: 72  HSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLS-NHKHPRLSYHRGPKRAKGQYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ LL ++FP+R C   ++ +ARS  RPCL   I +CSAPCV  + +++Y
Sbjct: 131 PYPNGGAVRESLHLLQKIFPIRQCD-DLYYKARS--RPCLQYQIGRCSAPCVDNVSLKDY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +        F+ G+  +  +                     RD I ALR V E+Q V   
Sbjct: 188 QEQVALASLFLKGKDQQVTKALVAKMEQAAVELNYEQAARYRDQITALRRVAEQQEVS-H 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
            S D DVI        A   + ++R G+I G R +      D    +++  F+ Q Y  +
Sbjct: 247 SSGDMDVIGAHFASGVACFHLLFIREGKIFGSRSYYPKVPVDTELSEVLRAFMFQFYLNS 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D +  T   P+E+LVS    ++  +   ++  +   V+++   RG++   +   L NA  
Sbjct: 307 DSQRVT---PKEILVSDAFEEQAELAGAINTAQQRKVEIKSQVRGERAQFLRLALTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +    + R +   T  +                R+ECFDIS   GE TV+S VVF    
Sbjct: 364 AV----NTRLAHRNTVEQRFLLLEEAIEVSHKIQRMECFDISHTMGESTVSSCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G    D D AAM + ISRRF             D + ++G        
Sbjct: 420 PNKADYRRYNIEGITPGD-DYAAMKQAISRRF-------------DKVAKAGKT------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGI---EDVAVCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +       + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGIGQLRIAQKVVDEKFVALDHAPTLIGVAKGEGRKPGLETLIYGE 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E+   LP  S  L+L+Q++RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 513 NEESFTLPADSGALHLIQQIRDESHRFAITGHRNKRQKTRNTSTLESIEGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+  E+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKSASVTELVKVPGISLEMAQTIHDAL 607


>UVRC_HAEI8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  325 bits (832), Expect = 9e-91
 Identities = 217/633 (34%), Positives = 324/633 (51%), Gaps = 51/633 (8%)

Query: 17  DPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEV 76
           +PGVYR  D+  +VIYVGKAK+L+ RLSSYF+  +    +T+ ++++   +D        
Sbjct: 14  EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDTMXXXXXX 72

Query: 77  EALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSY 136
                 +++IK Y PR+NV  RDDKSYP++ +T  E  PR+   RG+++    YFGPY +
Sbjct: 73  XXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPH 131

Query: 137 AWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEYRAL 195
           A A+R+T+ LL ++FPVR C   V+    +  RPCL   I +CSAPCV G +  EEY   
Sbjct: 132 AGAVRETLSLLQKLFPVRQCENSVYS---NRSRPCLQYQIGRCSAPCVQGYVSDEEYNQQ 188

Query: 196 AEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDST 255
            E    F+ G+  + L                      RD IQA+R+V+EKQ V      
Sbjct: 189 VELARLFLQGKDQQVLDYLIGKMEQASRNLDFEQAARYRDQIQAVRSVIEKQFVSNERLD 248

Query: 256 DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDE 315
           D D+++IA     A VQV ++R G++ G R +      +    +L E F+ Q Y      
Sbjct: 249 DMDIMSIAYQHGLACVQVMFIRQGKVLGNRSYFPKVPANTDLSELTETFVGQFYLQGHQG 308

Query: 316 ESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLA 375
            S   IP  ++V  + A++  +   L+++ G  V ++   +GDK   ++    NA+  L 
Sbjct: 309 RS---IPNSIIVDRQLAEKSELEQLLTEQAGRKVTIQESVKGDKSKYLQLAQVNAKAALN 365

Query: 376 RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARK 435
               Q     ++R                  R+ECFDIS   G  TVAS VVF      K
Sbjct: 366 VQLKQ-----SSRMSERYQALCDLLNLPEIKRMECFDISHTMGNQTVASCVVFNQEGPLK 420

Query: 436 SEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPR 495
           S+YRRF+I G  G D D AAM + + +R+ R LEE +                       
Sbjct: 421 SDYRRFNIEGITGGD-DYAAMEQALQKRYERDLEEDKI---------------------- 457

Query: 496 FAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKRLE-----EVWLPGEED 546
               P+++ +DGG+ Q+  A      L ++       + G+AK ++     EV +  ++D
Sbjct: 458 ----PDIIFIDGGKGQLNRALNVFQHLQVKWDKNRPHLIGVAKGVDRRAGQEVLIISKQD 513

Query: 547 -PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             I LP  S  L+L+Q +RDE+H  AIS HR+KR KA T S L+ I G+G  RR ALLK+
Sbjct: 514 REIHLPDDSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQALLKY 573

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            G ++ + +AT  EIA VPGI  + A+TI+E L
Sbjct: 574 LGGLQGVKKATLDEIASVPGISLKLAETIFETL 606


>UVRC_CHRVO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 601

 Score =  325 bits (832), Expect = 9e-91
 Identities = 236/633 (37%), Positives = 328/633 (51%), Gaps = 53/633 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT PGVYR  D  G+V+YVGKA +L+ R+SSYFQ  + L PR Q M+   A ++ TV 
Sbjct: 14  NLPTLPGVYRMLDAAGKVLYVGKAIDLKRRVSSYFQK-NDLSPRIQLMVRQIASIETTVT 72

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +E EAL LE + IK  +PR+N+ +RDDKSYPYL  +    FP++   RG  ++  +YFG
Sbjct: 73  RSEAEALILENNLIKALAPRYNILFRDDKSYPYLMFS-GHAFPQMAYYRGEPKKPNQYFG 131

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY   +A+R+++ +L +VF +RTC   VF    +  RPCLL  I +CS PCV  I  EEY
Sbjct: 132 PYPNGYAVRESIQILQKVFRLRTCEDAVFA---NRSRPCLLYQIKRCSGPCVDHISKEEY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
            A      AF+ G     +                     +RD IQAL  V EKQ V   
Sbjct: 189 AADVASAVAFLNGRQSELINELTRRMTXXXXXXXXXXXXXLRDQIQALARVQEKQFVASN 248

Query: 253 DST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
            S  DCDV+A         V +  +RGGR  G++       E  +  +++E F+ Q Y  
Sbjct: 249 QSQQDCDVVAARVRDGVPCVNLVMIRGGRHLGDKSHFPIGGEADTEQEILEAFIGQHYQH 308

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
           A        +P  ++V+      DA+  +L +R G  V +     G++R  +E   KNAE
Sbjct: 309 A-------GVPAALVVNG--VVDDALQQFLQERAGRKVYIVGNPIGERRVWLEMAEKNAE 359

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             + +    +A+     ++                R ECFDIS   GE TVAS VV++ G
Sbjct: 360 LAILQRLGSKATQAQRLAQLNEVLELEDAG-----RFECFDISHTMGEATVASCVVYDKG 414

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             + +EYRRF+I  A   D D AAM EV+SRR+ +  E   R+                 
Sbjct: 415 AMQPTEYRRFNITTAAPGD-DYAAMREVLSRRYGKLAEGEGRL----------------- 456

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
                   P+ V +DGG+ Q                 V G+AK       LE + LP  E
Sbjct: 457 --------PDAVFIDGGKGQXXXXXXXXXXXXXXXPIV-GIAKGEERKPGLETLILPYLE 507

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             + L +    L+L+Q VRDEAHRFAI+ H        T+S L+DIPG+G  RR  LL  
Sbjct: 508 KTLQLRQDHPALHLIQTVRDEAHRFAITGHXXXXXXXXTSSTLEDIPGIGAKRRQQLLTR 567

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FG +R +A A+  ++A+V GI    A+ IY  L
Sbjct: 568 FGGLRGVATASVDDLAQVEGISRTLAEKIYNAL 600


>UVRC_BRUME RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 611

 Score =  325 bits (832), Expect = 9e-91
 Identities = 217/631 (34%), Positives = 332/631 (52%), Gaps = 36/631 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVYR  +  G V+YVGKA+NL+ R+S+Y +     + R   MI     +++ V  
Sbjct: 4   LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFVVTR 62

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     + IK   PRFNV  RDDKS+PY+ +T     P +   RGAR R   YFGP
Sbjct: 63  XXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGP 122

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CSAPC   I  E+Y 
Sbjct: 123 FASAGAVGRTINALQRAFLLRTCTDSVFE---TRTRPCLLYQIKRCSAPCTYEISDEDYA 179

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  +  AF++G++                          RD + AL  V   Q +    
Sbjct: 180 GLVAEAKAFLSGKSQSVKDHLXXXXXXXXXDLDFEHAAVYRDRLAALSHVQSHQGINPQT 239

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AI ++     +QVF+ R G+  G R +       +   +++  FL+Q Y   D
Sbjct: 240 VEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFY---D 296

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      P+ VL+S    ++  +   LS R G  V V VPQRG+K+ L++  L NA + 
Sbjct: 297 DKPC----PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREA 352

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ +++++              P RIE +D S + G + V  M+V      
Sbjct: 353 LGR----RLAETSSQARLLQGLAETFGLPRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGF 408

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR  +     D   M EVI RRF+R ++E             G P G  + 
Sbjct: 409 VKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEH------------GTPAGEVKN 456

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGEE 545
              F   P+++++DGG+ QV A ++ L ++GI D V   G+AK +      E  ++ G++
Sbjct: 457 PDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQ 516

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P  LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL H
Sbjct: 517 -PFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHH 575

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+ + +++A   ++ ++ GI E  A+ I++
Sbjct: 576 FGTAKAVSRAAVEDLMQIDGISEAMARAIHD 606


>UVRC_BRUAB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 627

 Score =  325 bits (832), Expect = 9e-91
 Identities = 217/631 (34%), Positives = 332/631 (52%), Gaps = 36/631 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVYR  +  G V+YVGKA+NL+ R+S+Y +     + R   MI     +++ V  
Sbjct: 20  LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFVVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     + IK   PRFNV  RDDKS+PY+ +T     P +   RGAR R   YFGP
Sbjct: 79  XXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGP 138

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CSAPC   I  E+Y 
Sbjct: 139 FASAGAVGRTINALQRAFLLRTCTDSVFE---TRTRPCLLYQIKRCSAPCTYEISDEDYA 195

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  +  AF++G++                          RD + AL  V   Q +    
Sbjct: 196 GLVAEAKAFLSGKSQSVKDHLXXXXXXXXXDLDFEHAAVYRDRLAALSHVQSHQGINPQT 255

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AI ++     +QVF+ R G+  G R +       +   +++  FL+Q Y   D
Sbjct: 256 VEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFY---D 312

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      P+ VL+S    ++  +   LS R G  V V VPQRG+K+ L++  L NA + 
Sbjct: 313 DKPC----PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREA 368

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ +++++              P RIE +D S + G + V  M+V      
Sbjct: 369 LGR----RLAETSSQARLLQGLAETFGLPRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGF 424

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR  +     D   M EVI RRF+R ++E             G P G  + 
Sbjct: 425 VKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEH------------GTPAGEVKN 472

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGEE 545
              F   P+++++DGG+ QV A ++ L ++GI D V   G+AK +      E  ++ G++
Sbjct: 473 PDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQ 532

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P  LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL H
Sbjct: 533 -PFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHH 591

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+ + +++A   ++ ++ GI E  A+ I++
Sbjct: 592 FGTAKAVSRAAVEDLMQIDGISEAMARAIHD 622


>UVRC_BRUA2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 611

 Score =  325 bits (832), Expect = 9e-91
 Identities = 217/631 (34%), Positives = 332/631 (52%), Gaps = 36/631 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVYR  +  G V+YVGKA+NL+ R+S+Y +     + R   MI     +++ V  
Sbjct: 4   LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFVVTR 62

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     + IK   PRFNV  RDDKS+PY+ +T     P +   RGAR R   YFGP
Sbjct: 63  XXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGP 122

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CSAPC   I  E+Y 
Sbjct: 123 FASAGAVGRTINALQRAFLLRTCTDSVFE---TRTRPCLLYQIKRCSAPCTYEISDEDYA 179

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  +  AF++G++                          RD + AL  V   Q +    
Sbjct: 180 GLVAEAKAFLSGKSQSVKDHLXXXXXXXXXDLDFEHAAVYRDRLAALSHVQSHQGINPQT 239

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AI ++     +QVF+ R G+  G R +       +   +++  FL+Q Y   D
Sbjct: 240 VEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFY---D 296

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      P+ VL+S    ++  +   LS R G  V V VPQRG+K+ L++  L NA + 
Sbjct: 297 DKPC----PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREA 352

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ +++++              P RIE +D S + G + V  M+V      
Sbjct: 353 LGR----RLAETSSQARLLQGLAETFGLPRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGF 408

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR  +     D   M EVI RRF+R ++E             G P G  + 
Sbjct: 409 VKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEH------------GTPAGEVKN 456

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGEE 545
              F   P+++++DGG+ QV A ++ L ++GI D V   G+AK +      E  ++ G++
Sbjct: 457 PDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQ 516

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P  LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL H
Sbjct: 517 -PFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEIVRNPLDEIAGIGPTRKRALLHH 575

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+ + +++A   ++ ++ GI E  A+ I++
Sbjct: 576 FGTAKAVSRAAVEDLMQIDGISEAMARAIHD 606


>UVRC_SHEFN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  324 bits (830), Expect = 2e-90
 Identities = 213/635 (33%), Positives = 320/635 (50%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D+H +VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D TV 
Sbjct: 13  NVTSAPGVYRMYDKHQQVIYVGKAKDLKKRLSSYFR-VNIANVKTQALVSHIDHIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++   + PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLS-GHKHPRLAYHRGPKREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   +D+CSAPCVG +  +EY
Sbjct: 131 PYPNGGAVRESLHLIQKLFPIRQCDDLYYK---SRSRPCLQYQLDRCSAPCVGIVSDDEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 SEQVKLAGLFLRGKDKQVISQLVAKMETAAIDMEYERAAQYRDQITALRRVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D DVI +      A   + ++R G+I G R +      +    +++  FL Q Y  A
Sbjct: 247 HKGDMDVIGVDYASGIACFHLLFIRDGKIFGSRSYYPSVPAETEIEEVLSSFLGQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S        + A +        +++   RGD+   +   + NA  
Sbjct: 307 DIQRT---IPKEVILSHHFDGITELQASIEHALDKKFELKTQVRGDRANFLRLAMTNASN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +A   S +     T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVATKLSHK----NTVEQRFQLLEEALELNEPIKRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G  G D D AAM + ISRRF +          +D  G+          
Sbjct: 420 PHKADYRRYNITGITGGD-DYAAMEQAISRRFDK----------IDNNGKV--------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVC-----GLAKRLEEVWLPG 543
                  P+LV +DGG  Q+  AQ  +D+  +      + +C     G    LE   + G
Sbjct: 460 -------PDLVFIDGGIGQLRVAQTIVDEKCVNIDHPPLLICVTKGEGRKAGLETFTVGG 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    +   S   +L+  +RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 513 SEQTFEVASDSPAFHLMLHIRDESHRFAITGHRNKRQKTRNTSTLESIAGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGIQEVKGASVAELTKVPGISLEMAQTIHDAL 607


>UVRC_NEIMB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 617

 Score =  324 bits (830), Expect = 2e-90
 Identities = 215/637 (33%), Positives = 327/637 (51%), Gaps = 50/637 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYRF +E G V+YVGKA NL+ R+S YFQ  +   PR   M+     ++ T+ 
Sbjct: 19  NLPNLPGVYRFFNESGNVLYVGKAVNLKRRVSGYFQK-NDHSPRIALMVKQVHHIETTIT 77

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +E EAL LE ++IK  SP++N+ +RDDKSYPYL ++   ++P++   RG  ++  +YFG
Sbjct: 78  RSESEALILENNFIKALSPKYNILFRDDKSYPYLMLS-GHQYPQMAYYRGTLKKPNQYFG 136

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  + A+RD++ +L +VF +RTC   VF+      RPCLL  I +C+APCVG I  E+Y
Sbjct: 137 PYPNSNAVRDSIQVLQKVFMLRTCEDSVFEH---RDRPCLLYQIKRCTAPCVGHISEEDY 193

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL- 251
           R    +   F+ G+T    R                     RD IQAL  +   Q +   
Sbjct: 194 RDSVREAATFLNGKTDELTRTLQHKMQTAAANLQFEEAARYRDQIQALGIMQSNQFIDSK 253

Query: 252 --GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG--KLVEQFLAQ 307
              +  D D++A+A       V    +RGGR  G++ +  D   D         E F+AQ
Sbjct: 254 NPNNPNDIDLLALAVSDGLVCVHWVSIRGGRHVGDKSFFPDTKNDPEPNGQDYAEAFVAQ 313

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y G            ++++S  P   DA+   L    G  +       G+++  ++   
Sbjct: 314 HYLGKSKP--------DIIISNFPVP-DALKEALEGEHGKQMQFVTKTIGERKVRLKMAE 364

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           +NA+  +A              +                R+ECFDIS  QGE T+AS VV
Sbjct: 365 QNAQMAIAXXXXXXXXXXHRIDELAKILGMDSDGLN---RLECFDISHTQGEATIASCVV 421

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           +++   + S+YRR++I  A+  D D AAM EV++RR+ + ++E++  GE           
Sbjct: 422 YDEQNIQPSQYRRYNITTAKPGD-DYAAMREVLTRRYGK-MQEAEANGET---------- 469

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWL 541
                       P+ V++DGG+ Q+  A    ++LG+  + + G+AK       +EE+ L
Sbjct: 470 ---------VKWPDAVLIDGGKGQIGVAVSVWEELGLH-IPLVGIAKGPERKAGMEELIL 519

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
           P   +   LP  S  L+LLQ VRDE+HRFAI+ HR+KR KA   S L DIPG+G  RR A
Sbjct: 520 PFTGEVFRLPPNSPALHLLQTVRDESHRFAITGHRKKRDKARVTSSLSDIPGVGSKRRQA 579

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LL  FG +R +  A+  ++ +V GI +  A+TIY  L
Sbjct: 580 LLTRFGGLRGVIAASREDLEKVEGISKALAETIYNHL 616


>UVRC_METTH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 579

 Score =  324 bits (830), Expect = 2e-90
 Identities = 231/632 (36%), Positives = 336/632 (53%), Gaps = 67/632 (10%)

Query: 11  PGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT 70
           P  +P   GVY FRD   RV+YVGK+ ++R R+SSYF++    +PR + M+     +++ 
Sbjct: 7   PEKLPDATGVYIFRDRDDRVLYVGKSISIRKRVSSYFREQE--NPRLRIMMRHLESIEYI 64

Query: 71  VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRY 130
           +   E EAL LE + IK Y P +NVR +DDK YP++ +T +EE+PRV ++R   R   RY
Sbjct: 65  LTQNEKEALILESNLIKRYRPPYNVRLKDDKRYPFIKIT-DEEYPRVLIVRTIGRDSARY 123

Query: 131 FGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVE 190
           +GP++   A+R T+ L+  +F +R+C        R    PCL   ID C APC GRI  E
Sbjct: 124 YGPFTDTGAVRRTLKLIKSLFRIRSC--------RRMDGPCLNSQIDLCYAPCDGRISRE 175

Query: 191 EYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV 250
           +YR + E    F  G                           IRD I+++R VME+Q   
Sbjct: 176 DYREIIEKVDLFFQGRYQXXXXXXXXXXXXASERLEFERAARIRDQIESIREVMERQHAS 235

Query: 251 LGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
             DS D D++A+      +AV V  +R G+I G+  +++         +++E FL Q Y 
Sbjct: 236 FTDSIDQDIVALERGGDTSAVVVLQIRDGKITGKDDFILR--GSAPRTEILEAFLKQYY- 292

Query: 311 GADDEESTTAIPREV---LVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
                    AIPR V   +++  P +   +  WLS+ RG  V +  P+ G  R L+    
Sbjct: 293 ---------AIPRRVPSEILTQYPVEDGVIAEWLSELRGEEVKIHSPEGGAGRRLLNIAW 343

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           KNA   L +    R +                     P R+E  DIS + GE    S+ V
Sbjct: 344 KNASVILKQKGRVRDA--------XXXXXXXXXXPEIPRRMEGLDISNIAGESATGSVAV 395

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           F DG      YRR+ I  A+G D D A M E++ RR++                   +P+
Sbjct: 396 FIDGKPSSGSYRRYRI-SAQGPD-DYAMMRELVERRYS-------------------SPE 434

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDP 547
                       P+LV++DGG+ Q+  A  AL + G+  V V G+AK+ EEV+LPG  +P
Sbjct: 435 ---------LRKPDLVLIDGGKGQLGVALEALKNCGVH-VPVVGIAKKREEVYLPGLSEP 484

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
           + +      L +L+ +RDEAHRFA+ YHR  R +    S LD I G+GPVR+ ALL+HFG
Sbjct: 485 VDV--DDGALQILRHLRDEAHRFAVKYHRTIRDRDSLESELDGIRGVGPVRKRALLEHFG 542

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
           S+  +  A+  E+A +PG+    A+ I+   +
Sbjct: 543 SLDGVRDASVEELASIPGMTREVAERIHRHFS 574


>UVRC_BRUSU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 611

 Score =  323 bits (829), Expect = 2e-90
 Identities = 217/631 (34%), Positives = 331/631 (52%), Gaps = 36/631 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P +PGVYR  +  G V+YVGKA+NL+ R+S+Y +     + R   MI     +++ V  
Sbjct: 4   LPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSN-RITRMIRETVTMEFVVTR 62

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     + IK   PRFNV  RDDKS+PY+ +T     P +   RGAR R   YFGP
Sbjct: 63  XXXXXXXXXXNLIKRSRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGP 122

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CSAPC   I  E+Y 
Sbjct: 123 FASAGAVGRTINALQRAFLLRTCTDSVFE---TRTRPCLLYQIKRCSAPCTYEISDEDYA 179

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  +  AF++G++                          RD + AL  V   Q +    
Sbjct: 180 GLVAEAKAFLSGKSQSVKDHLXXXXXXXXXDLDFEHAAVYRDRLAALSHVQSHQGINPQT 239

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AI ++     +QVF+ R G+  G R +       +   +++  FL+Q Y   D
Sbjct: 240 VEEADVFAIHQEGGMTCIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFY---D 296

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      P+ VL+S    ++  +   LS R G  V V VPQRG+K+ L++  L NA + 
Sbjct: 297 DKPC----PKLVLLSETVEEQSLITEALSTRAGHKVQVSVPQRGEKKELVQHALTNAREA 352

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ +++++              P RIE +D S + G + V  M+V      
Sbjct: 353 LGR----RLAETSSQARLLQGLAETFGLPRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGF 408

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR  +     D   M EVI RRF+R ++E             G P G    
Sbjct: 409 VKNQYRKFNIRSTDITPGDDFGMMREVIERRFSRLVKEH------------GTPAGEVEN 456

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGEE 545
              F   P+++++DGG+ QV A ++ L ++GI D V   G+AK +      E  ++ G++
Sbjct: 457 PDAFPAWPDVILIDGGQGQVGAVRQILGEMGISDLVTAIGIAKGVDREAGRERFFMEGKQ 516

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P  LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL H
Sbjct: 517 -PFTLPPRDPVLYFIQRLRDEAHRFAIGTHRARRKKEMVRNPLDEIAGIGPTRKRALLHH 575

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+ + +++A   ++ ++ GI E  A+ I++
Sbjct: 576 FGTAKAVSRAAVEDLMQIDGISEAMARAIHD 606


>UVRC_GEOKA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 590

 Score =  323 bits (827), Expect = 3e-90
 Identities = 221/640 (34%), Positives = 331/640 (51%), Gaps = 64/640 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           L+ K   +P  PG Y  +D+HG VIYVGKAK+L+AR+ SYF   +  H  +TQ ++   A
Sbjct: 5   LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYF---TGTHDGKTQRLVEEIA 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++  EAL LE + IK++ P++NV  +DDKSYP++ +T  E+ PR+ + R  ++
Sbjct: 62  DFEYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDKSYPFIKITA-EKHPRLLITRKVKK 120

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
            G +YFGPY    A  +T  LL R++P+R CS           R CL  ++ +C APCV 
Sbjct: 121 DGGKYFGPYPNVQAANETKKLLDRLYPLRKCST-------LPSRACLYYHMGQCLAPCVH 173

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +  E+ +A+ E    F+ G      R                     RD I A+   ME
Sbjct: 174 PVSDEQNKAMVEQIVRFLNGGYEDVKRELAEKMHEAAETLEFERAKEYRDQIAAIEMTME 233

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           KQ ++L D  D DV   A D+    VQVF++R G++      +    +D     L   FL
Sbjct: 234 KQKMMLNDFIDRDVFGYAYDKGWMCVQVFFLRQGKLIERDVSIFPLYQDPDEEMLT--FL 291

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y  A   +     P+EV++   P+D D  +A    R    V V  P++G K+ L+E 
Sbjct: 292 GQFYAKAHHLK-----PKEVVL---PSDIDGELA----RELLGVAVVQPKKGKKKELVEL 339

Query: 366 VLKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
             KNA   L    +  +R  + T ++               P RIE FD S + G   V+
Sbjct: 340 ASKNAAIALKEKFYFIERDEERTIKA---VERLGERLGIPAPRRIEAFDNSNIYGADPVS 396

Query: 424 SMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGES 483
           ++VVF DG   K EYR++ ++   G + D   M EV+ RR+TR L+E             
Sbjct: 397 ALVVFLDGKPAKKEYRKYKVKTVAGPN-DYETMREVVRRRYTRVLKE------------- 442

Query: 484 GAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEE 538
           G P             P+L+++DGG+  ++A +  L+ +LG+ DV + GLAK    R  E
Sbjct: 443 GLPL------------PDLIIIDGGKGHLSAVRDVLENELGL-DVPLAGLAKDEKHRTSE 489

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           +      D + L R S+  YLLQR++DE HRFA+ +HR+ R K +  SVLDDIPG+G  R
Sbjct: 490 LLAGDPPDVVPLDRQSQEFYLLQRIQDEVHRFAVMFHRKTRQKTMFHSVLDDIPGVGEKR 549

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           + ALL +FGSV+++ +AT  E+     I    A+ IYE+L
Sbjct: 550 KKALLNYFGSVKKMKEATVEELQRA-NIPRAVAEKIYEKL 588


>UVRC_SHESM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  322 bits (826), Expect = 4e-90
 Identities = 230/635 (36%), Positives = 337/635 (53%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   EY
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRTRPCLQYQLSRCSAPCVGKVSNAEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V  G
Sbjct: 188 DEQVKLASLFLKGKDKQVISELVAKMXXXXXXXXXXXXXRFRDQIMALRRVAEQQEVS-G 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           ++ D DVI +      A   + ++R G+I G R +           +++  FL Q Y  A
Sbjct: 247 NTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPAQTDIEEVLRSFLLQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S          A +S+       ++   R D+ + +   L NA  
Sbjct: 307 DIQRT---IPKEVVISXXXXXXXXXXAAVSEALNKKFSIKTNVRADRASFLRLALTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVMT----RLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K+EYRR++I G    D D AAM + ISRRF +          +D  G+          
Sbjct: 420 PHKAEYRRYNIEGITPGD-DYAAMKQAISRRFDK----------IDASGKI--------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TESSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+A+VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELAKVPGISIEMAQTIHDAL 607


>UVRC_SHEON RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  322 bits (826), Expect = 4e-90
 Identities = 229/635 (36%), Positives = 337/635 (53%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ 
Sbjct: 13  TVTSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   EY
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRTRPCLQYQLSRCSAPCVGKVSNAEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V  G
Sbjct: 188 DEQVKLASLFLKGKDKQVISELVAKMXXXXXXXXXXXXXRFRDQIMALRRVAEQQEVS-G 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           ++ D DVI +      A   + ++R G+I G R +           +++  FL Q Y  A
Sbjct: 247 NTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPAQTDIEEVLRSFLLQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S          A +S+       ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISXXXXXXXXXXAAVSEALNKKFSIKTNVRADRASFLRLAITNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVMT----RLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K+EYRR++I G    D D AAM + ISRRF +          +D  G+          
Sbjct: 420 PHKAEYRRYNIEGITPGD-DYAAMKQAISRRFDK----------IDASGKI--------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+A+VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELAKVPGISIEMAQTIHDAL 607


>UVRC_PSEFL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  322 bits (826), Expect = 4e-90
 Identities = 205/629 (32%), Positives = 319/629 (50%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL++RL+SYF+  + L P+T  ++                
Sbjct: 18  PGVYRMFDSDTRLLYVGKAKNLKSRLASYFRK-TGLAPKTAALVGRXXXXXXXXXXXXXX 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                    KE+ P +N+  RDDKSYPY+ ++ + EFPR  + RGA+++  +YFGPY  A
Sbjct: 77  XXXXXXXXXKEWRPPYNILLRDDKSYPYVFLS-DGEFPRFSIHRGAKKQKGKYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +K      RPCL   I +C APCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFMVRQCEDSYYKNRT---RPCLQYQIKRCKAPCVGLVEAEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G S D 
Sbjct: 193 HSVMFLEGRSNALTDELSAGMEQAASTLDFEKAAELRDQISLLRRVQDQQSME-GGSGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +    +++  FL Q +  + + + 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVAEVMSAFLGQYFLSSPERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D  A++A + + RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPSELIVNVVHEDFPALIAAIQELRGRELSISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            S R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -SARLANRQHVAARFEALAEVLNLDEPPQRLECYDISHSSGEATVASCVVFGPEGPLKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF++  +   ++                       
Sbjct: 424 YRRYNIEGVTAGD-DYAAMHQALTRRFSKLKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L        L 
Sbjct: 460 --PDILLVDGGKGQLSMARDVLNELAVPDLILLGVAKGATRKTGFETLYLNDAAHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R K    S L+D+ G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEDVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A+ IY  L S
Sbjct: 578 LSRASIEEIAKAPGISKKLAELIYANLHS 606


>UVRC_HAEIE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  322 bits (826), Expect = 4e-90
 Identities = 216/633 (34%), Positives = 320/633 (50%), Gaps = 51/633 (8%)

Query: 17  DPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEV 76
           +PGVYR  D+  +VIYVGKAK+L+ RLSSYF+  +    +T+ ++++   +D        
Sbjct: 14  EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDTMXXXXXX 72

Query: 77  EALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSY 136
                 +++IK Y PR+NV  RDDKSYP++ +T  E  PR+   RG+++    YFGPY +
Sbjct: 73  XXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPH 131

Query: 137 AWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEYRAL 195
           A A+R+T+ LL ++FPVR C   V+    +  RPCL   I +CSAPCV G +  EEY   
Sbjct: 132 AGAVRETLSLLQKLFPVRQCENSVYS---NRSRPCLQYQIGRCSAPCVQGYVSDEEYNQQ 188

Query: 196 AEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDST 255
            E    F+ G+    L                      RD IQA+R+V+EKQ V      
Sbjct: 189 VELARLFLQGKDQLVLDYLIGKMEQASRNLDFEQAARYRDQIQAVRSVIEKQFVSNERLD 248

Query: 256 DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDE 315
           D D+++IA     A VQV ++R G++ G R +      +    +L E F+ Q Y      
Sbjct: 249 DMDIMSIAYQHGLACVQVMFIRQGKVLGNRSYFPKVPANTDLSELTETFVGQFYLQGHQG 308

Query: 316 ESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLA 375
            S   IP  ++V  + A++  +   L+ + G  V ++   +GDK   ++    NA+  L 
Sbjct: 309 RS---IPNSIIVDRQLAEKSELEQLLTDQAGRKVTIQESVKGDKSKYLQLAQVNAKAALN 365

Query: 376 RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARK 435
               Q     ++R                  R+ECFDIS   G  TVAS VVF      K
Sbjct: 366 VQLKQ-----SSRMSERYQALCDLLNLPEIKRMECFDISHTMGNQTVASCVVFNQEGPLK 420

Query: 436 SEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPR 495
           S+YRRF+I G  G D D AAM + + +R+ R LEE +                       
Sbjct: 421 SDYRRFNIEGITGGD-DYAAMEQALQKRYERDLEEDKI---------------------- 457

Query: 496 FAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKRL------EEVWLPGEE 545
               P+++ +DGG+ Q+  A      L ++       + G+AK +      E + +  +E
Sbjct: 458 ----PDIIFIDGGKGQLNRALNVFQHLQVKWDKNRPHLIGVAKGVDRRAGQEVLIISKQE 513

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             I LP  S  L+L+Q +RDE+H  AIS HR+KR KA T S L+ I G+G  RR ALLK+
Sbjct: 514 REIHLPDDSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQALLKY 573

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            G ++ + +AT  EIA VPGI  + A+TI+E L
Sbjct: 574 LGGLQGVKKATLDEIASVPGISLKLAETIFETL 606


>UVRC_PSESM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  322 bits (825), Expect = 6e-90
 Identities = 210/629 (33%), Positives = 321/629 (51%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D    ++YVGKAKNL+ RL+SYF+  +   P+T  +++               
Sbjct: 18  PGVYRMFDADATLLYVGKAKNLKKRLASYFRK-TGHAPKTGALVARXXXXXXXXXXXXXX 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                    KE+ P +N+  RDDKSYPY+ ++ +  +PR+ + RGA++   RYFGPY  A
Sbjct: 77  XXXXXXXXXKEWRPPYNILLRDDKSYPYVFLS-DGTYPRLSIHRGAKKAKGRYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    FK   +  RPCL   I +C  PCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFQVRQCEDSFFK---NRNRPCLQYQIKRCKGPCVGLVEPEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD +  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSNALSDELNASMEKAAMALDFERAAELRDQVALLRRVQDQQSMD-GGTGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +   G+++  FLAQ + G  D E 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEEVGEVMSAFLAQYFLGGVDRE- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P EV+V+    D  A++  + + RG  + +    RG +    +  + NAEQ LA  
Sbjct: 311 ---LPSEVIVNVVNEDFPALIDAIEESRGREMTISHRVRGTRARWQQLAVTNAEQALAAR 367

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            + R   + +R +              P+R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 368 LANR-QHVASRFEALAVVLNLDEP---PMRLECYDISHSSGEATVASCVVFGPEGPIKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+I G    D D AAM++ ++RR++R                    +  E K P   
Sbjct: 424 YRRFNIEGVTAGD-DYAAMHQALTRRYSRI-------------------KAGEGKLP--- 460

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
              ++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L        LP
Sbjct: 461 ---DVLLVDGGKGQMSMARDVLNELQVPDLILLGVAKGTTRKAGFETLYLNDAAHEFTLP 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ I G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGIAGVGPTRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A++IY  L S
Sbjct: 578 LSRASIDEIAKAPGISKKLAESIYANLHS 606


>UVRC_EDWI9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  322 bits (825), Expect = 6e-90
 Identities = 233/637 (36%), Positives = 345/637 (54%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  D    VIYVGKAK+L+ RLSSYF+   A   +T+ ++   A +D TV 
Sbjct: 13  TVTNQPGVYRMYDAGAEVIYVGKAKDLKKRLSSYFRCQLASR-KTEALVRQIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++  +  PR+ V RGARR    YFG
Sbjct: 72  HTETEALLLEHNYIKRYQPRYNVLLRDDKSYPLIFLSA-DRHPRLAVHRGARRARGDYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  A A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +   E
Sbjct: 131 PFPNANAVRETLALLQKLFPIRQCEDSVY---RNRSRPCLQYQIQRCLGPCVTGLVNDGE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + +                       D IQA+R V E+Q  + 
Sbjct: 188 YARQVEYVRLFLSGKDSQVIDALVARMXXXXXXXXXXXXXXXXDQIQAVRRVTERQ-FIS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GD  D DVI +A +   A + V ++R G++ G R +        +  ++++ F+ Q Y  
Sbjct: 247 GDHEDIDVIGVAFEAGMACIHVLFIRHGQVLGSRSYFPRVPAGTTLAEVLQTFVGQFY-- 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                    +P E+L+     DR  +   +S+  G  + ++   RGD+   ++    NA 
Sbjct: 305 -LQGSQIRTLPGEILIDFLLPDRKLLADSISELAGRRIPIQSQPRGDRARYLKLARTNAV 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    SQ+++                       R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 TALNSKLSQQSTIXXXXXXXXXXXXXADIQ-----RMECFDISHTMGEETVASCVVFDRN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I+G    D D AAM +V+ RR+ + L E +                   
Sbjct: 419 GPLRSEYRRYNIKGITPGD-DYAAMDQVLRRRYDKALNEEK------------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++ +DGG+ Q+  A++   +L +        + G+AK       LE ++ 
Sbjct: 459 -------IPDIIFIDGGKGQLGQAKQVFAELEVPWDTHRPLLLGIAKGSDRKAGLETLFF 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             + +   LP  S  L+L+Q +RDE+H  AI+ HR++RAK  + S L+ I G+GP RR  
Sbjct: 512 EAQGEGFSLPPDSPALHLIQHIRDESHNHAIAGHRKRRAKVRSTSALESIEGIGPKRRQL 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI    A+ I+  L
Sbjct: 572 LLKYMGGMQPLRDASIDEIAKVPGISAALAEKIHYAL 608


>UVRC_SOLUE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  322 bits (824), Expect = 8e-90
 Identities = 216/637 (33%), Positives = 314/637 (49%), Gaps = 45/637 (7%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           LR K G +P  PGVY ++D  G+VIYVGKAK+LR R+ SYF +      +T T+I+ A D
Sbjct: 3   LRDKVGQLPFSPGVYLYKDSGGKVIYVGKAKSLRNRVRSYFSEDKLGDIKTGTLITEACD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           +D+ +V+ E EAL LE + IK+Y PRFN+  RDDK+YPY+ VT NE++PRV V R  R+ 
Sbjct: 63  IDYILVDNEKEALALENNLIKQYKPRFNILLRDDKTYPYVKVT-NEKYPRVYVTRRLRKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G +YFGP+  A      V  + R F V +C   +    R   +PCL  +I +C  PCV  
Sbjct: 122 GAQYFGPFFPANLAHRLVHFIHRHFQVPSCKVDL---TRFHPKPCLQFHIHRCLGPCVQG 178

Query: 187 IGVEE-YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           +  +E Y A   D   F+ G      R                    +RD I  +  + E
Sbjct: 179 LTTDEAYAAAVRDVRLFLDGRHSDLARGLRARMEAASLEMRFEEAAGLRDLITTVEEIEE 238

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
           +Q +      D D+ A+  +    A+ +F++R G+I   R    +   +      +   L
Sbjct: 239 RQKMAAAKGDDVDIFAVYAEPPLVALNIFHLRNGQIVDRRELFWEDQFEYDESLFLSSLL 298

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
            Q Y   D +     +P E+ V                +R   V++R PQRG K+AL+  
Sbjct: 299 KQIY--LDQQ----FVPAEIHVPVXXXXXXXXXXXXXXKRQRRVEIRTPQRGQKKALLGL 352

Query: 366 VLKNAEQTL-ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
           V  NA+ +  AR +  + S    +                P RIECFDIS +QG   VAS
Sbjct: 353 VETNAKHSFDARFRVLKPSSRAIQE----ALQDALNLPDAPSRIECFDISHIQGTDKVAS 408

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           MVV+EDG  +KS+YR+F IR   G D D A+M EV++RR++R  EE Q +          
Sbjct: 409 MVVWEDGKMKKSDYRKFIIRTVVGND-DFASMREVVTRRYSRLQEEKQPM---------- 457

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGE 544
                          P LV++D                   D  +  +AKR E +++ G+
Sbjct: 458 ---------------PGLVLIDXXXXXXXXXXXXXXXXXXXDQPLASIAKREEIIYVFGQ 502

Query: 545 ED-PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           ED P++L R S  L+L+Q +RDEAHRFA+++HR  R      S LD I G+G      LL
Sbjct: 503 EDEPVVLDRFSPILHLVQSIRDEAHRFAVTFHRSLRNTRQLTSELDAIRGVGAKTVQKLL 562

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           K FGS+ R+  AT  ++A V  +G   A+ +    T+
Sbjct: 563 KEFGSLERVRAATETQLATV--VGRAAAKRVIAHYTT 597


>UVRC_SHESA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  322 bits (824), Expect = 8e-90
 Identities = 230/634 (36%), Positives = 336/634 (52%), Gaps = 49/634 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           + +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ +
Sbjct: 14  VSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVTLTH 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFGP
Sbjct: 73  SETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   EY 
Sbjct: 132 YPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRTRPCLQYQLSRCSAPCVGKVSNAEYD 188

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ G+  + +                      RD I ALR V E+Q V  G+
Sbjct: 189 EQVKLASLFLKGKDKQVISELVAKMXXXXXXXXXXXXXRFRDQIMALRRVAEQQEVS-GN 247

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
           + D DVI +      A   + ++R G+I G R +           +++  FL Q Y  AD
Sbjct: 248 TGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPAQTDIEEVLRSFLLQFYLNAD 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
            + +   IP+EV++S          A +S+       ++   R D+ + +   L NA   
Sbjct: 308 IQRT---IPKEVVISXXXXXXXXXXAAVSEALNKKFSIKTNVRADRASFLRLALTNATNA 364

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           +      R S   T  +                R+ECFDIS   GE TVAS VVF     
Sbjct: 365 VMT----RLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREGP 420

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
            K+EYRR++I G    D D AAM + ISRRF +          +D  G+           
Sbjct: 421 HKAEYRRYNIEGITPGD-DYAAMKQAISRRFDK----------IDASGKI---------- 459

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPGE 544
                 P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE +     
Sbjct: 460 ------PDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGDT 513

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
           E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL+
Sbjct: 514 ETSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALLQ 573

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           H G ++ +  A+ AE+A+VPGI    AQTI++ L
Sbjct: 574 HLGGLQEVKGASVAELAKVPGISIEMAQTIHDAL 607


>UVRC_NOVAD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 658

 Score =  322 bits (824), Expect = 8e-90
 Identities = 223/637 (35%), Positives = 325/637 (51%), Gaps = 49/637 (7%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           TL+PKPG       VYR  D  G V+YVGKA+ L+ R+++Y Q    L  R + M+S   
Sbjct: 59  TLKPKPG-------VYRMLDARGDVLYVGKARALKNRVANYTQ-VERLPNRLRRMVSQTR 110

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
            +     N+           IK + P +NV  RDDKS+P++ +  +  FPR+   RGAR+
Sbjct: 111 SMTIVTTNSXXXXXXXXXQLIKRFRPPYNVLLRDDKSFPFILLRGDHAFPRISKHRGARK 170

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
               Y+GP++ A ++  T++ L ++F +R+C+ G   R     RPCLL  I +CSAPCVG
Sbjct: 171 AKGNYYGPFASAGSVNTTINALQKLFLLRSCNDGFMARR---DRPCLLYQIRRCSAPCVG 227

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
           RI   +Y  L      F+ G++G   R                              +  
Sbjct: 228 RISEADYGELVRQAKDFLGGKSGAVQREIEAQMHKAAEDLDFEXXXXXXXXXXXXTFIQG 287

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFL 305
            QA+      + DV A+A    + AVQ F++RGG+  G R +     E +S  +++  FL
Sbjct: 288 SQAINAEGVGNADVFAMATKGGQVAVQAFFIRGGQNWGHRAFFPSHTEGLSEEEVMTSFL 347

Query: 306 AQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMET 365
           AQ Y     EE   A  R +LV                  G  V++ VPQRGD+R LME 
Sbjct: 348 AQFY-----EEVPPA--RLILVDRXXXXXXXXXXXXXXXXGGKVEISVPQRGDRRRLMEQ 400

Query: 366 VLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             +NA + L R    R ++  T++K              P RIE +D S +QG + + +M
Sbjct: 401 AQRNAVEALDR----RMAESGTKAKVMRELAEFLELPEVPQRIEIYDNSHIQGTNALGAM 456

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VV       K +YR+++I+ A+  D D A M EV++RRF R  EE       D   ESG 
Sbjct: 457 VVAGPEGFVKGQYRKWNIKLAQTND-DFAMMREVMTRRFGRAQEE-------DPDRESGN 508

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEV 539
                         P+LV++DGG+ Q++A + AL +LGIEDV +  +AK         EV
Sbjct: 509 W-------------PDLVLIDGGKGQMSAVKEALGELGIEDVPLVAIAKGPHHGREGREV 555

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           +   +    +LP  S  L+ LQ +RDE HRFAI  HR KR++A+TAS LD+IPG+GP R+
Sbjct: 556 FHFPDGREKMLPVNSPVLFQLQVMRDEVHRFAIGAHRAKRSRAITASPLDEIPGIGPARK 615

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
            ALL HFG+  ++  A+  ++   PG+    AQTIY+
Sbjct: 616 RALLLHFGTAGKVRAASLEDLQRAPGVSAAVAQTIYD 652


>UVRC_SHESR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  321 bits (823), Expect = 1e-89
 Identities = 230/635 (36%), Positives = 336/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLGNVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG  R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPLREKGYYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   EY
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRTRPCLQYQLSRCSAPCVGKVSNAEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V  G
Sbjct: 188 DEQVKLASLFLKGKDKQVISELVAKMXXXXXXXXXXXXXRFRDQIMALRRVAEQQEVS-G 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           ++ D DVI +      A   + ++R G+I G R +           +++  FL Q Y  A
Sbjct: 247 NTGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPTVPAQTDIEEVLRSFLLQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S          A +S+       ++   R D+ + +   L NA  
Sbjct: 307 DIQRT---IPKEVVISXXXXXXXXXXAAVSEALNKKFSIKTNVRADRASFLRLALTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVMT----RLSHKNTVEQRFVLLEEILELNAPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K+EYRR++I G    D D AAM + ISRRF +          +D  G+          
Sbjct: 420 PHKAEYRRYNIEGITPGD-DYAAMKQAISRRFDK----------IDASGKI--------- 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGLGQLRIAQQIVDEKFVNLDKAPQLIGVAKGESRKPGLETLIFGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TESSFSLEDDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+A+VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELAKVPGISIEMAQTIHDAL 607


>UVRC_BURM1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 674

 Score =  321 bits (823), Expect = 1e-89
 Identities = 218/672 (32%), Positives = 329/672 (48%), Gaps = 65/672 (9%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDAAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RGA  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-SHRFPRMAYYRGAVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  E+Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAISAEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     ++                    +R+ + +L TV+ +QA+ +G 
Sbjct: 195 VDVSNAARFLLGRQSEVMKELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGS 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGLGXXXXXXXXX 314

Query: 298 ------------------------GKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPAD 333
                                    ++++ F+AQ Y G         +P  ++VS  PA 
Sbjct: 315 XXXXXXXXXXXXXGSARDTTASIEAEVLDAFIAQHYLG-------NRVPPVLVVSHAPAS 367

Query: 334 RDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXX 392
           RD ++  LS++ G  V  VR PQ G +RA +    +NA+  LAR  S++ S    R++  
Sbjct: 368 RD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLSMAEQNAQIALARLLSEQGSQ-QARTRAL 424

Query: 393 XXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSD 452
                        LRIECFDIS   GE T AS VV+     +  EYRR++I G    D D
Sbjct: 425 AETLGLECDDLATLRIECFDISHTMGEATQASCVVYHHHKMQSGEYRRYNITGITPGD-D 483

Query: 453 VAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQV 512
            AAM +V++RR+ + +E              G    + R+A   +  PN+V++DGG+ QV
Sbjct: 484 YAAMRQVLTRRYEKMVE--XXXXXXXXXXXXGIDGESTRQAEASSLLPNIVLIDGGKGQV 541

Query: 513 AAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYLLQRVRDE 566
             A++   +LG++   + G+AK       LE +       P+ L + S  L L+ ++RDE
Sbjct: 542 EIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRAPLELGKESAALMLVAQIRDE 601

Query: 567 AHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGI 626
           AHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R              GI
Sbjct: 602 AHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGXXXXXXXXXXXXDGI 661

Query: 627 GERTAQTIYERL 638
               A+ IY++L
Sbjct: 662 SHALAEQIYKQL 673


>UVRC_BACLD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 590

 Score =  321 bits (823), Expect = 1e-89
 Identities = 230/657 (35%), Positives = 339/657 (51%), Gaps = 98/657 (14%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           ++ K   +P  PG Y  +D    VIYVGKAK L+ R+ SYF    +   +TQ ++S   D
Sbjct: 5   IKEKLALLPDQPGCYLMKDRQDTVIYVGKAKILKNRVRSYFS--GSHDAKTQRLVSEIED 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V ++ +EAL LE + IK+Y P++NV  +DDKSYP++ +T NE  P++ V R  ++ 
Sbjct: 63  FEYIVTSSNIEALILEMNLIKKYDPKYNVMLKDDKSYPFIKIT-NERHPKLVVTRKVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             RYFGPY    A R+T  LL R++P+R C       A+   R CL  ++ +C APCV  
Sbjct: 122 KGRYFGPYPNVQAARETKKLLDRLYPLRKC-------AKLPDRVCLYYHLGQCLAPCVYD 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E  R L E+   F+ G      +                     RD I  + + MEK
Sbjct: 175 VSEETNRQLTEEITRFLKGGYNEVKKELEAKMLEASENLQFERAKEFRDQIAHIESTMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLV----E 302
           Q ++L D  D DV A + D+    VQVF++R G++  ER        DVS   L     E
Sbjct: 235 QKMMLNDMVDRDVFAYSYDKGWMCVQVFFIRQGKLI-ER--------DVSMFPLYREADE 285

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG----- 357
           +FL  T+ G    ++   +P+E+LV  +  D+D +   L       V+VR P+RG     
Sbjct: 286 EFL--TFIGQFYSKNNHFLPKEILV-PDSVDKDMIEELLD------VNVRQPKRGXXXXX 336

Query: 358 ----------DKRALMETVLKNAEQTL-ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL 406
                             + ++ E+T+ A  K  +A D+ T                 P 
Sbjct: 337 XXXXXXXXXXXXXXXFSLIERDEERTIGAIEKLGKALDIYT-----------------PY 379

Query: 407 RIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTR 466
           RIE FD S +QG   V++MVVF DG   K EYR++ I+  EG D D  +M EVI RR+TR
Sbjct: 380 RIEAFDNSNIQGTDPVSAMVVFLDGKPHKKEYRKYKIKTVEGPD-DYGSMREVIRRRYTR 438

Query: 467 YLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIE 525
            L+E+  +                         P+L+++DGG+ QV+AA   L+ +LG+ 
Sbjct: 439 VLKENLPL-------------------------PDLILIDGGKGQVSAALDVLENELGL- 472

Query: 526 DVAVCGLAK----RLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAK 581
           DV V GL K    R   + +    + + L R S+  YLLQR++DE HRFAIS+HR+ R K
Sbjct: 473 DVPVAGLVKDDKHRTSNLLIGDPLEIVQLERNSQEFYLLQRIQDEVHRFAISFHRQLRGK 532

Query: 582 ALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +   SVLD IPG+G  R+  LLKHFGSV+++ +A+A +I ++ GI  +TAQ I E L
Sbjct: 533 SAFQSVLDGIPGVGEQRKKLLLKHFGSVKKMKEASAEDIRKL-GIPLKTAQLIEEAL 588


>UVRC_SYNY3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 626

 Score =  321 bits (822), Expect = 1e-89
 Identities = 206/627 (32%), Positives = 310/627 (49%), Gaps = 43/627 (6%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVY   D  G ++Y+GKAK LR R+ SYF+D      R   M+   A++++ V +T   
Sbjct: 28  PGVYFMGDRQGEILYIGKAKKLRTRVRSYFRDSQPHTARIALMVQQVAEIEFIVTDTXXX 87

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYFGPYS 135
                   IK++ P FNV  +DDK YPY+ +T +E +PR+ + R  R      RY+GPY 
Sbjct: 88  XXXXXXXXIKQHQPHFNVLLKDDKKYPYVCITWSETYPRIFITRKRRLNQAKDRYYGPYV 147

Query: 136 YAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRAL 195
            ++++R T+ L+ R+FP+R     +FK      RPCL   I +C   C   I  E+YR  
Sbjct: 148 DSFSLRQTLRLIQRIFPLRQRRQPLFKH-----RPCLNYDIGRCPGVCQELITPEDYRQT 202

Query: 196 AEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL-GDS 254
            +       G T    +                    IRD I +L  +   Q V L  D+
Sbjct: 203 LQKVAMVFQGRTQELHQLLTQQMEKAAADLKFEQAALIRDQINSLGKLNADQKVSLPQDT 262

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVE-DVSTGKLVEQFLAQTYGGAD 313
              D IA+A D   +A+Q+F +R GR+ G  G+  D VE ++  G+++++ L Q Y    
Sbjct: 263 ISRDAIAVASDGQISAIQLFQIRAGRLVGRLGFFADGVESELEKGEVLQRVLEQHY---- 318

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
            +     IP EV++     D + +  WL+ +RG  V   +PQR  K  L+E V +NA+  
Sbjct: 319 QQVEAVEIPSEVILPCALPDGELLNDWLTSQRGRKVTFNLPQRQTKAELLEMVERNAQYE 378

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R + Q A ++T                  P RIE +DIS +QG + VAS VVF DG+ 
Sbjct: 379 LERLQKQTAKNVTA----LEDLAEILNLETLPKRIEGYDISHIQGSNAVASQVVFIDGVP 434

Query: 434 RKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
            +  YR + I+      G   D A++ EVI RRF   ++  +   +              
Sbjct: 435 AQQYYRHYKIKNPSIKVGHSDDFASLAEVIIRRFQSSVKGKKNQQDW------------- 481

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAA-AQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPII 549
                    P+L+++DGG+ Q++A               V  LAK+ EE++LPGE  P+ 
Sbjct: 482 ---------PDLIMIDGGKGQLSAXXXXXXXXXXXXXFTVVSLAKQREEIFLPGESQPLP 532

Query: 550 LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSV 609
                 G+ LL+R+RDEAHRFA+S+H             D+IPGLG  R+  LL HF S+
Sbjct: 533 THAEQPGVQLLRRLRDEAHRFAVSFHXXXXXXXXXXXXXDEIPGLGFSRQKQLLAHFRSL 592

Query: 610 RRLAQATAAEIAEVPGIGERTAQTIYE 636
             + +A+  ++ EVPGIG + AQTIY+
Sbjct: 593 DYIREASVKQLQEVPGIGPQLAQTIYD 619


>UVRC_DICT6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 599

 Score =  320 bits (821), Expect = 2e-89
 Identities = 208/631 (32%), Positives = 322/631 (51%), Gaps = 50/631 (7%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K  + P   GVY F D  G+VIYVGKAKNLR R+ SYF D S   P++  ++  A +
Sbjct: 10  LKQKVENFPESTGVYIFYDHSGKVIYVGKAKNLRKRVLSYFNDDS---PKSNYILKKAKN 66

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           +++ + +TE EAL LE   IK+Y P  NV+ RDDK YP L +TL EE+PR+ + R     
Sbjct: 67  IEFYITDTETEALILESVLIKKYRPIMNVQLRDDKQYPMLKLTLYEEYPRLVLARRFEDD 126

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G RY+GPY+ +  +R+T+ ++ ++F +R+C+  + K      RPCL  +I  C APC   
Sbjct: 127 GARYYGPYTQSGTVRETISMVKKIFNLRSCNWNLPK--SKPKRPCLNYFIGNCKAPCQNY 184

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  EEY  + +    F+ G+    +                     IRD I+ L+ + EK
Sbjct: 185 ITKEEYWEIVKGVIDFLDGKYEEIIEKLYDQMQEYSKNLEFEKAAKIRDKIRLLQNLSEK 244

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +V  +  + D+I    +  +A   V+ +R G++  +R + +   E  S  +L+E F+ 
Sbjct: 245 QKIVSFNRENKDLIQFYVEDHKAKALVYLIREGKLIEKRIFNLTLPEICSNDELIESFVL 304

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAV--VAWLSKRRGAAVDVRVPQRGDKRALME 364
           Q Y       S   IP EV+V   P   + V    +L KR+G+ V +R P+  ++  L+ 
Sbjct: 305 QYY-------SRGEIP-EVIVVPSPFSEEEVNLKEFLCKRKGSEVVLRTPENEEEEKLLG 356

Query: 365 TVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
             LK  + T+   KS++     +  +              P+ IE +DIS LQG   V S
Sbjct: 357 MALK--DLTIESIKSEKVWLALSELQ------RIFNLQNLPVSIEGYDISNLQGREAVGS 408

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
            V F++G                   +D   + EVI RR     E+              
Sbjct: 409 RVYFQNGYPEXXXXXXXXXXXXPELPNDYLMLQEVIRRRLKNIEEDPL------------ 456

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGE 544
                          P+++++DGG+ Q++A     ++L IE   +  LAK  EE+++PG 
Sbjct: 457 ---------------PDIMLIDGGKGQLSAVLEVFNELKIEPKFILALAKEKEEIFVPGR 501

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            +PI+L   S  L+LLQ+VRDEAHRFA+SYHR+ R+K L  S LD IPG+G  R   LL+
Sbjct: 502 SEPILLSYDSPALHLLQQVRDEAHRFAVSYHRKLRSKKLMDSHLDKIPGVGEKRMKILLE 561

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            F ++  L +A+  ++ +VPGI E+ A+ IY
Sbjct: 562 AFSTLENLKKASLEDLKKVPGISEKIAEKIY 592


>UVRC_FINM2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  320 bits (820), Expect = 2e-89
 Identities = 197/627 (31%), Positives = 326/627 (51%), Gaps = 41/627 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY   D++  +IYVGKA +LR R+  YF D S    +   M+S     ++ +VN
Sbjct: 11  VPHKPGVYIMHDKNDEIIYVGKAIDLRRRVGQYF-DSSKKLAKVAAMVSHVEYFEYIIVN 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
            E EAL LE + IK+ SP++N+  RDDK YPY+ +T NE+FPRV   R   +   +YFGP
Sbjct: 70  NECEALVLESNLIKKNSPKYNIVLRDDKQYPYIKIT-NEKFPRVLKTRRVLKDKAKYFGP 128

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  A+A+ D +DL+   + +RTC+   F + +   RPCL  YI++C   CV  +  E+Y 
Sbjct: 129 FPNAYAVNDIIDLIHETYKIRTCNLN-FDKGQKLKRPCLNYYINRCDGMCVYDVNEEDYN 187

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G      +                    +RD I  ++ ++EKQ +    
Sbjct: 188 KELLEVENFLNGREDELTKKLTDKMMAASKNLNFELAAKLRDSITNIQVILEKQNITNTK 247

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D+I++A +     VQVF++R G+I   + +++D   + S   +V +F  Q Y    
Sbjct: 248 GLDLDMISMAREAETVCVQVFFMRNGKIIERQHFIIDNKYEESNEHIVGEFFKQFY---- 303

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                T +P++                 ++++G+ V++++P+RG+K  L+E V  NA++ 
Sbjct: 304 --IDLTYVPKQXXXXXXXXXXXXXXXXXTEKKGSKVEIKIPKRGNKTDLLEMVRVNAKEG 361

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL-RIECFDISTLQGEHTVASMVVFEDGL 432
           L ++ S+       R++              P+ RIEC+DIS   G  +V SM+VF++G 
Sbjct: 362 LDKYISRHLK--RERNRENAILDLQDITGVKPIDRIECYDISNTSGVDSVGSMIVFKNGA 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
               +YR+F I+  EGAD D A+  EV++RRF R L+  ++    D +            
Sbjct: 420 KSSKDYRKFKIKTVEGAD-DYASHREVLTRRFRRLLDSDKKDNSFDEM------------ 466

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
                  P+++++DGG+ QV  A+  L++  + D+ + GL K    R   +    EE   
Sbjct: 467 -------PSIILMDGGKGQVNIAKEVLNEFNL-DIPILGLVKDDKHRTRGIIYENEE--- 515

Query: 549 ILPRTSEGLY-LLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
           I  + +  LY LL  +++E HRFAI+YHR+   K    S LD+I  +G  R+ AL+KHF 
Sbjct: 516 IRLKVNTPLYRLLFAIQEETHRFAINYHRKLHEKNFKKSELDNIALIGEKRKKALMKHFK 575

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTI 634
           ++ R+ +A+  E+ EV G+ E+ A+ I
Sbjct: 576 TLDRIKKASVEELCEVDGMNEKAAENI 602


>UVRC_SHELP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  319 bits (818), Expect = 4e-89
 Identities = 225/635 (35%), Positives = 338/635 (53%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S  A++D T+ 
Sbjct: 13  TVSSSAGVYRMYDAQGVVIYVGKAKDLKKRLSSYFRR-NLPNVKTQALVSHIANIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +E +AL LE  +IK+Y PR+NV  RDDKSYPY+ ++     PR+   RG +R    YFG
Sbjct: 72  PSETDALILENDYIKQYMPRYNVLLRDDKSYPYIFLS-GHRHPRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C   ++ +ARS  RPCL   I +CSAPCVG+I  E+Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCD-DLYYKARS--RPCLQYQIARCSAPCVGKISDEDY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 AEQVKLASLFLRGKDQQVIATLVGKMEQAAMDLNYEDAARYRDQISALRRVAEQQEVS-S 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           DS D DVI        A   + ++R G+I G R +     ++    +++  F+ Q Y   
Sbjct: 247 DSGDMDVIGAYYASGIACFHLLFIRNGKIFGSRSYYPSVPDETEVSEVLRAFMLQFYLNV 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   +PRE++VS E  D   +   +++     + ++   R ++ + +     NA+ 
Sbjct: 307 DSQRT---LPREIVVSHEFEDIHELEEAIAQASNRRLLIKTKVRSERASFLRIADANAKN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T                   R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AV----ETRLSHQNTVXXXXXXXXXXXXQSQAINRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + I RRF + +E   ++                  
Sbjct: 420 PSKGEYRRYNISGITPGD-DYAAMKQAIGRRFDK-IEADGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +++     DVA  + G+AK       LE +    
Sbjct: 460 -------PDILFIDGGMGQLRIAQKVVNEKFAHLDVAPTLIGVAKGEGRKPGLETLIYGE 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    LP  S  L+L+Q +RDE+HRFAI+ HR KR K    S L+ IPG+GP RR ALL
Sbjct: 513 NEVAFSLPADSGALHLIQHIRDESHRFAITGHRNKRQKTRNTSTLESIPGVGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           ++ G ++++  A+ A++++VPGI    AQTI++ L
Sbjct: 573 QYLGGLQQVKGASVAQLSKVPGISLEMAQTIHDAL 607


>UVRC_POLSJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 666

 Score =  319 bits (818), Expect = 4e-89
 Identities = 243/678 (35%), Positives = 344/678 (50%), Gaps = 93/678 (13%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR+ D  G V+YVGKA+NL+ R+SSYFQ       R   M++    ++ TVV +   
Sbjct: 24  PGVYRYFDAEGGVLYVGKARNLKKRVSSYFQKNHGA-TRIGHMVTKIVRMETTVVRSXXX 82

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEE-----------FPRVQVMRGARRR 126
                   IK  +P++N+ +RDDKSYPYL +T  +            FPR+   RGA  +
Sbjct: 83  XXXXXXXXIKTLNPKYNILFRDDKSYPYLKLTAVQPSEAGSAPVATAFPRIAYYRGAVEK 142

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             RYFGPY  AWA++DT+ LL +VF +RTC   VF    +  RPCLL  I +CSAPCVG 
Sbjct: 143 KHRYFGPYPSAWAVKDTMLLLQKVFRLRTCEDTVF---NNRTRPCLLYQIKRCSAPCVGH 199

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+Y     +   F+ G+T   L                     +R+ + AL  V+ +
Sbjct: 200 VSPEQYALDTANAERFLQGQTQEILTELERKMLAHADRLEFEQAAELRNQMSALSKVLHQ 259

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVE------------- 293
           Q++ +G   D D++A+     +A V +  VRGGR  G+R +    VE             
Sbjct: 260 QSMEIGGDKDVDILAVKVQGGKACVNLAMVRGGRHLGDRPYFPTHVENATDVXXXXXXXX 319

Query: 294 ----------DVSTGKLV----------------EQFLAQTYGGADDEESTTAIPREVLV 327
                     D   GK V                E F+AQ Y           +P   LV
Sbjct: 320 XXXXXXXPESDDRAGKTVVPLPARPAKSLEALVLEAFIAQHY-------IDVPVP-PTLV 371

Query: 328 SAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTT 387
            +EP D+D + A L+ + G+ +      R  +R  ++   KN          ++ S    
Sbjct: 372 CSEPVDKDLISA-LAAQTGSKITAIHQPREQRRIWLDMAQKNXXXXXXXXXXEQGSQ-QA 429

Query: 388 RSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAE 447
           R++                RIECFDIS   GE T AS VVF+    + SEYRR++I G  
Sbjct: 430 RTRXXXXXXXXXXXXXXXXRIECFDISHTAGESTQASCVVFQGHKMQNSEYRRYNIEGIT 489

Query: 448 GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDG 507
             D D AAM +V++RR+T+ L E+ R G                     A  P+LV+VDG
Sbjct: 490 PGD-DYAAMRQVLTRRYTK-LAEAARNGN--------------------ARLPDLVLVDG 527

Query: 508 GRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYLLQ 561
           G+ QV+ A+    +LG++   + G+ K       LEE+      + + L R S  L L+ 
Sbjct: 528 GKGQVSMAREVFVELGLDLGLIAGVEKGEGRKVGLEELVFADGREKVYLGRDSAALMLIA 587

Query: 562 RVRDEAHRFAISYHRRKRAKA-LTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEI 620
           ++RDEAHRFAI+  R +RAK  +  S L+DI G+GP RRA+LL+ FG +R +A A+A +I
Sbjct: 588 QIRDEAHRFAITGMRARRAKVRVGGSKLEDIAGIGPKRRASLLQRFGGIRGIASASAEDI 647

Query: 621 AEVPGIGERTAQTIYERL 638
           A V GI +  A+ IY  L
Sbjct: 648 ATVDGISKDLAEEIYRAL 665


>UVRC_CAUCR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 640

 Score =  319 bits (818), Expect = 4e-89
 Identities = 229/639 (35%), Positives = 349/639 (54%), Gaps = 54/639 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAADVDWTVV 72
           +P  PGVYR   E   V+YVGKAK+L+ R+  Y Q     H  R   M+     +++   
Sbjct: 33  LPDAPGVYRMIGEADEVLYVGKAKSLKKRVVQYAQ--GRFHTNRIANMVDATRAMEFITT 90

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            TE +AL LE + IK+  PRFNV  RDDKS+P + +  + + P+++  RGA      YFG
Sbjct: 91  RTEADALLLEINLIKQLKPRFNVLLRDDKSFPEIVIRRDHDAPQLRKHRGAHTIKGDYFG 150

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ AWA+  T++ L + F +R+CS  V+    S  RPC+L  I +C+APC G IG ++Y
Sbjct: 151 PFASAWAVNRTLNTLQKAFLLRSCSDSVYD---SRDRPCMLYQIKRCAAPCTGLIGKDDY 207

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +AL +   AF+ G++                                   V ++  +   
Sbjct: 208 QALVDQAEAFLRGKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAQETQINPE 267

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGW------VVDKVEDVSTG---KLVEQ 303
              + DV+A+  +  +A VQVF+ R G+  G R +        D  ED +     +++  
Sbjct: 268 TVEEADVVALHVEGGQACVQVFFFRAGQNWGNRAYFPRITGAADDPEDETVTEEQRIITA 327

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
           FL Q Y   DD+     IPR +L + +PA+ + +    + + G  V++ VP+RG+K  L+
Sbjct: 328 FLGQFY---DDKP----IPRLILANVQPAESELLSEAFALKSGRKVEIAVPKRGEKADLV 380

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           + VL NA + L R  ++ ++    ++K              P RIE +D S +QG + V 
Sbjct: 381 QHVLTNAREALGRKMAEGSA----QTKLLAGVAEAFKLDAPPERIEVYDNSHIQGANAVG 436

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
            M+V       K +YR+F+I+  E     D   M EV+ RRF R ++E +   +      
Sbjct: 437 GMIVAGPEGFMKGQYRKFNIKSTELTPGDDYGMMKEVLRRRFARLVKEEEEGDD------ 490

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------L 536
                         A  P+LV+VDGG+ Q+ AA   + DLG++D+AV G+AK       L
Sbjct: 491 --------------ANRPDLVLVDGGQGQLDAAIEIMADLGVDDIAVVGVAKGPDRDAGL 536

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
           E  ++PG+  P +L   S  LY LQR+RDEAHRFAI  HR +R+  L  + LD+I G+GP
Sbjct: 537 ERFFIPGQT-PFMLEPKSPVLYYLQRLRDEAHRFAIGAHRTRRSMDLKKNPLDEIEGVGP 595

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
            R+ ALL  FGS + + +A+  ++ +V G+ +  A+ I+
Sbjct: 596 GRKKALLHAFGSAKGVGRASVEDLVKVDGVSQALAERIF 634


>UVRC_SERP5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  319 bits (817), Expect = 5e-89
 Identities = 210/637 (32%), Positives = 321/637 (50%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RL+SYF+       +T+T++   A +D TV 
Sbjct: 13  TVTSQPGVYRMYDATGTVIYVGKAKDLKKRLASYFRQQVGSR-KTETLVKNIAQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP + ++  +  PR+ V RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLSA-DSHPRLAVHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+  ++A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  +E
Sbjct: 131 PFPNSYAVRETLALLQKLFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVAGLVSEDE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           YR   +    F++G+  + L                     IRD IQA+R V E+Q  V 
Sbjct: 188 YRQQVDYVRLFLSGKDQQVLHQLIERMENASKALNFEEAARIRDQIQAVRRVTERQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           G+S D DVI +A +   A + V ++R G++ G R +           ++V+ F+ Q Y  
Sbjct: 247 GNSDDLDVIGVAFEAGMACLHVLFIRQGKVLGSRSYFPKVPGGTEMSEVVQTFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+                  G  + ++   RGD+            
Sbjct: 307 GSQMRT---LPAEILLDFTLPXXXXXXXXXXXXXGRKIQIQSKPRGDRARYXXXXXXXXX 363

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                  SQ+++     ++                R+ECFDIS   GE TVAS VVF+  
Sbjct: 364 XXXXXXXSQQSTIHQRLAELTKVLNLSEIN-----RMECFDISHTMGEQTVASCVVFDAN 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              +SEYRR++I G    D D AAM +V+ RR+ + LEE +                   
Sbjct: 419 GPLRSEYRRYNITGITPGD-DYAAMAQVLKRRYGKALEEKK------------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++ +DGG+ Q+  A    + L +        + G+AK       LE ++ 
Sbjct: 459 -------IPDVIFIDGGKGQLGMAIDVFNSLNVSWDKNKPLLIGIAKGADRKAGLETLFF 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             E + I LP  S  L+++Q +RD++H  AI+ HR++RAK    S L+ I G+GP RR  
Sbjct: 512 VPEGEGIALPSDSPALHVIQHIRDDSHNHAITGHRQRRAKVRNTSALELIDGVGPKRRQV 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L  A+  EIA+VPGI +  A+ IY  L
Sbjct: 572 LLKYMGGLQPLLNASVEEIAKVPGISQALAEKIYNAL 608


>UVRC_OCEIH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 596

 Score =  319 bits (817), Expect = 5e-89
 Identities = 219/639 (34%), Positives = 333/639 (52%), Gaps = 58/639 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           +  K   +P  PG Y  +D++G VIYVGK+K LR R+ SYF+   A   +TQ ++    D
Sbjct: 5   IEKKLSILPQQPGCYLMKDKNGTVIYVGKSKKLRNRVRSYFR--GANDRKTQRLVQEIRD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V ++E+EAL LE + IK+Y PR+NV  +DDKSYPYL +T +E  PR+ V R  ++ 
Sbjct: 63  FEYMVTSSEIEALILEMNLIKKYDPRYNVMLKDDKSYPYLKIT-SERHPRLIVTRRLKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY    A R+T  LL R++P+R C+         SGRPCL  ++ +C A     
Sbjct: 122 KGKYFGPYPNVIAARETKKLLDRMYPLRKCN-------NPSGRPCLYYHMGQCKACAENP 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
             V+EY+ + ++  +F+ G      +                    IRD IQ +   ME+
Sbjct: 175 PSVKEYQEIVQEISSFLQGGFKDIRKNLAGEMQKASEALNFERAKEIRDTIQHIDATMEQ 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q + L D  D D+   + D+    VQVF++R G++  ER   V    D S  + +  F+ 
Sbjct: 235 QKMTLTDQMDRDIFGYSYDKGWMCVQVFFIRQGKLI-ERDTSVFPFFD-SPEETIVSFIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           + Y            P++VLV     D + +   L       + V +P RG K+ L++  
Sbjct: 293 RFY-----LHENHLKPKQVLVPV-GIDNELLAKVLE------IQVHIPLRGRKKELVQLA 340

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
           +KNAE +L   K Q       R+               P RIE FD S +QG   V++M+
Sbjct: 341 VKNAEISL-NEKFQLIEKDEERTIQAIEDLGEQLNIETPHRIEAFDNSNIQGTDPVSAMI 399

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VFEDG   K EYR++ IR  +G D D   M EV+ RR++R L+E+  +            
Sbjct: 400 VFEDGKPNKKEYRKYKIRDVKGPD-DYDTMREVVRRRYSRVLKENLPL------------ 446

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK--RLEEVWLPG 543
                        P+L++VDGG+ Q++AA   L D+LG+ D+ + GLAK  R +   L  
Sbjct: 447 -------------PDLIIVDGGKGQMSAALEVLEDELGL-DIPLAGLAKDDRHKTSELLY 492

Query: 544 EEDPIILP--RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
              PI++P  R S+  YL+QR++DE HRFAI++HR+ R K+L  S LD IPG+G  RR  
Sbjct: 493 GMPPIVVPLERQSQAFYLVQRIQDEVHRFAITFHRQLRGKSLFQSELDKIPGVGEKRRKL 552

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           LL HF S+ ++ +A+  ++ ++ GI    A+ +   L S
Sbjct: 553 LLSHFKSINQIKKASIEDMRKL-GIPSNIAELVLNHLNS 590


>UVRC_THIDA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 598

 Score =  318 bits (816), Expect = 6e-89
 Identities = 224/634 (35%), Positives = 306/634 (48%), Gaps = 54/634 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           S+PT PGVYR  D  G V+YVGKAK+LR R+ SYF       PR + M+ +   +D TV 
Sbjct: 10  SLPTLPGVYRMVDAAGAVLYVGKAKDLRKRVGSYFLKTDQ-SPRIRLMLKSVDHIDTTVT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            T           IK   PRFN+ +RDDKSYPYL +T    +PR+   RGA ++  + FG
Sbjct: 69  RTXXXXXXXXXXXIKGLKPRFNILFRDDKSYPYLLLT-GHGYPRLAYFRGAPKKRDQAFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  ++A+R+++ LL +VF +RTC   VF    +  RPCLL  I +CSAPCV  +  E Y
Sbjct: 128 PYPNSYAVRESIQLLQKVFQLRTCEDTVFG---NRSRPCLLHQIKRCSAPCVSLVSAETY 184

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV-VL 251
                +    + GE                          +RD ++ L TV EKQ V   
Sbjct: 185 ARDVAEAMLLLKGEATALTEEITAQMNAAAENLDFETAAYLRDRLRMLATVREKQFVDTT 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           G                    +  +RGGR  G+R +                F+AQ Y  
Sbjct: 245 GSXXXXXXXXXXXXXXXXXXNLTMIRGGRHLGDRSFFPQHXXXXXXXXXXXXFVAQHY-- 302

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                    IP  +LVS E  D  A+   LS++ G  V ++    G++R  +     NA 
Sbjct: 303 -----LDHPIPARILVS-EAIDSAALQTLLSEQAGKKVTLQHRVTGERRVWIAMAQANAR 356

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            +  R  + RA+     +                 RIECFDIS   GE T+AS VV+E  
Sbjct: 357 LSAERRSADRANQSQRLAALRDTLELPTLN-----RIECFDISHTMGEATIASCVVYEGD 411

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             +KS+YRR++I G    D D AAM+  + +RF R +EE+   G L              
Sbjct: 412 DLKKSDYRRYNIEGITPGD-DYAAMHAALIKRFHRTVEEN---GVL-------------- 453

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPII-- 549
                   P+L+++DGG+ QVA A  AL +LGI+DV + G+AK   E   PG E  I   
Sbjct: 454 --------PDLLLIDGGKGQVAMAVEALAELGIDDVLLLGVAKG--ESRKPGLETLIFAD 503

Query: 550 -----LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
                L R   G +L+Q+VRDEAHRFAI+ HR KR KA   S L+DI G+GP RR  LL+
Sbjct: 504 GRELKLARDHPGFHLIQQVRDEAHRFAITGHRAKRGKARVQSTLEDIAGIGPKRRKQLLE 563

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           HFG ++ +  A    +A V GI    A+ IY  L
Sbjct: 564 HFGGLQGVRNAGVDALASVNGISRELAEIIYNAL 597


>UVRC_BACSU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 590

 Score =  318 bits (816), Expect = 6e-89
 Identities = 219/641 (34%), Positives = 332/641 (51%), Gaps = 66/641 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D    VIYVGKAK L+ R+ SYF    +   +TQ +++   D
Sbjct: 5   LKEKLALLPDQPGCYLMKDRQQTVIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVTEIED 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V ++ +EAL LE + IK++ P++NV  +DDK+YP++ +T +E  PR+ V R  ++ 
Sbjct: 63  FEYIVTSSNLEALILEMNLIKKHDPKYNVMLKDDKTYPFIKLT-HERHPRLIVTRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             RYFGPY    A R+T  LL R++P+R CS       +   R CL  ++ +C APCV  
Sbjct: 122 KGRYFGPYPNVQAARETKKLLDRLYPLRKCS-------KLPDRVCLYYHLGQCLAPCVKD 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  E  R L E    F+ G      +                    +RD I  + + MEK
Sbjct: 175 ISEETNRELVESITRFLRGGYNEVKKELEEKMHEAAENLEFERAKELRDQIAHIESTMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLV----E 302
           Q + + D  D DV A A D+    VQVF++R G++  ER        DVS   L     E
Sbjct: 235 QKMTMNDLVDRDVFAYAYDKGWMCVQVFFIRQGKLI-ER--------DVSMFPLYQEADE 285

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRAL 362
           +FL  T+ G    ++   +P+E+LV  +  D+  +   L        +V  P++G K+ L
Sbjct: 286 EFL--TFIGQFYSKNNHFLPKEILV-PDSIDQSMIEQLLE------TNVHQPKKGPKKEL 336

Query: 363 METVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
           +    KNA+  L    S    D   RS               P RIE FD S +QG + V
Sbjct: 337 LMLAHKNAKIALKEKFSLIERD-EERSIGAVQKLGEALNIYTPHRIEAFDNSNIQGTNPV 395

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
           ++M+VF DG   K EYR++ I+   G D D  +M EV+ RR+TR L E+  +        
Sbjct: 396 SAMIVFIDGKPYKKEYRKYKIKTVTGPD-DYGSMREVVRRRYTRVLRENLPL-------- 446

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLE 537
                            P+L+++DGG+ Q+ AA+  ++ +LG+ D+ + GLAK    R  
Sbjct: 447 -----------------PDLIIIDGGKGQINAARDVIENELGL-DIPIAGLAKDEKHRTS 488

Query: 538 EVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPV 597
            + +    +   L R S+  YLLQR++DE HRFAIS+HR+ R K+   SVLDDIPG+G  
Sbjct: 489 NLLIGDPLEVAYLERNSQEFYLLQRIQDEVHRFAISFHRQIRGKSAFQSVLDDIPGIGEK 548

Query: 598 RRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           R+  LLKHFGSV+++ +A+  +I +  G+    AQ +Y++L
Sbjct: 549 RKKMLLKHFGSVKKMKEASLEDIKKA-GVPAAAAQLLYDKL 588


>UVRC_BACA2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 590

 Score =  318 bits (816), Expect = 6e-89
 Identities = 232/637 (36%), Positives = 339/637 (53%), Gaps = 58/637 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D    VIYVGKAK L+ R+ SYF    +   +TQ ++S   D
Sbjct: 5   LKEKLALLPDQPGCYLMKDRQKTVIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVSEIED 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V ++ +EAL LE + IK+Y P++NV  +DDK+YP++ +T +E  PR+ V R  ++ 
Sbjct: 63  FEYIVTSSNLEALILEMNLIKKYDPKYNVMLKDDKTYPFIKIT-HERHPRLIVTRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             RYFGPY    A R+T  LL R++P+R CS       +   R CL  ++ +C APCV  
Sbjct: 122 KGRYFGPYPNVQAARETKKLLDRLYPLRKCS-------KLPDRVCLYYHLGQCLAPCVKD 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I  E  R + ED   F+ G                            RD +  + + MEK
Sbjct: 175 ISEETNREIVEDITRFLKGGHNXXXXXXXXXXXXXXXXXXXXRAKEFRDQLAHIESTMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q + + D  D DV A A D+    VQVF++R G++      +    ++       E+FL 
Sbjct: 235 QKMTMNDLLDRDVFAYAYDKGWMCVQVFFIRQGKLIERDVSMFPMYQEAD-----EEFL- 288

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
            T+ G    ++   +P+E+LV  +  DRD +   L         V               
Sbjct: 289 -TFIGQFYSKNNHFLPKEILV-PDSVDRDMITELLE------TAVHQXXXXXXXXXXXXA 340

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            KNA+  L R K         RS               P RIE FD S +QG + V++M+
Sbjct: 341 HKNAKIAL-REKFSLIERDEERSIGAAERLGEALNIYTPHRIEAFDNSNIQGTNPVSAMI 399

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VF DG   K EYR++ I+   G D D  +M EV+ RR+TR L E+  +            
Sbjct: 400 VFIDGKPNKKEYRKYKIKTVTGPD-DYGSMREVVRRRYTRVLRENLPL------------ 446

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEVWL 541
                        P+L+++DGG+ Q+ AA+  L+ +LG+ DV V GLAK    R   + +
Sbjct: 447 -------------PDLIIIDGGKGQINAARDVLENELGL-DVPVAGLAKDDKHRTSNLLI 492

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
               +P+ L R S+  YLLQR++DE HRFAIS+HR+ R K++  SVLDDIPG+G  R+  
Sbjct: 493 GDPLEPVFLERNSQEFYLLQRIQDEVHRFAISFHRQIRGKSVFQSVLDDIPGIGEKRKKM 552

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLKHFGSV+++ +A+  +I +  G+    AQ ++E+L
Sbjct: 553 LLKHFGSVKKMKEASLDDIKKA-GVPAAAAQLLFEKL 588


>UVRC_PROM9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 652

 Score =  318 bits (815), Expect = 8e-89
 Identities = 197/637 (30%), Positives = 323/637 (50%), Gaps = 24/637 (3%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ +   IP   G Y F+D    ++Y+GK+K LR+R+SSYF ++S L PR   M+    +
Sbjct: 28  LKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKKLRSRVSSYFNNYSDLTPRLSLMVRQITE 87

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
           ++  V ++E EAL LE + IK   P FN+  +DDK YPYL +T +E++PR+ +       
Sbjct: 88  IEIIVTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEKYPRIFITXXXXXX 147

Query: 127 GV--RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV 184
               RY+GPY     +R T+  + ++FP+R     V+K      R CL   I +C   C 
Sbjct: 148 XXLDRYYGPYVDVGLLRRTLFTIKKIFPLRQRPRPVYK-----DRTCLNYSIGRCPGVCQ 202

Query: 185 GRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVM 244
             I  ++Y+ + +       G                           IRD I  L+ + 
Sbjct: 203 EVISSDDYKKIMQQVSMIFQGRNDDLEIFLQKKMLQFSNDLDYENAAKIRDQISGLKLLT 262

Query: 245 EKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQ 303
           E Q + + DS+ + D+  I  ++  A++Q+F +R G++ G  G+   K+ +     ++++
Sbjct: 263 ESQKISIPDSSINRDIFGIVSEKNVASIQIFQMRSGKLIGRIGY-SQKLNNEDENHILQK 321

Query: 304 FLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALM 363
            L + Y   +  E    IP E+L+      +  +  WL++ R   V + +P+R  K   +
Sbjct: 322 ILEEHYMNVEAVE----IPSEILIQYNLPKQATIEDWLTELRKKKVKILIPKRNKKHETV 377

Query: 364 ETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVA 423
           E VLKNA+  L R      + +                   P RIE +DIS +QG   VA
Sbjct: 378 EMVLKNAKLELDR----ILNGIQDNESSIEDLAQILELSEQPKRIEGYDISHIQGSDPVA 433

Query: 424 SMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           S VVF DG+  K  YR++ I+      G   D A++YEVI              G+   L
Sbjct: 434 SQVVFIDGIPSKQHYRKYKIKDPNVFVGHSDDFASIYEVIHXXXXXXXXXXXXGGDFSIL 493

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEV 539
            +      ++      +  P+L+++DGG+ Q+ AA +AL++L + E+V +C LAK+ EE+
Sbjct: 494 NDK---TNSKLDNELLSDWPDLIMIDGGKGQLNAAIKALNELNLEEEVTICSLAKKNEEI 550

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           ++PG    +      +G+ LL+RVRDEAHRFA+S+HR KR+K +  S L  I GLGP R 
Sbjct: 551 FIPGFTKSLDTDENQKGVLLLRRVRDEAHRFALSFHRDKRSKRMNRSQLSQISGLGPSRI 610

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
             LL++F S+  +  A+  ++++V G+G+ +   IYE
Sbjct: 611 RELLEYFKSIDAIRIASKEDLSKVKGLGKNSVNDIYE 647


>UVRC_LISMH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  318 bits (815), Expect = 8e-89
 Identities = 213/644 (33%), Positives = 333/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++  AF+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIR----GERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y  A+       IP + +   +  D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFYQKANH------IPPKEIYLPDDVDSEAVQAVVPDTK-----IIVPQRGNKKD 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+ +L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKISL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E           
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKE----------- 444

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
             G P             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 445 --GLPM------------PDLILIDGGKGQIDSAKDVLTNELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASVEEIKEA-GVPLNVAEEVHKHITA 592


>UVRC_LISIN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  318 bits (815), Expect = 8e-89
 Identities = 213/644 (33%), Positives = 332/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++  AF+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIR----GERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y  A+       IP + +   +  D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFYQKANH------IPPKEIYLPDDVDSEAVQAVVPDTK-----IIVPQRGNKKE 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+  L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKIAL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E           
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKE----------- 444

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
             G P             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 445 --GLPM------------PDLILIDGGKGQIDSAKDVLTNELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASVEEIKEA-GVPLNVAEEVHKHITA 592


>UVRC_RHORT RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 639

 Score =  318 bits (814), Expect = 1e-88
 Identities = 216/646 (33%), Positives = 316/646 (48%), Gaps = 49/646 (7%)

Query: 3   VRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIS 62
           +R  LR    ++P+ PGVYR  D  G V+YVGKA+NL+ R+ +Y Q    L  R Q MI+
Sbjct: 33  IRAALR----TMPSSPGVYRMIDGKGDVLYVGKARNLKRRVINYTQPHR-LPVRIQRMIA 87

Query: 63  TAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRG 122
               +                + IK+  PR+N+  RDDKS+PY+ +T +  FPR+   RG
Sbjct: 88  ATLTMXXXXXXXXXXXXXXXSNLIKKLKPRYNILLRDDKSFPYIEITSDHAFPRIVKFRG 147

Query: 123 ARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
             R+G  YFGP++ A A+  T+  L + F +RTC+  VF    S  RPCLL  I +C+AP
Sbjct: 148 TLRKGGEYFGPFASAGAVTSTLTALQKTFLLRTCADNVFA---SRSRPCLLFQIKRCAAP 204

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           CV R+   +Y+AL E+  AF++G +                          RD I+AL  
Sbjct: 205 CVDRVAEADYKALVEEARAFLSGSSKALQHDLAKRMDEAAQALDYEQAAIFRDRIKALTN 264

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
           V   Q + L    + DVIA  +   +  VQV             +      D    +++E
Sbjct: 265 VQSHQDINLPTLGEADVIACHQAGGQTCVQVXXXXXXXXXXXXSFFPAHAGDEGLPEVLE 324

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRAL 362
            FL Q Y G          PRE+L+  +    D V   L  R G  V + VP+RG +R L
Sbjct: 325 AFLGQFYAGFPP-------PREILLLTDIPHHDLVEQALCLRAGHRVRLVVPRRGSRRKL 377

Query: 363 METVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPL-RIECFDISTLQGEHT 421
           ++  L NA + L R  ++ ++  T                  PL R+E +D S + G H 
Sbjct: 378 IDHALANAREALGRRLAESSAQRTLLE-----GTAVAFGLDGPLQRVEIYDNSHISGTHA 432

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
           V  MVV       K+ YR+F+IR  +     D A M EV+ RRF R  +E          
Sbjct: 433 VGGMVVAGPEGFMKAAYRKFNIRSPDITPGDDYAMMREVMIRRFARARKEDP-------- 484

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR----- 535
                    +R   ++   P+LV++DGG  Q+ A + AL ++G+EDV + G+AK      
Sbjct: 485 ---------DRDRGQW---PDLVLIDGGLGQLNAVREALAEIGVEDVPLVGVAKGPDRDA 532

Query: 536 -LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGL 594
             E  ++PG   P +L      LY +QR+RDEAHRFAI  HR +R+KA+  S LD +PG+
Sbjct: 533 GRERFFVPGRP-PFMLRHNDPVLYFIQRLRDEAHRFAIGSHRTRRSKAIGVSPLDSVPGI 591

Query: 595 GPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           G  R+ ALL HFGS + ++QA   ++  V GI    A+ +Y+   S
Sbjct: 592 GASRKKALLHHFGSAKAVSQAGLTDLEAVEGISAALAKKLYDHFHS 637


>UVRC_GEOSF RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 622

 Score =  318 bits (814), Expect = 1e-88
 Identities = 223/651 (34%), Positives = 323/651 (49%), Gaps = 65/651 (9%)

Query: 12  GSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTV 71
           G  P+ PGVY  +D    V+YVGKA++LR R+ SYF        + + +++   D+ + V
Sbjct: 8   GHFPSSPGVYIMKDAEATVLYVGKARDLRKRIRSYFAASGDSRYQIRFLMARVTDIQFIV 67

Query: 72  VNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYF 131
            +TE EAL LE + IK+Y P++N   RDDK+Y  L + ++ +FPR+ ++R   R G RYF
Sbjct: 68  TDTEKEALILENTLIKKYRPKYNFNLRDDKTYFSLRMDMSSDFPRLSIIRKVTRDGARYF 127

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPYS A   R  +  L ++FP+R       +  R   RPCL   + +CSAPC G+I  E+
Sbjct: 128 GPYSSASDARAVLKHLYKLFPLRHYP---METCRRRNRPCLFYQLKQCSAPCHGKISRED 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y             +    L+                     RD I+++   +EKQ VV 
Sbjct: 185 YMXXXXXXXXXXXXKNREILKIFRERMSXXXXXXXXXXXXRFRDLIRSIEVTVEKQKVV- 243

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGER----GWVVDKVEDVSTGKLVEQFLAQ 307
               D DVI    +  +  + + ++RGG + G R     W +D  E +++      FL +
Sbjct: 244 AQGGDSDVIGFYREGEQLHIALLFLRGGTLTGSRNYSFSWEMDDHEGIAS------FLNE 297

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y           IP E+++    AD       L + RG  V + VPQRG+K  L+   +
Sbjct: 298 YY------NQEVFIPSEIVLPIAIADPLPQEELLCELRGRRVSITVPQRGNKLELVRLAI 351

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
                                                P RIEC+DIS +QG+  V S V 
Sbjct: 352 ----XXXXXXXXXXXXXXXXXXXILQTLKERLHLHKLPRRIECYDISNIQGQMAVGSKVA 407

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           F DG A K+ YRR+ I+G   +D D A M E+ SRRF                    AP 
Sbjct: 408 FVDGKADKAHYRRYRIKGVSQSD-DFAMMREMFSRRFK----------------PGTAPD 450

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL----------- 536
                       P+L++VDGG  Q+      L DL I DV   GLAK             
Sbjct: 451 DY----------PDLIIVDGGIGQLNVLTHVLGDLQITDVEAAGLAKSRVDREMGATEIS 500

Query: 537 ---EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
              E V+LP  ++P++L + S  L LL R+RDEAHRFA++YH++ R   L AS L+ IPG
Sbjct: 501 RSDERVFLPNRKNPVVLRQNSAPLLLLARIRDEAHRFAVAYHKKLRGNKLLASQLEAIPG 560

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGG 644
           +G  RR  LL+HFGS++++++AT  E+ +V GI    A+++++ L   E G
Sbjct: 561 IGIKRRKELLRHFGSLKKISEATLEELRQVQGISATVAESLWKHLHENEKG 611


>UVRC_SHEB9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  317 bits (813), Expect = 1e-88
 Identities = 223/635 (35%), Positives = 334/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D    VIYVGKAK+L+ RL+SYF+   A + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   I +CSAPCVG++   +Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRSRPCLQYQISRCSAPCVGKVSNADY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 DEQVKLASLFLKGKDQQVISALVDKMELXXXXXXXXXXXXFRDQIMALRKVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVI +      A   + ++R G+I G R +           +++  F+ Q Y  A
Sbjct: 247 NKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPAQTDMDEVLRSFILQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S    +   + A +S+       ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISHNFEELHELEAAISEALDKKFSIKTNVRADRASFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVVT----RLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + +SRRF + +E   ++                  
Sbjct: 420 PHKGEYRRYNIEGITPGD-DYAAMKQAVSRRFDK-IEAGGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE + L  
Sbjct: 460 -------PDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELVKVPGISIEMAQTIHDAL 607


>UVRC_RHILO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 688

 Score =  317 bits (812), Expect = 2e-88
 Identities = 206/630 (32%), Positives = 318/630 (50%), Gaps = 24/630 (3%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAADVDWTVV 72
           +P  PGVYR  +  G V+YVGKA++L+ R+++Y Q     H  R   M+   + +++ V 
Sbjct: 69  LPNAPGVYRMMNAAGDVLYVGKARSLKKRVTNYAQ--GRFHTNRIGRMVRETSTMEFVVT 126

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            T            K   PRFNV  RDDKS+PY+ +T +   P +   RGAR R   YFG
Sbjct: 127 RTXXXXXXXXXXXXKRLRPRFNVLMRDDKSFPYILLTGDHVSPGIYKHRGARSRKGDYFG 186

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ A A+  T++ L R F +R+C+   ++      RPCLL  I +C+ PC G I  E Y
Sbjct: 187 PFASAGAVGRTINSLQRAFLLRSCTNSFYENRT---RPCLLYQIKRCAGPCTGEISHEGY 243

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L  +   F++G + +                        RD + AL  V   Q +   
Sbjct: 244 AELVAEAKDFLSGRSQKVKTEISAAMQQASEDLDFERAAIYRDRLAALSHVQSHQGINPA 303

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV AI ++  +  +QVF+ R G+  G R +       +   +++  FLAQ Y   
Sbjct: 304 TVDEADVFAIHQEGGQVCIQVFFFRTGQNWGNRAYFPKADPALEAAEVLGSFLAQFY--- 360

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
            D++ T   PR +L+S    D++ +   LS R G  V + VPQRG+K+ L +  L+NA +
Sbjct: 361 -DDKPT---PRNILLSRGVEDQELLGEALSTRAGRKVTISVPQRGEKKDLTDNALQNARE 416

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L R    R ++ +T+ +              P+RIE +D S + G + V +MVV     
Sbjct: 417 ALGR----RLAETSTQGRLLAGFAETFGLAKPPVRIEVYDNSHIMGTNAVGAMVVAGPEG 472

Query: 433 ARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             K++YR+F+IR  E     D   M EV+ RRF+R L+E   V   D           + 
Sbjct: 473 FVKNQYRKFNIRSTEITPGDDFGMMREVMERRFSRLLKEHGDVAPNDAASAEAGDDIEDD 532

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLE-----EVWLPGEE 545
            +  F   P+++++DGG+ Q+ A ++ L DLGIED V   G+AK  +     E +     
Sbjct: 533 ISGSFPAWPDVILIDGGQGQMTAVRKILADLGIEDRVVAIGIAKGQDRDAGRERFFVKGR 592

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           D   LP     LY +QR+RDE HRFAI  HR +R K +  S LD+I G+GP R+ ALL  
Sbjct: 593 DSFSLPVRDPVLYFVQRLRDEVHRFAIGSHRARRKKEMVKSPLDEIAGIGPGRKRALLLA 652

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           FG+ + +++A   ++ +V GI E+ A+ +Y
Sbjct: 653 FGTAKAVSRAAIEDLRKVDGISEQVAKLVY 682


>UVRC_LISMO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  317 bits (812), Expect = 2e-88
 Identities = 213/644 (33%), Positives = 331/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++  AF+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIR----GERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y  A+       IP + +      D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFYQKANH------IPPQEIYLPNDVDSEAVQAVVPDTK-----IIVPQRGNKKD 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+  L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKIAL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E           
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKE----------- 444

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
             G P             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 445 --GLPM------------PDLILIDGGKGQIDSAKDVLTNELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASIEEIKEA-GVPLNVAEEVHKHITA 592


>UVRC_LISW6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  317 bits (811), Expect = 2e-88
 Identities = 210/644 (32%), Positives = 330/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++  AF+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQVAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRI----RGERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y      +    IP + +   +  D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFY------QKANHIPPKEIYLPDDVDSEAVQAVVPDTK-----IIVPQRGNKKE 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+  L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKIAL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E   +       
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKERLPM------- 448

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
                             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 449 ------------------PDLILIDGGKGQIDSAKDVLINELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASVEEIKEA-GVPMNVAEEVHKHITT 592


>UVRC_SHEB8 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  316 bits (810), Expect = 3e-88
 Identities = 222/635 (34%), Positives = 334/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D    VIYVGKAK+L+ RL+SYF+   A + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   +Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRSRPCLQYQLSRCSAPCVGKVSNADY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 DEQVKLASLFLKGKDQQVISALVDKMELXXXXXXXXXXXXFRDQIMALRKVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVI +      A   + ++R G+I G R +           +++  F+ Q Y  A
Sbjct: 247 NKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPAQTDMDEVLRSFILQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S    +   + A +S+       ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISHNFEELHELEAAVSEALDKKFSIKTNVRADRASFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVVT----RLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + +SRRF + +E   ++                  
Sbjct: 420 PHKGEYRRYNIEGITPGD-DYAAMKQAVSRRFDK-IEAGGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE + L  
Sbjct: 460 -------PDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELVKVPGISIEMAQTIHDAL 607


>UVRC_LISMC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  316 bits (810), Expect = 3e-88
 Identities = 210/644 (32%), Positives = 330/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++  AF+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRI----RGERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y      +    IP + +   +  D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFY------QKANHIPPKEIYLPDDVDSEAVQAVVPDTK-----IIVPQRGNKKD 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+  L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKIAL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E   +       
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKEELPM------- 448

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
                             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 449 ------------------PDLILIDGGKGQIDSAKDVLTNELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASVEEIKEA-GVPLNVAEEVHKHITA 592


>UVRC_SHESW RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  316 bits (809), Expect = 4e-88
 Identities = 224/635 (35%), Positives = 335/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLDNVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   +Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRSRPCLQYQLSRCSAPCVGKVSNADY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 DEQVKLASLFLKGKDQQVISTLVAKMXXXXXXXXXXXXXRFRDQIMALRKVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVI +      A   + ++R G+I G R +           +++  F+ Q Y  A
Sbjct: 247 NKGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPSVPAQTDMDEVLRSFILQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S    +   + A +S        ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISHNFEELHELEAAVSIALNKKFSIKTNVRADRASFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVIT----RLSHKNTVEQRFVLLEEILELSTPIYRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + I+RRF + +E   ++                  
Sbjct: 420 PHKGEYRRYNIEGITPGD-DYAAMKQAITRRFDK-IEAGGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE + L  
Sbjct: 460 -------PDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELVKVPGISIEMAQTIHDAL 607


>UVRC_PROM4 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 647

 Score =  315 bits (808), Expect = 5e-88
 Identities = 204/638 (31%), Positives = 328/638 (51%), Gaps = 25/638 (3%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQ-DFSALHPRTQTMISTAADVDWTV 71
           +IP++PG Y  RD++  ++Y+GK+K+L++R+ SYF  + +AL PR   M+    D+++ +
Sbjct: 23  TIPSEPGCYLMRDKNETLLYIGKSKSLKSRVRSYFNTNNTALSPRISLMVRQVYDIEFIL 82

Query: 72  VNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--R 129
            +++ EAL LE + IKE+ P FN+  +DDK YPYL +T +EE+PR+ +           R
Sbjct: 83  TDSDSEALNLESNLIKEHQPYFNILLKDDKKYPYLCITWSEEYPRIFITXXXXXXNSEDR 142

Query: 130 YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGV 189
           Y+GPY                         ++K      R CL   I++C   C   I  
Sbjct: 143 YYGPYVDVXXXXXXXXXXXXXXXXXXXXXALYK-----DRTCLNYSINRCPGVCQRLIEP 197

Query: 190 EEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAV 249
           ++Y    +       G T +                       IRD I+ +  +   Q +
Sbjct: 198 DDYHKTLKKVAMIFEGRTDQLKDLLHKQMLIQSKLQEFEKAAIIRDQIKGIEQLYAAQKM 257

Query: 250 VLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQT 308
            + DST   DV+ ++ D     VQ+F +R G++ G  G+V + +E + +  ++++ L + 
Sbjct: 258 TIPDSTVSRDVLGLSIDSNVCCVQLFQMRAGKLVGRIGFVYNSLE-LRSELILQKVLEEY 316

Query: 309 YGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLK 368
           Y   D+      IP E+L+ +    +     WLS+ RG+ V + +P+R +K  L++ V +
Sbjct: 317 YSQIDN----VTIPPEILLQSSIPQQSYFEQWLSELRGSQVKIVIPKRKEKAELVKLVKR 372

Query: 369 NAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
           NA+  L R K  ++  L                   P RIE +DIS L G   V S VVF
Sbjct: 373 NADIELERVKDGQSKHLIELEDLTQVLDLAFV----PRRIEGYDISHLAGTEVVGSQVVF 428

Query: 429 EDGLARKSEYRRFSIRGAEGAD---SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
            +G+  K  YR+++I+          D  A+ EVI RRF R+     +   LD L E   
Sbjct: 429 IEGIPAKQHYRKYAIKXXXXXXXXXDDYMALAEVIRRRFRRW--SKYKADGLD-LTELRN 485

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVAVCGLAKRLEEVWLPGE 544
            + +          P+L+++DGG+ Q+ A + AL  LG++ D+ VC LAKR EE+++PG 
Sbjct: 486 KKLSSLDPLIITDWPDLIMIDGGKGQLKAVEEALRQLGLDSDINVCSLAKRNEEIFVPGS 545

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            + +   +   GL LL+R+RDEAHRFAI++HR+KR+ ++  S L DIPG+GP R  +LL 
Sbjct: 546 YNKLDTEKNQPGLLLLRRLRDEAHRFAINFHRKKRSLSMKRSQLIDIPGVGPRRIKSLLA 605

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
           HF SV+ +  AT  EIA V G+G  TA  I++    +E
Sbjct: 606 HFKSVQAIQLATEKEIASVEGLGTETASIIFKYFNPIE 643


>UVRC_BREBN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 593

 Score =  315 bits (808), Expect = 5e-88
 Identities = 207/647 (31%), Positives = 330/647 (51%), Gaps = 68/647 (10%)

Query: 6   TLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAA 65
           +L+ K   +P  PG Y  ++  G +IYVGKAK L+ R+ SYF    + + +TQ ++S   
Sbjct: 4   SLKDKLAVLPDKPGCYLMKNASGEIIYVGKAKVLKNRVRSYFT--GSHNGKTQLLVSEIV 61

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ VV++ +EAL LE + IKE+ PR+NV  RDDK+YPY+ +T NE  PR+++ R   +
Sbjct: 62  DFEYIVVSSAIEALILECNLIKEHDPRYNVMLRDDKTYPYIKIT-NEAQPRLEITRKVLK 120

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY  A    +   LL R++P+R C            + CL  ++ +C APCV 
Sbjct: 121 DKAKYFGPYPNAGDASEVKKLLDRLYPLRKC-------RNMPKQVCLYYHLGQCLAPCVY 173

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +  EE + L +    F+ G      +                     RD I+++  VME
Sbjct: 174 EVSAEENQRLVDQISQFLDGGHEEMKQTLTEKMLQAAENMEFERAKEYRDQIKSIEAVME 233

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST-----GKL 300
           KQ               A ++    +QVFY+R G++          +E  +T     G  
Sbjct: 234 KQKXXXXXXXXXXXXGFAVEKGWMCIQVFYMRKGKM----------IERQTTSFPYYGSE 283

Query: 301 VEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKR 360
            E F++       D+++  A+P+E+L+  E ++ + +  WL       + V  P+RG K 
Sbjct: 284 TEDFMSYVSQFYYDKQN--ALPKEILLPQE-SEPELLAEWL------GIKVHAPKRGKKH 334

Query: 361 ALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
            L++   +NA   L    +  + D   R+               P RIE FD S +QG  
Sbjct: 335 ELVKMATENARIALQEKFALMSKD-DARTVQAVHNLGHILGIPVPHRIEAFDNSNIQGTE 393

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            V++M+VF DG   K EYR+F I+  EG D D  +M EV+ RR++R L+E+Q +      
Sbjct: 394 PVSAMIVFTDGRPDKKEYRKFKIKTVEGPD-DYGSMREVVRRRYSRLLKENQPM------ 446

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----R 535
                              P+L+V+DGG+ Q++AA   L+ +LG+  + VCGLAK    R
Sbjct: 447 -------------------PDLIVIDGGKGQISAAMDVLENELGLY-IPVCGLAKDEKHR 486

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
             ++      +P+ L R S   YLLQR++DE HRF I++HR+ R K + +S LD+IPG+G
Sbjct: 487 TAQLMYGDPPEPVNLRRDSYEFYLLQRIQDEVHRFVITFHRQSRTKTMLSSQLDEIPGIG 546

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVE 642
             RR  L  HFGS++++ +AT  +  ++ GIG++ A+ I   L  ++
Sbjct: 547 EKRRKLLFSHFGSLKKMREATVEDFRQL-GIGDKLAKEIIGHLRKLD 592


>UVRC_BARHE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 661

 Score =  315 bits (808), Expect = 5e-88
 Identities = 201/630 (31%), Positives = 319/630 (50%), Gaps = 32/630 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  DE+G+V+YVGKA+NL+ R+S+Y ++    + R   MI   + +++ V +
Sbjct: 50  LPHKPGVYRMVDENGKVLYVGKARNLKKRVSNYTRE-QGHNNRITRMIRATSHMEFVVTH 108

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           T            K   PRFNV  RDDKS+PY+ +T +   P +   RGAR R   YFGP
Sbjct: 109 TXXXXXXXXXXXXKRLHPRFNVLLRDDKSFPYIIITDDHRAPALYKHRGARTRKAHYFGP 168

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ + A+  T+++L R F +RTC+  V +      RPCLL  I +CSAPC   I   +YR
Sbjct: 169 FASSSAVTQTINVLQRAFLLRTCTDSVLENRT---RPCLLYQIKRCSAPCTHEISDRDYR 225

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L +   +F++G++                          RD + AL  +   Q +    
Sbjct: 226 ELVKGAKSFLSGKSQSIKNDMVQAMHKAAKNFDFEQAAAYRDRLSALSHIQSHQGINPQT 285

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AIA+ +  + +QVF+ R G+  G R +        S+ +++  FL+Q Y   D
Sbjct: 286 IEEADVFAIAQKEGISCIQVFFFRMGQNWGNRAYFPKADPSFSSSEILASFLSQFY---D 342

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+     +P+ +L+S    D+  +    S +    + + +P++G+++ L+     NA +T
Sbjct: 343 DKP----LPKLILLSESIEDKTLLAEAFSLKANRKISLSLPKQGERKTLVNYAYINAHET 398

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L    ++ A    T +K              P RIE +D S + G + V +M+V      
Sbjct: 399 LGHKLAETA----THTKLFQGIAEIFQLPHTPCRIEIYDNSHIMGTNAVGAMIVAGKNGF 454

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K++YR+F+IR  +     D   M EVI RRF+R ++E     E   +          + 
Sbjct: 455 IKNQYRKFNIRSTDITPGDDFGMMKEVIKRRFSRLIKEHGLPHESKNI--------QSKD 506

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGEE 545
              F   P+L+++DGG+ Q+ +    L +LG+++ + V G+AK        E  ++ G+ 
Sbjct: 507 DASFPIWPDLILIDGGKGQINSVHTILSELGLDNFMTVVGIAKGADRRAGRERFFIKGKT 566

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P  LP     LY LQR+RDEAHRFAI  HR KR K    + LD+I  +GP R+ ALL H
Sbjct: 567 -PFTLPPCDPILYFLQRLRDEAHRFAIGTHRAKRKKETLKNPLDEIENIGPTRKRALLHH 625

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           FGS + +A A+  ++ +V GI    AQ IY
Sbjct: 626 FGSAKAIASASLEDLTKVIGISTTIAQKIY 655


>UVRC_SPHAL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 644

 Score =  315 bits (807), Expect = 7e-88
 Identities = 205/630 (32%), Positives = 310/630 (49%), Gaps = 43/630 (6%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G V+YVGKA+ LR R++SY Q  + L  R Q M++    ++     
Sbjct: 45  LPARPGVYRMLDARGDVLYVGKARALRNRVTSYTQ-VARLPQRLQRMVAQTRAMEIVTTT 103

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK Y P +NV  RDDKS+P++ +  + +FPRVQ              P
Sbjct: 104 SXXXXXXXXXQLIKRYRPPYNVLLRDDKSFPFILLRTDHDFPRVQKHXXXXXXXXXXXXP 163

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A ++  T++ L + F +R+C+   F    +  RPCLL  I +CSAPCV RI  E+Y 
Sbjct: 164 FASAGSVARTLNALQKTFLLRSCTDSFFA---NRSRPCLLYQIRRCSAPCVDRISKEDYA 220

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  D   F+ G +    +                    +RD ++AL  +   Q+V    
Sbjct: 221 GLVSDAQDFLEGRSTAVQKRLGEAMTRAADAMDFEQAAVLRDRLKALTFIQGSQSVHADG 280

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DV A+A    +  +  F++RGG+  G R +    V  V   +++  FL Q Y G  
Sbjct: 281 LGDADVFALAAKGGQLCIAGFFIRGGQNWGHRSFFPAHVAGVPETEVMASFLMQFYEGVP 340

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                   P+ +LV  EP              G  V++ VPQRG+++ L++  ++NA + 
Sbjct: 341 P-------PKLILVDREPDXXXXXXXXXXXTAGRKVEISVPQRGNRKRLLDQAVRNAGEE 393

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L R    R ++ ++++K              P RIE +D S +QG   + +MVV      
Sbjct: 394 LDR----RLAESSSQAKLGRELADLFDLENPPQRIEIYDNSHIQGTSALGAMVVAGPEGW 449

Query: 434 RKSEYRRFSIRGAEGADSD-VAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K  YR+F+I+ AE    D  A M EV  RRF R +EE        T GE          
Sbjct: 450 MKGAYRKFNIKRAETQPGDDFAMMREVFQRRFARAIEEDPE----RTKGEW--------- 496

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEED 546
                  P+LV++DGG+ QV+A      +LGI+D+   G+AK        E  +LP   +
Sbjct: 497 -------PDLVLIDGGKGQVSAVAAVFSELGIDDLPFVGVAKGPDRNAGRETFYLPDGRE 549

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
              LP  +  L+ +QR+RDEAHRFAI  HR KRAKA+ +S LD++PG+GP R+ ALL HF
Sbjct: 550 -FTLPTNNAVLFYIQRLRDEAHRFAIGAHRAKRAKAMGSSPLDEVPGIGPARKKALLMHF 608

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G+ R +  A+  ++ + PG+    AQ +Y+
Sbjct: 609 GTTRAIKGASLEDLQKAPGVSAAVAQAVYD 638


>UVRC_SYNSC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 661

 Score =  315 bits (806), Expect = 9e-88
 Identities = 208/631 (32%), Positives = 310/631 (49%), Gaps = 26/631 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PG Y  RD   R++YVGK+K LR+R+ SYF+    L PR + M     ++++ V +
Sbjct: 23  IPAEPGCYLMRDCDDRILYVGKSKALRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFIVTD 82

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYF 131
           +E EAL LE + IK + P FNV  +DDK YPYL +T +E +P               R++
Sbjct: 83  SEAEALVLESNLIKNHQPHFNVLLKDDKKYPYLCITWSEAYPXXXXXXXXXXXSPLDRFY 142

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R T+ L+ RVFP+R        R     R CL   I +C   C  +I   +
Sbjct: 143 GPYVDVGLLRRTLFLVKRVFPLRQ-----RPRPMYPDRTCLNYSIGRCPGVCQEKISSVD 197

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y            G +                         +RD +Q L  +   Q + L
Sbjct: 198 YHRTLRKVAMVFQGRSDELQHLLQEQMERYAERMDYESAARVRDQLQGLDQLTADQKMSL 257

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            DS+   DV+A+A D+  AAVQ+F +R G++ G  G+  D    +  G ++++ + + Y 
Sbjct: 258 PDSSVSRDVLALAFDERLAAVQLFQMRAGKLVGRLGYTAD-ASGLEPGLILQRVIEEHYS 316

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E    +P E+LV      +  +  WL+++R   V +  PQR  K  L+E V +NA
Sbjct: 317 QVDSVE----VPPELLVQHALPQQKLMEDWLTEQRERRVQIHCPQRQQKADLIELVQRNA 372

Query: 371 EQTLARHK-SQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           E  L R K  Q    L T                 P RIE +DIS +QG   VAS VVF 
Sbjct: 373 EFELLRAKQGQEKQSLATED-----LAQLLELPTPPRRIEGYDISHIQGSDAVASQVVFI 427

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YR++ IR +    G   D                       ++  L   G  
Sbjct: 428 DGLPAKQHYRKYKIRSSSIRAGHSDDFXXXXXXXXXXXXXXXXXXXEGMDVGALRHKG-- 485

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEVWLPGEE 545
            G+  +       P++V++DGG+ Q++A   AL +L + ED+ VC LAK+ EEV+LPGE 
Sbjct: 486 -GSALQTDGLNDWPDVVMIDGGKGQLSAVMEALRELDLHEDLNVCSLAKQREEVFLPGES 544

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+       G+ LL+R+RDEAHRFA+S+HR++R + +  S L DIPG+GP R   LL H
Sbjct: 545 QPLESEPDQLGVVLLRRLRDEAHRFAVSFHRQQRGERMKRSRLSDIPGVGPKRVKDLLAH 604

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           F S+  +  A+   +++ PG+G   A+ I++
Sbjct: 605 FHSIDAIQLASIETLSKAPGVGPALARDIHD 635


>UVRC_LISMF RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  315 bits (806), Expect = 9e-88
 Identities = 209/644 (32%), Positives = 329/644 (51%), Gaps = 67/644 (10%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAA 65
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF   S  H  +TQ ++    
Sbjct: 6   IQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYF---SGTHDSKTQRLVQEIV 62

Query: 66  DVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARR 125
           D ++ V ++ VEAL LE + IK++ PRFN+R +DDK+YP++ +T NE  PR+ + R  ++
Sbjct: 63  DFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKIT-NERHPRLIITRQVKK 121

Query: 126 RGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVG 185
              +YFGPY   +A  +   +L R++P+R CS           + CL  ++ +C APCV 
Sbjct: 122 DKGKYFGPYPNVYAANEVKRILDRLYPLRKCST-------LPNKVCLYYHLGQCLAPCVF 174

Query: 186 RIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVME 245
            +   +Y+ + ++   F+ G                            RD I A+ T ME
Sbjct: 175 DVEASKYKEMQDEIVTFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEFRDQINAIETTME 234

Query: 246 KQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRI----RGERGWVVDKVEDVSTGKLV 301
           KQ + + D  D DV   A D+    VQVF++R G++      +  +  D  ED  T    
Sbjct: 235 KQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFYNDADEDFLT---- 290

Query: 302 EQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
             F+ Q Y      +    IP + +   +  D +AV A +   +     + VPQRG+K+ 
Sbjct: 291 --FIGQFY------QKANHIPPKEIYLPDDVDSEAVQAVVPDTK-----IIVPQRGNKKD 337

Query: 362 LMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHT 421
           L++   KNA+  L   K         R+               P R+E FD S + G   
Sbjct: 338 LVKLAYKNAKIAL-NEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDP 396

Query: 422 VASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLG 481
           V++MV F DG   K++YR++ I+  EG D D A M EVI RR+ R L+E   +       
Sbjct: 397 VSAMVTFLDGKPSKNDYRKYKIKTVEGPD-DYATMREVIRRRYWRVLKEELPM------- 448

Query: 482 ESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RL 536
                             P+L+++DGG+ Q+ +A+  L ++LG+ D+ V GLAK    R 
Sbjct: 449 ------------------PDLILIDGGKGQIDSAKDVLTNELGL-DIPVAGLAKDDKHRT 489

Query: 537 EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGP 596
            ++      + + L R S+  YLLQR++DE HRFAI++HR+ R+K    S+LD IPG+GP
Sbjct: 490 SQLLFGDPLEIVPLERNSQEFYLLQRMQDEVHRFAITFHRQLRSKTGFQSILDGIPGVGP 549

Query: 597 VRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
            R+  LLKHFGS+++L +A+  EI E  G+    A+ +++ +T+
Sbjct: 550 GRKKKLLKHFGSMKKLKEASVEEIKEA-GVPLNVAEEVHKHITA 592


>UVRC_SHEB5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  314 bits (805), Expect = 1e-87
 Identities = 221/635 (34%), Positives = 334/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D    VIYVGKAK+L+ RL+SYF+   A + +TQ ++S    ++ T+ 
Sbjct: 13  TVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLA-NVKTQALVSHIHHINVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   +Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRSRPCLQYQLSRCSAPCVGKVSNADY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 DEQVKLASLFLKGKDQQVISALVDKMELXXXXXXXXXXXXFRDQIMALRKVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVI +      A   + ++R G+I G R +           +++  F+ Q Y  A
Sbjct: 247 NKGDMDVIGVHYSSGIACFHLLFIREGKIFGSRSYYPSVPAQTDMDEVLRSFILQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S    +   + A +S+       ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISHNFEELHELEAAVSEALDKKFSIKTNVRADRASFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE TVAS VVF    
Sbjct: 364 AVVT----RLSHKNTVEQRFVLLEEILELSTPIQRMECFDISHTMGESTVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + +SRRF + +E   ++                  
Sbjct: 420 PHKGEYRRYNIEGITPGD-DYAAMKQAVSRRFDK-IEAGGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE + L  
Sbjct: 460 -------PDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEGDSPALHLIQHIRDESHRFAIAGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELVKVPGISIEMAQTIHDAL 607


>UVRC_BURS3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 677

 Score =  314 bits (805), Expect = 1e-87
 Identities = 215/675 (31%), Positives = 328/675 (48%), Gaps = 68/675 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RG+  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTAHR-FPRMAYYRGSVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  E+Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAISDEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     ++                    +R+ + +L TV+ +QA+ +G 
Sbjct: 195 IDVSNAARFLLGRQSEVMKELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGS 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGIGDESXXXXXX 314

Query: 298 ---------------------------GKLVEQFLAQTYGGADDEESTTAIPREVLVSAE 330
                                       ++++ F+AQ Y G         +P  ++VS  
Sbjct: 315 XXXXXXXXXXXXXXXGRARSDAAASVEAEVLDAFIAQHYLG-------NRVPPVLVVSHA 367

Query: 331 PADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRS 389
           PA RD ++  LS++ G  V  VR PQ G +RA +    +NA+  L R  S++ S    R+
Sbjct: 368 PASRD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLSMAEQNAQIALMRLLSEQGSQ-QART 424

Query: 390 KXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGA 449
           +               LRIECFDIS   GE T AS VV+     +  EYRR++I G    
Sbjct: 425 RALAETLSYECDDLTTLRIECFDISHTMGEATQASCVVYHHHKMQSGEYRRYNITGITPG 484

Query: 450 DSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGR 509
           D D AAM +V++RR+ + +E              G    + R+A   +  PN+V++DGG+
Sbjct: 485 D-DYAAMRQVLTRRYEKMVE--XXXXXXXXXXXXGIDGESTRQAEASSLLPNIVLIDGGK 541

Query: 510 PQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYLLQRV 563
            QV  A++   +LG++   + G+AK       LE +       P+ L + S  L ++ ++
Sbjct: 542 GQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRTPLELGKESAALMVVAQI 601

Query: 564 RDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEV 623
           RDEAHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R             
Sbjct: 602 RDEAHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGXXXXXXXXXXXX 661

Query: 624 PGIGERTAQTIYERL 638
            GI    A+ IY++L
Sbjct: 662 XGISHALAEQIYKQL 676


>UVRC_SYNPX RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 652

 Score =  314 bits (804), Expect = 2e-87
 Identities = 210/643 (32%), Positives = 316/643 (49%), Gaps = 26/643 (4%)

Query: 1   MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTM 60
           +T    L  +   IP +PG Y  RD   R++YVGK+K+LR+R+ SYF+    L PR + M
Sbjct: 5   LTQPEVLERRLKEIPPEPGCYLMRDGEDRILYVGKSKSLRSRVRSYFRSRHDLSPRIRLM 64

Query: 61  ISTAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVM 120
                ++++ V ++E EAL LE + IK + P FNV  +DDK YPYL +T +E +P     
Sbjct: 65  TRQVCEIEFIVTDSEAEALALESNLIKNHQPHFNVLLKDDKKYPYLCITWSEAYPXXXXX 124

Query: 121 RGARRRGV--RYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDK 178
                     R++GPY     +R T+ L+ RVFP+R        R     R CL   I +
Sbjct: 125 XXXXXXSPLDRFYGPYVDVGLLRRTLFLVKRVFPLRQ-----RPRPLHPDRTCLNYSIGR 179

Query: 179 CSAPCVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQ 238
           C   C  +I  E+Y            G +    R                    +RD +Q
Sbjct: 180 CPGVCQEKITSEDYHRTLRKVAMVFQGRSDELQRLLDEQMNRYAERLDFESAARVRDQLQ 239

Query: 239 ALRTVMEKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST 297
            L  +   Q + L DS+   DV+A+A D   AAVQ+F +R G++ G  G+  D    ++ 
Sbjct: 240 GLDQLTADQKMSLPDSSVSRDVLALACDDRLAAVQLFQMRAGKLVGRLGYTAD-ASALAP 298

Query: 298 GKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRG 357
           G ++++ + + Y   D  E    +P E+LV      +  +  WL+++R   V +  P++ 
Sbjct: 299 GLILQRVIEEHYSQVDAVE----VPPELLVQHALPQQQLLEDWLTEQRERKVQIHCPKQR 354

Query: 358 DKRALMETVLKNAEQTLARHK-SQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTL 416
            K  L+E V +NAE  L R K  Q    L T                 P RIE +DIS +
Sbjct: 355 QKADLIELVQRNAEFELLRAKQGQEQQALATED-----LAQLLEMPTPPRRIEGYDISHI 409

Query: 417 QGEHTVASMVVFEDGLARKSEYRRFSIRGA---EGADSDVAAMYEVISRRFTRYLEESQR 473
           QG   VAS VVF DGL  K  YR++ IR +    G   D                     
Sbjct: 410 QGSDAVASQVVFIDGLPAKQHYRKYKIRSSSIQSGHSDDFXXXXXXXXXXXXXXXXXXXD 469

Query: 474 VGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGL 532
             ++  L   G   G+  +       P++V++DGG+ Q++A   AL +L + ED+ VC L
Sbjct: 470 GVDVGALRHKG---GSALQTDGLNDWPDVVMIDGGKGQLSAVMEALRELDLHEDLNVCSL 526

Query: 533 AKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIP 592
           AK+ EEV+LPGE  P+       G+ LL+R+RDEAHRFA+S+HR++R + +  S L DIP
Sbjct: 527 AKQREEVFLPGESQPLESEPDQLGVALLRRLRDEAHRFAVSFHRQQRGERMKRSRLSDIP 586

Query: 593 GLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           G+GP R   LL HF S+  +  A+   +++ PG+G   A+ I+
Sbjct: 587 GVGPKRVKDLLAHFHSIDAIQMASVDLLSKAPGVGTALARDIH 629


>UVRC_SHEPC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  313 bits (803), Expect = 2e-87
 Identities = 223/635 (35%), Positives = 335/635 (52%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S    +D T+ 
Sbjct: 13  TVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRK-NLDNVKTQALVSHIHHIDVTLT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPY+ ++ +E  PR+   RG +R    YFG
Sbjct: 72  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R+++ L+ ++FP+R C    +K   S  RPCL   + +CSAPCVG++   +Y
Sbjct: 131 PYPNGGAVRESLHLMQKLFPIRQCDDLYYK---SRSRPCLQYQLSRCSAPCVGKVSNADY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V   
Sbjct: 188 DEQVKLASLFLKGKDQQVISTLVAKMXXXXXXXXXXXXXRFRDQIMALRKVAEQQEVS-N 246

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  D DVI +      A   + ++R G+I G R +           +++  F+ Q Y  A
Sbjct: 247 NKGDMDVIGVHYASGIACFHLLFIREGKIFGSRSYYPSVPAQTDMDEVLRSFILQFYLNA 306

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   IP+EV++S    +   + A +S        ++   R D+ + +   + NA  
Sbjct: 307 DIQRT---IPKEVVISHNFEELHELEAAVSIALNKKFSIKTNVRADRASFLRLAVTNATN 363

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            +      R S   T  +                R+ECFDIS   GE +VAS VVF    
Sbjct: 364 AVIT----RLSHKNTVEQRFVLLEEILELSTPIHRMECFDISHTMGESSVASCVVFNREG 419

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K EYRR++I G    D D AAM + I+RRF + +E   ++                  
Sbjct: 420 PHKGEYRRYNIEGITPGD-DYAAMKQAITRRFDK-IEAGGKI------------------ 459

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVA--VCGLAKR------LEEVWLPG 543
                  P+++ +DGG  Q+  AQ+ +D+  +  D A  + G+AK       LE + L  
Sbjct: 460 -------PDILFIDGGLGQLRIAQKIVDEKFVHLDKAPQLIGVAKGEGRKPGLETLILGD 512

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+GP RR ALL
Sbjct: 513 TETSFSLEGDSPALHLIQHIRDESHRFAITGHRNRRQKTRNTSTLESIPGIGPKRRKALL 572

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 573 QHLGGLQEVKGASVAELVKVPGISIEMAQTIHDAL 607


>UVRC_PSEF5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  313 bits (803), Expect = 2e-87
 Identities = 201/629 (31%), Positives = 316/629 (50%), Gaps = 46/629 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D   R++YVGKAKNL+ RLSSYF+  +   P+T  +++               
Sbjct: 18  PGVYRMFDSDARLLYVGKAKNLKNRLSSYFRK-TGQAPKTAALVARXXXXXXXXXXXXXX 76

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                    KE+ P +N+  RDDKSYPY+ ++ + +FPR  + RGA+++  +YFGPY  A
Sbjct: 77  XXXXXXXXXKEWRPPYNILLRDDKSYPYVFLS-DGDFPRFSIHRGAKKQKGKYFGPYPSA 135

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
            AIR+++ LL + F VR C    +K      RPCL   I +C APCVG +  E Y     
Sbjct: 136 GAIRESLSLLQKTFMVRQCEDSYYKNRT---RPCLQYQIKRCKAPCVGLVEPEVYAEDVR 192

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G +                         +RD I  LR V ++Q++  G + D 
Sbjct: 193 HSVMFLEGRSNALTDELSTAMEAAASTLDFEKAAELRDQISLLRRVQDQQSME-GGTGDV 251

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+A   +   A V +  VRGGR+ G + +      +    +++  FL Q +  + + + 
Sbjct: 252 DVVAAFVNPGGACVHLISVRGGRVLGSKNFFPQVGIEEDVAEVMSAFLGQYFVSSPERD- 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
              +P E++V+    D   ++A + + RG  + +    RG +    +  + NAEQ L   
Sbjct: 311 ---LPSELIVNVVHEDFPTLIAAIDELRGRELTISHRVRGTRARWQQLAVTNAEQAL--- 364

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
            S R ++    +               P R+EC+DIS   GE TVAS VVF      KS+
Sbjct: 365 -SARLANRQHVAARFEALAEVLNLDEPPQRLECYDISHSSGEATVASCVVFGPEGPLKSD 423

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRR++I G    D D AAM++ ++RRF++  +   ++                       
Sbjct: 424 YRRYNIEGVTAGD-DYAAMHQALTRRFSKLKDGEGKL----------------------- 459

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDPIILP 551
             P++++VDGG+ Q++ A+  L++L + D+ + G+AK        E ++L        L 
Sbjct: 460 --PDILLVDGGKGQLSMARDVLNELAVPDLILLGVAKGATRKAGFETLYLNDAAHEFTLK 517

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
             S  L+L+Q++RDEAHRFAI+ HR +R K    S L+ + G+GP RR  LLKHFG ++ 
Sbjct: 518 GDSPALHLIQQIRDEAHRFAITGHRARRGKTRRTSTLEGVAGVGPKRRRDLLKHFGGLQE 577

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERLTS 640
           L++A+  EIA+ PGI ++ A+ IY  L S
Sbjct: 578 LSRASIDEIAKAPGISKKLAELIYANLHS 606


>UVRC_HAEIN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  312 bits (800), Expect = 5e-87
 Identities = 214/633 (33%), Positives = 314/633 (49%), Gaps = 51/633 (8%)

Query: 17  DPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEV 76
           +PGVYR  D+  +VIYVGKAK+L+ RLSSYF+  +    +T+ ++++   +D        
Sbjct: 14  EPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRK-NLSSKKTEALVASIHHIDXXXXXXXX 72

Query: 77  EALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSY 136
                 +++IK Y PR+NV  RDDKSYP++ +T  E   R+   RG+++    YFGPY +
Sbjct: 73  XXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHQRITSYRGSKKFAGEYFGPYPH 131

Query: 137 AWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEYRAL 195
           A A+R+T+ LL ++FPVR C   V+    +  RPCL   I +CSAPCV G +  EEY   
Sbjct: 132 AGAVRETLSLLQKLFPVRQCENSVYS---NRSRPCLQYQIGRCSAPCVQGYVSDEEYNQQ 188

Query: 196 AEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDST 255
            E    F+ G+  + L                      RD IQA+R+V+EKQ V      
Sbjct: 189 VELARLFLQGKDQQVLDYLIGKMEQASRNLDFEQAARYRDQIQAVRSVIEKQFVSNERLD 248

Query: 256 DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDE 315
           D D+++IA     A VQV ++R G++ G R +      +    +L E F+ Q Y      
Sbjct: 249 DMDIMSIAYQHGLACVQVMFIRQGKVLGNRSYFPKVPANTDLSELTETFVGQFYLQGHQG 308

Query: 316 ESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLA 375
            S   IP  ++V                  G  V ++   +GDK   ++    NA+  L 
Sbjct: 309 RS---IPNSIIVDRXXXXXXXXXXXXXXXXGRKVTIQESVKGDKSKYLQLAQVNAKAALN 365

Query: 376 RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARK 435
               Q     ++R                  R+ECFDIS   G  TVAS VVF      K
Sbjct: 366 VQLKQ-----SSRMSERYQALCDLLNLPKIKRMECFDISHTMGNQTVASCVVFNKEGPLK 420

Query: 436 SEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPR 495
           S+YRRF+I G  G D D AAM +V+ +R+ R LEE +                       
Sbjct: 421 SDYRRFNIEGITGGD-DYAAMEQVLQKRYERDLEEDKI---------------------- 457

Query: 496 FAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKRLE-----EVWLPGEED 546
               P+++ +DGG+ Q+  A      L ++       + G+AK ++     EV +  ++D
Sbjct: 458 ----PDIIFIDGGKGQLNRALNVFQHLQVKWDKNRPHLIGVAKGVDRRAGQEVLIISKQD 513

Query: 547 -PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             I LP  S  L+L+Q +RDE+H  AIS HR+KR KA T S L+ I G+G  RR ALLK+
Sbjct: 514 REIHLPDDSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQALLKY 573

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            G ++ + +AT  EIA VPGI  + A+ I+E L
Sbjct: 574 LGGLQGVKKATLDEIASVPGISPKLAERIFETL 606


>UVRC_COXBN RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  312 bits (800), Expect = 5e-87
 Identities = 205/631 (32%), Positives = 314/631 (49%), Gaps = 47/631 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT  GVY+ +D  G+VIYVGKA+NL+ R+SSYF+    L  +TQ M++    +  T+ 
Sbjct: 12  TLPTGSGVYQIQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTTIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
             E EAL LE S+IK++ PR+NV  RDDKSYPYL +  +++FPR+   RGA++   RYFG
Sbjct: 70  RNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  A ++R+ + L+ ++F +R CS   FK   +  RPCL   I +C+APCVG +  +EY
Sbjct: 130 PYPNAGSVRENLALIQKLFKLRQCSESFFK---NRTRPCLQYQIKRCTAPCVGYVNEQEY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   ED   F  G+  + +                      RD                G
Sbjct: 187 RRQVEDAILFFEGKNDQVIIKLTERMEVASENLVFEEAAHYRDXXXXXXXXXXXXXXT-G 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + D+I IAE        + ++R GR+ G + +  +     +    + +F+ Q Y   
Sbjct: 246 GKGNIDIIGIAESNGAIGFAILFIRSGRMIGHKPFFPNTPLGTTLQTALVEFIPQYY--- 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP  ++ S    DR     W+ +   + ++ R+     KRA  +        
Sbjct: 303 LSPLRNGDIPERIVTSEPLEDR----LWIQRALSSGLNRRLAITDQKRAPYKXXXXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF-EDG 431
                         T +                 RIECFDIS   GE TVAS VVF E+G
Sbjct: 359 XXXXXXXXXXXXKNTFALKLEAIQKSLALPNPIARIECFDISHTLGEATVASCVVFGEEG 418

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
           L +K +YRRF+I G    D D  A+ + ++RR+ R L+E + +                 
Sbjct: 419 LIKK-DYRRFNISGVTPGD-DYGALRQALTRRYVR-LKEGEGI----------------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEE 545
                   P+++++DGG  Q+  A   L++L +  V +  +AK       LE++++ G  
Sbjct: 459 -------LPDVLLIDGGMGQLRQAAEVLEELQVSGVILTAIAKGPGRKAGLEKLFVWGRR 511

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           + I LP  +   +L+Q++RDEAHRFAI+ H  +RAK    S L +I G+GP RR  LLK+
Sbjct: 512 EEIHLPADNIAFHLIQQIRDEAHRFAITAHCNRRAKRRVESTLQEIEGIGPKRRQKLLKY 571

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG ++ L +A+  EIA VPG+ E  A+ IY+
Sbjct: 572 FGGLQELQRASIEEIARVPGVSETLAKAIYD 602


>UVRC_BURCH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 681

 Score =  312 bits (800), Expect = 5e-87
 Identities = 217/679 (31%), Positives = 325/679 (47%), Gaps = 72/679 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RG+  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTAHR-FPRMAYYRGSVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  E+Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAISEEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     ++                    +R+ + +L TV+ +QA+ +G 
Sbjct: 195 VDVSNAARFLLGRQSEVMKELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGS 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGLGXXXXXXXXX 314

Query: 298 -------------------------------GKLVEQFLAQTYGGADDEESTTAIPREVL 326
                                             ++ F+AQ Y G         +P  ++
Sbjct: 315 XXXXXXXXXXXXXQPXXXXXXXXXXXXXXXXXXXLDAFIAQHYLG-------NRVPPVLV 367

Query: 327 VSAEPADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDL 385
           VS  PA RD ++  LS++ G  V  VR PQ G +RA +    +NA   LAR  S++ S  
Sbjct: 368 VSHAPASRD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLSMAEQNARLALARLLSEQGSQ- 424

Query: 386 TTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRG 445
             R++               LRIECFDIS   GE T AS VV+     + SEYRR++I G
Sbjct: 425 QARTRALADTLSYDSDDLATLRIECFDISHTMGEATQASCVVYHHHKMQSSEYRRYNITG 484

Query: 446 AEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVV 505
               D D AAM +V++RR+ +                 G    + R+A   +  PN+V++
Sbjct: 485 ITPGD-DYAAMRQVLTRRYEKM--XXXXXXXXXXXXXXGIDGESTRQAEASSLLPNIVLI 541

Query: 506 DGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYL 559
           DGG+ QV  A++   +LG++   + G+AK       LE +       P+ L + S  L L
Sbjct: 542 DGGKGQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRAPLELGKESAALML 601

Query: 560 LQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAE 619
           + ++RDEAHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R         
Sbjct: 602 VAQIRDEAHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGXXXXXXXX 661

Query: 620 IAEVPGIGERTAQTIYERL 638
                GI    A+ IY++L
Sbjct: 662 XXXXXGISHALAEQIYKQL 680


>UVRC_BURCA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 681

 Score =  312 bits (800), Expect = 5e-87
 Identities = 217/679 (31%), Positives = 325/679 (47%), Gaps = 72/679 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RG+  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTAHR-FPRMAYYRGSVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  E+Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAISEEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     ++                    +R+ + +L TV+ +QA+ +G 
Sbjct: 195 VDVSNAARFLLGRQSEVMKELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGS 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGLGXXXXXXXXX 314

Query: 298 -------------------------------GKLVEQFLAQTYGGADDEESTTAIPREVL 326
                                             ++ F+AQ Y G         +P  ++
Sbjct: 315 XXXXXXXXXXXXXQPXXXXXXXXXXXXXXXXXXXLDAFIAQHYLG-------NRVPPVLV 367

Query: 327 VSAEPADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDL 385
           VS  PA RD ++  LS++ G  V  VR PQ G +RA +    +NA   LAR  S++ S  
Sbjct: 368 VSHAPASRD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLSMAEQNARLALARLLSEQGSQ- 424

Query: 386 TTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRG 445
             R++               LRIECFDIS   GE T AS VV+     + SEYRR++I G
Sbjct: 425 QARTRALADTLSYDSDDLATLRIECFDISHTMGEATQASCVVYHHHKMQSSEYRRYNITG 484

Query: 446 AEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVV 505
               D D AAM +V++RR+ +                 G    + R+A   +  PN+V++
Sbjct: 485 ITPGD-DYAAMRQVLTRRYEKM--XXXXXXXXXXXXXXGIDGESTRQAEASSLLPNIVLI 541

Query: 506 DGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYL 559
           DGG+ QV  A++   +LG++   + G+AK       LE +       P+ L + S  L L
Sbjct: 542 DGGKGQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRAPLELGKESAALML 601

Query: 560 LQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAE 619
           + ++RDEAHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R         
Sbjct: 602 VAQIRDEAHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGXXXXXXXX 661

Query: 620 IAEVPGIGERTAQTIYERL 638
                GI    A+ IY++L
Sbjct: 662 XXXXXGISHALAEQIYKQL 680


>UVRC_ACTP7 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  312 bits (800), Expect = 5e-87
 Identities = 210/637 (32%), Positives = 314/637 (49%), Gaps = 52/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D    +IYVGKAK+L+ RLSSYF+   A   +T+ +++           
Sbjct: 11  VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXXXXX 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
               AL LE+++IKE  P++NV  RDDKSYPY+ +T ++  PR+   RG+++    YFGP
Sbjct: 70  XXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQH-PRITSFRGSKKVAGEYFGP 128

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           Y  A A+R+T++LL ++FP+R C    +K   +  RPCL   I +C APCV G     EY
Sbjct: 129 YPNAGAVRETLNLLQKLFPIRQCEDSYYK---NRSRPCLQYQIGRCLAPCVEGYYSQAEY 185

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
                    F+ G+ G+ +                      RD IQ++R V EKQ V   
Sbjct: 186 DNQVNLVRLFLQGKDGQVVEHLVQKMENAAQELDFEAAARFRDQIQSVRAVQEKQFVSNE 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+I+IA     A V + +VR G++ G R +      +    +L + F+ Q Y   
Sbjct: 246 RLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYFPKVPNNTDLTELADTFVGQFYLQM 305

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQ-RGDKRALMETVLKNAE 371
           +   +   IP ++++    ++  A+   LS++ G  V +     RGDK   +     NAE
Sbjct: 306 NQHRT---IPNQIIIDQPLSEATALANVLSEQAGHKVSIADKNIRGDKSRYLALAKTNAE 362

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L     Q      T  +                R+ECFDIS   G  TVAS VVF++ 
Sbjct: 363 AALTLQLKQ-----DTHIRQRYDSLKALLNLAEIKRMECFDISHTMGNQTVASCVVFDEN 417

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G  G D D AAM + + +R+ R+LEE +                   
Sbjct: 418 GPLKSDYRRFNIEGITGGD-DYAAMEQALLKRYGRHLEEEKI------------------ 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q+  A      L +        + G+AK       LE + +
Sbjct: 459 --------PDIIFIDGGKGQLNRALETFASLNVSWDKRKPLLIGVAKGVERKAGLETLLI 510

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
              +  I LP  S  L+L+Q +RDE+H  AI+ HR+KR KA T S L+ I G+G  RR A
Sbjct: 511 SKWDKEIHLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQA 570

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ +  AT  EI  VPGI ++ A+ I++ L
Sbjct: 571 LLKYLGGMQGVKSATLEEIQSVPGISKQLAEVIFDTL 607


>UVRC_ACTPJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  312 bits (799), Expect = 6e-87
 Identities = 212/643 (32%), Positives = 316/643 (49%), Gaps = 64/643 (9%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D    +IYVGKAK+L+ RLSSYF+   A   +T+ +++           
Sbjct: 11  VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXXXXX 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
               AL LE+++IKE  P++NV  RDDKSYPY+ +T ++  PR+   RG+++    YFGP
Sbjct: 70  XXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQH-PRITSFRGSKKVAGEYFGP 128

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           Y  A A+R+T++LL ++FP+R C    +K   +  RPCL   I +C APCV       EY
Sbjct: 129 YPNAGAVRETLNLLQKLFPIRQCEDSYYK---NRSRPCLQYQIGRCLAPCVESYYSQAEY 185

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
                    F+ G+ G+ +                      RD IQ++R V EKQ V   
Sbjct: 186 DNQVNLVRLFLQGKDGQVIEHLVQKMENAAQELDFEAAARFRDQIQSVRAVQEKQFVSNE 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+I+IA     A V + +VR G++ G R +      +    +L + F+ Q Y   
Sbjct: 246 RLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYFPKVPNNTDLSELADTFVGQFYLQM 305

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQ-RGDKRALMETVLKNAE 371
           +   +   IP ++++    ++  A+   LS++ G  V +     RGDK   +     NAE
Sbjct: 306 NQHRT---IPNQIIIDQPLSESAALADVLSEQAGHKVSIADKNIRGDKSRYLALAKTNAE 362

Query: 372 QTLA------RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASM 425
             L        H  QR   L T                   R+ECFDIS   G  TVAS 
Sbjct: 363 AALTLQLKQDTHIRQRYDSLKTLLNLAEIK-----------RMECFDISHTMGNQTVASC 411

Query: 426 VVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGA 485
           VVF++    KS+YRRF+I G  G D D AAM + + +R++R+LEE +             
Sbjct: 412 VVFDENGPLKSDYRRFNIEGITGGD-DYAAMEQALLKRYSRHLEEEKI------------ 458

Query: 486 PQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------ 535
                         P+++ +DGG+ Q+  A      L +        + G+AK       
Sbjct: 459 --------------PDIIFIDGGKGQLNRALETFASLNVSWDKRKPLLIGVAKGVERKAG 504

Query: 536 LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLG 595
           LE + +   +  I LP  S  L+L+Q +RDE+H  AI+ HR+KR KA T S L+ I G+G
Sbjct: 505 LETLLISKWDKEIHLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVG 564

Query: 596 PVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
             RR ALLK+ G ++ +  AT  EI  VPGI ++ A+ I++ L
Sbjct: 565 AKRRQALLKYLGGMQGVKAATLEEIQSVPGISKQLAEVIFDTL 607


>UVRC_BURCC RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 682

 Score =  311 bits (798), Expect = 8e-87
 Identities = 217/680 (31%), Positives = 325/680 (47%), Gaps = 73/680 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RG+  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTAHR-FPRMAYYRGSVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  E+Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAISDEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     ++                    +R+ + +L TV+ +QA+ +G 
Sbjct: 195 VDVSNAARFLLGRQSEVMKELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGS 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGLGXXXXXXXXX 314

Query: 298 --------------------------------GKLVEQFLAQTYGGADDEESTTAIPREV 325
                                              ++ F+AQ Y G         +P  +
Sbjct: 315 XXXXXXXXXXXXXQPXXXXXXXXXXXXXXXXXXXXLDAFIAQHYLG-------NRVPPVL 367

Query: 326 LVSAEPADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRASD 384
           +VS  PA RD ++  LS++ G  V  VR PQ G +RA +    +NA   LAR  S++ S 
Sbjct: 368 VVSHAPASRD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLSMAEQNARLALARLLSEQGSQ 425

Query: 385 LTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIR 444
              R++               LRIECFDIS   GE T AS VV+     + SEYRR++I 
Sbjct: 426 -QARTRALADTLSYDSDDLATLRIECFDISHTMGEATQASCVVYHHHKMQSSEYRRYNIT 484

Query: 445 GAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVV 504
           G    D D AAM +V++RR+ +                 G    + R+A   +  PN+V+
Sbjct: 485 GITPGD-DYAAMRQVLTRRYEKM--XXXXXXXXXXXXXXGIDGESTRQAEASSLLPNIVL 541

Query: 505 VDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLY 558
           +DGG+ QV  A++   +LG++   + G+AK       LE +       P+ L + S  L 
Sbjct: 542 IDGGKGQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRAPLELGKESAALM 601

Query: 559 LLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAA 618
           L+ ++RDEAHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R        
Sbjct: 602 LVAQIRDEAHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGXXXXXXX 661

Query: 619 EIAEVPGIGERTAQTIYERL 638
                 GI    A+ IY++L
Sbjct: 662 XXXXXXGISHALAEQIYKQL 681


>UVRC_VIBPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  311 bits (797), Expect = 1e-86
 Identities = 209/637 (32%), Positives = 323/637 (50%), Gaps = 52/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RLSSYF+       +T+ ++S  A +D TV 
Sbjct: 13  TVTHQPGVYRMYNADAVVIYVGKAKDLQKRLSSYFRK-KVDSEKTRALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++   + PR+ + RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYILIS-GHKHPRLSMHRGAKKRKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR-IGVEE 191
           PY  + A+R+T+ LL ++FPVR C   V+    +  RPCL+  I +C+ PCV   I  EE
Sbjct: 131 PYPDSGAVRETLHLLQKIFPVRQCEDTVYS---NRTRPCLMYQIGRCAGPCVSSIISDEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  L      F+ G+  + L+                     RD IQA+R V E+Q V  
Sbjct: 188 YAELVGFVRLFLQGKDQQVLKQLIEKMEVASQQLRFEDAAKFRDQIQAIRRVQEQQYVSE 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DV+  A++   A + +  +R G++ G R       ++ S  ++ + FL Q Y  
Sbjct: 248 DSMDDMDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPQNTSQQEVFDSFLTQYYLS 307

Query: 312 ADDEESTTAIPREVLVSAEPA-DRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
            ++  +   IP  ++++ E A D + +   LS+  G  V       G +   ++    NA
Sbjct: 308 HNEART---IPSRIILNQELADDLEPIQKALSEVAGRKVHFHTSPTGARGRYLKLSNTNA 364

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
             T    K      +  R K               +R+ECFDIS   GE T+AS VVF +
Sbjct: 365 -LTAITTKINHKMTINQRFKALRETLGMESI----MRMECFDISHTMGESTIASCVVFNN 419

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
               K EYRR++I G  G D D AAM + + RR+++ L+  +                  
Sbjct: 420 EGPVKQEYRRYNITGITGGD-DYAAMGQALERRYSKQLDVEK------------------ 460

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRAL----DDLGIEDVAVCGLAKRLE-----EVWL 541
                    P+++ +DGG+ Q+  A   +     D     + + G+AK +      E  +
Sbjct: 461 --------IPDIIFIDGGKGQLNRAHEIIAQYWGDWPKRPIMI-GIAKGVTRKPGLETLI 511

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             + +   LP  +  L+L+Q +RDE+H  AI+ HR KR K    S L+ I G+GP RR A
Sbjct: 512 TVDGEEFNLPSDAPALHLIQHIRDESHNHAIAGHRAKRGKTRRTSALEGIEGVGPKRRQA 571

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ L +A+  EIA+VPGI    A+ I++ L
Sbjct: 572 LLKYMGGLQELKRASVEEIAKVPGISHSLAEIIFQAL 608


>UVRC_COXB1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  311 bits (797), Expect = 1e-86
 Identities = 202/630 (32%), Positives = 311/630 (49%), Gaps = 45/630 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT  GVY+ +D  G+VIYVGKA+NL+ R+SSYF+    L  +TQ M++    +  T+ 
Sbjct: 12  TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTTIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
             E EAL LE S+IK++ PR+NV  RDDKSYPYL +  +++FPR+   RGA++   RYFG
Sbjct: 70  RNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  A ++R+ + L+ ++F +R CS   FK   +  RPCL   I +C+APCVG +  +EY
Sbjct: 130 PYPNAGSVRENLALIQKLFKLRQCSESFFK---NRTRPCLQYQIKRCTAPCVGYVNEQEY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   ED   F  G+  + +                      RD                G
Sbjct: 187 RRQVEDAILFFEGKNDQVIIKLTERMEVASENLVFEEAAHYRDXXXXXXXXXXXXXXT-G 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + D+I IAE        + ++R GR+ G + +  +     +    + +F+ Q Y   
Sbjct: 246 GKGNIDIIGIAESNGAIGFAILFIRSGRMIGHKPFFPNTPLGTTLQTALVEFIPQYY--- 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP  ++ S    DR     W+ +   + ++ ++     KRA  +        
Sbjct: 303 LSPLRNGDIPERIVTSEPLEDR----LWIQRALSSGLNRKLAITDQKRAPYKXXXXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                         T +                 RIECFDIS   GE TVAS VVF +  
Sbjct: 359 XXXXXXXXXXXXKNTFALKLEAIQKSLALPNPIARIECFDISHTLGEATVASCVVFGEEG 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K +YRRF+I G    D D  A+ +V++RR+ R L+E + +                  
Sbjct: 419 PIKKDYRRFNISGVTPGD-DYGALRQVLTRRYVR-LKEGEGI------------------ 458

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEED 546
                  P+++++DGG  Q+  A   L++L +  V +  +AK       LE++++ G  +
Sbjct: 459 ------LPDVLLIDGGMGQLRQAAEVLEELQVSGVILTAIAKGPGRKAGLEKLFVWGRRE 512

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            I LP  +   +L+Q++RDEAHRFAI+ H  +RAK    S L +I G+GP RR  LLK+F
Sbjct: 513 EIHLPADNIAFHLIQQIRDEAHRFAITAHCNRRAKRRVESTLQEIEGIGPKRRQKLLKYF 572

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G ++ L +A+  EIA VPG+ E  A+ IY+
Sbjct: 573 GGLQELQRASIEEIARVPGVSETLAKAIYD 602


>UVRC_BORPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  311 bits (796), Expect = 1e-86
 Identities = 232/633 (36%), Positives = 329/633 (51%), Gaps = 47/633 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G V+YVGKA++L+ R+SSYFQ   A  PR   M++  A VD TV  
Sbjct: 14  LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVTVTR 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK   PR+N+ +RDDKSYPYL +T    +PR+   RGA  +  +YFGP
Sbjct: 73  SXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLIT-GHAWPRIAYYRGATSKRGQYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  +WA+R+T+ +L +VF +RTC   VF    +  RPCLL  I +CSAPCVG I   +Y 
Sbjct: 132 YPNSWAVRETIQILQKVFRLRTCEDTVFA---NRSRPCLLHQIGRCSAPCVGVIEAGDYA 188

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ GE    +                     +RD + +L  V+ +Q +    
Sbjct: 189 HDVQRAVRFLNGEAREVMDEIEARMLQASTELRFEEAAVLRDQMGSLSKVLHQQTMENVG 248

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA+A    +  V +  VRGGR  G++ +     E     +++E F+AQ Y    
Sbjct: 249 GDDTDVIAVASAGGKICVNLAMVRGGRHLGDKPFFPTHAEGEQPAQVLEAFVAQHYADG- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGA-AVDVRVPQRGDKRALMETVLKNAEQ 372
                 A+P  VLV +       +V  L+++ G  A  V    +G +R+ +E   KNAE 
Sbjct: 308 ------AMP-PVLVCSHALPDSGLVGLLAEQGGTRAARVLTRPQGVRRSWLEQAQKNAEM 360

Query: 373 TLARHKSQRASDL-TTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            LAR  ++  +                        RIECFDIS   GE T AS VVF   
Sbjct: 361 ALARALTESGARAGRXXXXXXXXXXXXXXXXXXXXRIECFDISHTAGEATQASCVVFLHH 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             + S YRR++I G    D D AAM +V++RRF +                      A+ 
Sbjct: 421 DMQPSLYRRYNIVGITPGD-DYAAMRQVLTRRFGKV---------------------ADG 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
           +AP     P LV++DGG+ QV  A++   +LG++  ++ G+AK       LE +      
Sbjct: 459 EAPM----PGLVLIDGGKGQVEVARQVFVELGLDIQSLVGVAKGEGRKVGLETLVFADGR 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+ L + S  L L+ +VRDEAHRFAI+  R +RAK    S L++I G+G  RR  LL  
Sbjct: 515 PPVALGKESAALMLIAQVRDEAHRFAITGMRARRAKTRNVSRLEEIEGIGARRRQRLLAR 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FG +  ++ A+  ++A V GI +  A  IY+ L
Sbjct: 575 FGGLSGVSSASIEDLASVEGISQELAVRIYDAL 607


>UVRC_BORBR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  311 bits (796), Expect = 1e-86
 Identities = 232/633 (36%), Positives = 329/633 (51%), Gaps = 47/633 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G V+YVGKA++L+ R+SSYFQ   A  PR   M++  A VD TV  
Sbjct: 14  LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVTVTR 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK   PR+N+ +RDDKSYPYL +T    +PR+   RGA  +  +YFGP
Sbjct: 73  SXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLIT-GHAWPRIAYYRGATSKRGQYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  +WA+R+T+ +L +VF +RTC   VF    +  RPCLL  I +CSAPCVG I   +Y 
Sbjct: 132 YPNSWAVRETIQILQKVFRLRTCEDTVFA---NRSRPCLLHQIGRCSAPCVGVIEAGDYA 188

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ GE    +                     +RD + +L  V+ +Q +    
Sbjct: 189 HDVQRAVRFLNGEAREVMDEIEARMLQASTELRFEEAAVLRDQMGSLSKVLHQQTMENVG 248

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA+A    +  V +  VRGGR  G++ +     E     +++E F+AQ Y    
Sbjct: 249 GDDTDVIAVASAGGKICVNLAMVRGGRHLGDKPFFPTHAEGEQPAQVLEAFVAQHYADG- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGA-AVDVRVPQRGDKRALMETVLKNAEQ 372
                 A+P  VLV +       +V  L+++ G  A  V    +G +R+ +E   KNAE 
Sbjct: 308 ------AMP-PVLVCSHALPDSGLVGLLAEQGGTRAARVLTRPQGVRRSWLEQAQKNAEM 360

Query: 373 TLARHKSQRASDL-TTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            LAR  ++  +                        RIECFDIS   GE T AS VVF   
Sbjct: 361 ALARALTESGARAGRXXXXXXXXXXXXXXXXXXXXRIECFDISHTAGEATQASCVVFLHH 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             + S YRR++I G    D D AAM +V++RRF +                      A+ 
Sbjct: 421 DMQPSLYRRYNIVGITPGD-DYAAMRQVLTRRFGKV---------------------ADG 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
           +AP     P LV++DGG+ QV  A++   +LG++  ++ G+AK       LE +      
Sbjct: 459 EAPM----PGLVLIDGGKGQVEVARQVFVELGLDIQSLVGVAKGEGRKVGLETLVFADGR 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+ L + S  L L+ +VRDEAHRFAI+  R +RAK    S L++I G+G  RR  LL  
Sbjct: 515 PPVALGKESAALMLIAQVRDEAHRFAITGMRARRAKTRNVSRLEEIEGIGARRRQRLLAR 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FG +  ++ A+  ++A V GI +  A  IY+ L
Sbjct: 575 FGGLSGVSSASIEDLASVEGISQELAVRIYDAL 607


>UVRC_SHEDO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  310 bits (795), Expect = 2e-86
 Identities = 210/635 (33%), Positives = 317/635 (49%), Gaps = 49/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ +  GVYR  D  G VIYVGKAK+L+ RLSSYF+  +  + +TQ ++S   ++D T+ 
Sbjct: 12  NLSSSAGVYRMYDAKGEVIYVGKAKDLKKRLSSYFRA-NLGNIKTQALVSHITNIDVTLT 70

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           ++E +AL LE  +IK+Y P++NV  RDDKSYPYL ++   + PR+   RG +R   RYFG
Sbjct: 71  HSETDALLLENDYIKQYMPKYNVLLRDDKSYPYLFLS-GHKHPRLAYHRGPQREKGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY    A+R++++LL ++FP+R C   ++ +AR+  RPCL   + +CSAPCV ++  E+Y
Sbjct: 130 PYPNGGAVRESLNLLQKLFPIRQCD-DLYYKART--RPCLQYQLGRCSAPCVNKVTDEDY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD I ALR V E+Q V L 
Sbjct: 187 AEQVQLASLFLQGKDQQVVTNLVTKMEQAAEEFHYEQAAAYRDQITALRKVAEQQEVSL- 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           D  D DVI +  ++  A   + ++R G+I G R +           +++  F++Q Y  A
Sbjct: 246 DKGDMDVIGVHYEKAIACFHMLFIRSGKIFGSRSYYPSVPAQTDIDEVLSAFISQFYLNA 305

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           D + +   +P EV++S   +D                 ++   RG++ +           
Sbjct: 306 DVQRT---LPNEVILSQSFSDXXXXXXXXXXXXXXXFIIKTQVRGERASF----XXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                      D  T+ +                R+ECFDIS   GE TVAS VVF    
Sbjct: 359 XXXXXXXXXXXDKNTQEQRFSLLEEALELGHSIGRMECFDISHTMGESTVASCVVFNREG 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRR++I G  G D D AAM + I+RRF +          +DT G+          
Sbjct: 419 PHKADYRRYNISGITGGD-DYAAMEQAINRRFDK----------IDTNGK---------- 457

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDD---------LGIEDVAVCGLAKRLEEVWLPG 543
                  P++V +DGG  Q+  AQ  +D+         L I      G    LE     G
Sbjct: 458 ------VPDIVFIDGGLGQLRIAQGIVDEKCAHLDRPPLLIGVTKGEGRKAGLETFVFGG 511

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            E    LP  S   +L+  +RDE+HRFAI+ HR KR K    S L+ I G+GP RR ALL
Sbjct: 512 SEQQFNLPSDSGAFHLILHIRDESHRFAITGHRNKRQKTRNTSSLESIAGVGPKRRKALL 571

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +H G ++ +  A+ AE+ +VPGI    AQTI++ L
Sbjct: 572 QHLGGLQEVKGASVAELTKVPGISLEMAQTIHDAL 606


>UVRC_BORPE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  310 bits (795), Expect = 2e-86
 Identities = 233/633 (36%), Positives = 329/633 (51%), Gaps = 47/633 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D  G  +YVGKA++L+ R+SSYFQ   A  PR   M++  A VD TV  
Sbjct: 14  LPHLPGVYRHLDAAGEAMYVGKARDLKKRVSSYFQKNLA-SPRIAQMVAKVASVDVTVTR 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK   PR+N+ +RDDKSYPYL +T    +PR+   RGA  +  +YFGP
Sbjct: 73  SXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLIT-GHAWPRIAYYRGATSKRGQYFGP 131

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  +WA+R+T+ +L +VF +RTC   VF    +  RPCLL  I +CSAPCVG I  E+Y 
Sbjct: 132 YPNSWAVRETIQILQKVFRLRTCEDTVFA---NRSRPCLLHQIGRCSAPCVGVIEAEDYA 188

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              +    F+ GE    +                     +RD + +L  V+ +Q +    
Sbjct: 189 HDVQRAVRFLNGEAREVMDEIEARMLQASTELRFEEAAVLRDQMGSLSKVLHQQTMENVG 248

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D DVIA+A    +  V +  VRGGR  G++ +     E     +++E F+AQ Y    
Sbjct: 249 GDDTDVIAVASAGGKICVNLAMVRGGRHLGDKPFFPTHAEGEQPAQVLEAFVAQHYADG- 307

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQ 372
                 A+P  VLV +       +V  L+++ G  V  V    +G +R+ +E   KNAE 
Sbjct: 308 ------AMP-PVLVCSHALPDSGLVGLLAEQGGTRVARVLTRPQGVRRSWLEQAQKNAEM 360

Query: 373 TLARHKSQRASDL-TTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            LAR  ++  +                        RIECFDIS   GE T AS VVF   
Sbjct: 361 ALARALTESGARAGRXXXXXXXXXXXXXXXXXXXXRIECFDISHTAGEATQASCVVFLHH 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             + S YRR++I G    D D AAM +V++RRF +  +           GE  AP     
Sbjct: 421 DMQPSLYRRYNIVGITPGD-DYAAMRQVLTRRFGKVTD-----------GE--APM---- 462

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
                   P LV++DGG+ QV  A++   +LG++  ++ G+AK       LE +      
Sbjct: 463 --------PGLVLIDGGKGQVEVARQVFVELGLDIQSLVGVAKGEGRKVGLETLVFADGR 514

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+ L + S  L L+ +VRDEAHRFAI+  R +RAK    S L++I G+G  RR  LL  
Sbjct: 515 PPVALGKESAALMLIAQVRDEAHRFAITGMRARRAKTRNVSRLEEIEGIGARRRQRLLAR 574

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FG +  ++ A+  ++A V GI +  A  IY+ L
Sbjct: 575 FGGLSGVSSASIEDLASVEGISQELAVRIYDAL 607


>UVRC_AZOSE RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 602

 Score =  310 bits (795), Expect = 2e-86
 Identities = 225/633 (35%), Positives = 316/633 (49%), Gaps = 54/633 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P +PGVYR      RV+YVGKAKNL+ R+SSYFQ      PR   M++    VD T  
Sbjct: 16  TVPEEPGVYRMIGADERVLYVGKAKNLKRRVSSYFQRTQP-SPRIAMMVAQILRVDITPT 74

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +           IK  +PR+N+ +RDDK+YPY+ ++  +EFPR+   RGA  +G RYFG
Sbjct: 75  RSXXXXXXXXXXXIKSLAPRYNILFRDDKTYPYIELS-GDEFPRLAYHRGAFTKGARYFG 133

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P+   WA+R+++ LL + F +RTC   VF   ++  RPCLL  I +C+APCVG I  E Y
Sbjct: 134 PFPNVWAVRESIHLLQKTFRLRTCENPVF---QNRSRPCLLHQIKRCTAPCVGLIDKEAY 190

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
            A       F+ G     +                      RD ++ L+ V+ +Q V   
Sbjct: 191 AADVRLAARFLEGRASEVIDDLTARMHXXXXXXXXXXXXXCRDQVRVLQAVLARQFVDSR 250

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+IA  E+     V +  VRGGR  G+R         +        F+ Q Y   
Sbjct: 251 KDEDVDIIAAVEEGSVTCVNIAMVRGGRHLGDRPQFPSATAGIGMLDAALAFIEQHYREH 310

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           +       +P ++LV    A    V   + +       + VP+   ++  M         
Sbjct: 311 E-------LPAKLLVDVPLA---PVRVLMDEICDKPCTLLVPRLQAEKVWMGM----XXX 356

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                      D                    P RIECFDIS   GE TVAS VV  DG 
Sbjct: 357 XXXXXXXXXXXDTGRAEMRLEALRETLDLAEAPRRIECFDISHTMGEATVASCVVSVDGA 416

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            + SEYRR++I G    D D AAM +V+ RR+                G+  A +G    
Sbjct: 417 MKNSEYRRYNITGITPGD-DFAAMRQVLERRY----------------GKVAAGEGV--- 456

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPII--- 549
                  P+L+++DGG+ QV++A+  L D+G+E +A+ G+AK  E    PG E  +    
Sbjct: 457 ------CPDLILIDGGKGQVSSARSVLADVGLESIAMVGVAKGEER--KPGLETLVFPDG 508

Query: 550 ----LPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
               L      L+L+Q +RDEAHRFAI+ HR +RAKA   S L+DIPG+GP+RR  LL  
Sbjct: 509 RMQNLAIDHPALHLIQEIRDEAHRFAITGHRARRAKARIGSRLEDIPGIGPMRRRNLLAS 568

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           FG +  +  AT  ++  V G+  +TA+ IY  L
Sbjct: 569 FGGLDGVRAATVEDLCRVGGVSRKTAEAIYNAL 601


>UVRC_VIBVU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  310 bits (794), Expect = 2e-86
 Identities = 211/636 (33%), Positives = 313/636 (49%), Gaps = 50/636 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RLSSYF+       +T+ ++S  A +D TV 
Sbjct: 13  TVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRK-KVDSEKTKALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ +   PRV + RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHRH-PRVSLHRGAKKRKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR-IGVEE 191
           PY  + A+R+T+ L+ ++FPVR C   V+    +  RPCL+  I +C+ PCV   I   +
Sbjct: 131 PYPDSGAVRETLHLIQKIFPVRQCEDTVY---ANRTRPCLMYQIGRCAGPCVSSVISDVD 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  L      F+ G+  + L                      RD IQA+R V E+Q V  
Sbjct: 188 YAELVGYLRLFLQGKDNQVLELLVQKMEIASQQLKFEDAAKFRDQIQAIRRVQEQQYVSE 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DV+  A++   A + +  +R G++ G R       ++ +  ++ + FL Q Y  
Sbjct: 248 DSQEDMDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPQNTNAQEVFDSFLTQYY-- 305

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
               E+ T   R +L     AD +A+   LS   G  V       G +   ++    NA 
Sbjct: 306 LSHNEARTIPSRIILNQELAADVEAIQLALSDVAGRKVQFHTSPSGSRGRYLKLSNTNA- 364

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            T    K      +  R K                R+ECFDIS   GE T+AS VVF   
Sbjct: 365 LTAMTTKINHKMTINQRFKALRDVLAMDSI----ARMECFDISHTMGESTIASCVVFNSE 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              K EYRR++I G  G D D AAM + + RR+ + L+  +                   
Sbjct: 421 GPVKQEYRRYNITGITGGD-DYAAMGQALERRYAKQLDVEK------------------- 460

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRAL----DDLGIEDVAVCGLAKRLE-----EVWLP 542
                   P+++ +DGG+ Q+  A   +     D     V + G+AK +      E  + 
Sbjct: 461 -------IPDIIFIDGGKGQLNRAHEIIVQYWGDWPKRPVMI-GIAKGVTRKPGLETLIT 512

Query: 543 GEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAAL 602
            + D   LP     L+L+Q +RDE+H  AI+ HR KR K    S L+ I G+GP RR AL
Sbjct: 513 VDGDEFHLPSDDPALHLIQHIRDESHNHAIAGHRAKRGKTRKTSALEGIEGVGPKRRQAL 572

Query: 603 LKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LK+ G ++ L +A+  EIA+VPGI    A+ IY+ L
Sbjct: 573 LKYTGGLQELKRASVEEIAKVPGISHSLAEIIYQAL 608


>UVRC_PSEA6 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  310 bits (794), Expect = 2e-86
 Identities = 207/633 (32%), Positives = 325/633 (51%), Gaps = 50/633 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +   PGVYR  +    VIYVGKAKNL+ R+SSYF+       +TQ+++   A +D TVV+
Sbjct: 16  LTNQPGVYRMYNHKQDVIYVGKAKNLKNRVSSYFRS-QVDSIKTQSLVKQIAHMDVTVVH 74

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E EA  LE ++IK+Y PR+NV  RDDKSYP++ ++ + + PR+   RG ++R   YFGP
Sbjct: 75  SEAEAFILENNFIKKYKPRYNVLLRDDKSYPFIFLS-DHQHPRLANHRGPKKRKGEYFGP 133

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           Y  AWA+R+++  + R+FP+R C    + RARS  RPCL   + +C+ PCV G +  E+Y
Sbjct: 134 YPSAWAVRESLRTMQRIFPIRQCEDSYY-RARS--RPCLQYQLQRCAGPCVEGLVSDEDY 190

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +A  +    F+ G+  + +                      RD I AL  V E+Q V  G
Sbjct: 191 QAQVDLARMFLKGKNKQVIDSLVQHMERASTDLRFEAAARYRDQISALNKVQEQQWVS-G 249

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
           +  + DV   A     A++Q  ++R  ++ G + +      + +  ++ + F+ Q Y   
Sbjct: 250 NQEEMDVFGFAYRNGIASIQGLFIRDNKLLGSKSFYPKVPAEATDEEVFQSFILQFYLAG 309

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           +       IP++++   E  ++ A+   L+K  G  +      R +KR  ++    NAE 
Sbjct: 310 NK-----VIPKQIVTPLELNEQGAIEELLTKEAGRRIQFYRGARDEKRRYLDLANTNAEN 364

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            L   + Q+ S     ++                R+ECFDIS   G+ TVAS VVF    
Sbjct: 365 ALIAKQGQQKSVFARYTELEKILEFEQPIQ----RMECFDISHTSGQLTVASCVVFNREG 420

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K++YRRF+I G    D D AAM + ++RR+    ++S+                    
Sbjct: 421 PFKADYRRFNIEGITPGD-DYAAMAQALARRYRDVKDDSKI------------------- 460

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVC-GLAKR------LEEVWLPGEE 545
                  P+++ +DGG+ Q+  A+   +D   E   +  G+AK       LE + L G  
Sbjct: 461 -------PDILFIDGGKGQLTQAEDYFEDWKHEKKPLLIGVAKGSSRKAGLETLILAGNH 513

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
             I L   S  L+L+Q +RDE+HRFAI+ HR +R K    S L+ IPG+G  RR +LLK+
Sbjct: 514 ATIPLSGDSIALHLIQHIRDESHRFAITGHRARRQKDKKTSKLESIPGVGAKRRQSLLKY 573

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            G ++ + QA+ +EIA VPGI    A TIY+ +
Sbjct: 574 MGGLQGILQASRSEIANVPGISAELADTIYDHI 606


>UVRC_VIBVY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  310 bits (793), Expect = 3e-86
 Identities = 211/636 (33%), Positives = 313/636 (49%), Gaps = 50/636 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RLSSYF+       +T+ ++S  A +D TV 
Sbjct: 13  TVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRK-KVDSEKTKALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ +   PRV + RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHRH-PRVSLHRGAKKRKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR-IGVEE 191
           PY  + A+R+T+ L+ ++FPVR C   V+    +  RPCL+  I +C+ PCV   I   +
Sbjct: 131 PYPDSGAVRETLHLIQKIFPVRQCEDTVY---ANRTRPCLMYQIGRCAGPCVSSVISDVD 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y  L      F+ G+  + L                      RD IQA+R V E+Q V  
Sbjct: 188 YAELVGYLRLFLQGKDNQVLELLVQKMEIASQQLKFEDAAKFRDQIQAIRRVQEQQYVSE 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DV+  A++   A + +  +R G++ G R       ++ +  ++ + FL Q Y  
Sbjct: 248 DSQEDMDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPQNTNAQEVFDSFLTQYY-- 305

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
               E+ T   R +L     AD +A+   LS   G  V       G +   ++    NA 
Sbjct: 306 LSHNEARTIPSRIILNQELAADVEAIQLALSDVAGRKVQFHTSPSGSRGRYLKLSNTNA- 364

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
            T    K      +  R K                R+ECFDIS   GE T+AS VVF   
Sbjct: 365 LTAMTTKINHKMTINQRFKALRDVLAMDSI----ARMECFDISHTMGESTIASCVVFNSE 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              K EYRR++I G  G D D AAM + + RR+ + L+  +                   
Sbjct: 421 GPVKQEYRRYNITGITGGD-DYAAMGQALERRYAKQLDVEK------------------- 460

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRAL----DDLGIEDVAVCGLAKRLE-----EVWLP 542
                   P+++ +DGG+ Q+  A   +     D     V + G+AK +      E  + 
Sbjct: 461 -------IPDVIFIDGGKGQLNRAHEIIAQYWGDWPKRPVMI-GIAKGVTRKPGLETLIT 512

Query: 543 GEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAAL 602
            + D   LP     L+L+Q +RDE+H  AI+ HR KR K    S L+ I G+GP RR AL
Sbjct: 513 VDGDEFHLPSDDPALHLIQHIRDESHNHAIAGHRAKRGKTRKTSALEGIEGVGPKRRQAL 572

Query: 603 LKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LK+ G ++ L +A+  EIA+VPGI    A+ IY+ L
Sbjct: 573 LKYTGGLQELKRASVEEIAKVPGISHSLAEIIYQAL 608


>UVRC_COXBU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  310 bits (793), Expect = 3e-86
 Identities = 201/630 (31%), Positives = 310/630 (49%), Gaps = 45/630 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT  GVY+ +D  G+VIYVGKA+NL+ R+SSYF+    L  +TQ M++    +  T+ 
Sbjct: 12  TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTTIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
             E EAL LE S+IK++ PR+NV  RDDKSYPYL +  +++FPR+   RGA++   RYFG
Sbjct: 70  RNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  A ++R+ + L+ ++F +R CS   FK   +  RPCL   I +C+APCVG +  +EY
Sbjct: 130 PYPNAGSVRENLALIQKLFKLRQCSESFFK---NRTRPCLQYQIKRCTAPCVGYVNEQEY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   ED   F  G+  + +                      RD                G
Sbjct: 187 RRQVEDAILFFEGKNDQVIIKLTERMEVTSENLVFEEAAHYRDXXXXXXXXXXXXXXT-G 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + D+I IAE        + ++R GR+ G + +  +     +    + +F+ Q Y   
Sbjct: 246 GKGNIDIIGIAESNGAIGFAILFIRSGRMIGHKPFFPNTPLGTTLQTALVEFIPQYY--- 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP  ++ S    DR     W+ +   + ++ ++     KRA  +        
Sbjct: 303 LSPLRNGDIPERIVTSEPLEDR----LWIQRALSSGLNRKLAITDQKRAPYKXXXXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                         T +                 RIECFDIS   GE TVAS VVF +  
Sbjct: 359 XXXXXXXXXXXXKNTFALKLEAIQKSLALPNPIARIECFDISHTLGEATVASCVVFGEEG 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K +YRRF+I G    D D  A+ + ++RR+ R L+E + +                  
Sbjct: 419 PIKKDYRRFNISGVTPGD-DYGALRQALTRRYVR-LKEGEGI------------------ 458

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEED 546
                  P+++++DGG  Q+  A   L++L +  V +  +AK       LE++++ G  +
Sbjct: 459 ------LPDVLLIDGGMGQLRQAAEVLEELQVSGVILTAIAKGPGRKAGLEKLFVWGRRE 512

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            I LP  +   +L+Q++RDEAHRFAI+ H  +RAK    S L +I G+GP RR  LLK+F
Sbjct: 513 EIHLPADNIAFHLIQQIRDEAHRFAITAHCNRRAKRRVESTLQEIEGIGPKRRQKLLKYF 572

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G ++ L +A+  EIA VPG+ E  A+ IY+
Sbjct: 573 GGLQELQRASIEEIARVPGVSETLAKAIYD 602


>UVRC_COXBR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  310 bits (793), Expect = 3e-86
 Identities = 201/630 (31%), Positives = 310/630 (49%), Gaps = 45/630 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT  GVY+ +D  G+VIYVGKA+NL+ R+SSYF+    L  +TQ M++    +  T+ 
Sbjct: 12  TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTTIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
             E EAL LE S+IK++ PR+NV  RDDKSYPYL +  +++FPR+   RGA++   RYFG
Sbjct: 70  RNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  A ++R+ + L+ ++F +R CS   FK   +  RPCL   I +C+APCVG +  +EY
Sbjct: 130 PYPNAGSVRENLALIQKLFKLRQCSESFFK---NRTRPCLQYQIKRCTAPCVGYVNEQEY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   ED   F  G+  + +                      RD                G
Sbjct: 187 RRQVEDAILFFEGKNDQVIIKLTERMEVASENLVFEEAAHYRDXXXXXXXXXXXXXXT-G 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + D+I IAE        + ++R GR+ G + +  +     +    + +F+ Q Y   
Sbjct: 246 GKGNIDIIGIAESNGAIGFAILFIRSGRMIGHKPFFPNTPLGTTLQTALVEFIPQYY--- 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP  ++ S    DR     W+ +   + ++ ++     KRA  +        
Sbjct: 303 LSPLRNGDIPERIVTSEPLEDR----LWIQRALSSGLNRKLAITDQKRAPYKXXXXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                         T +                 RIECFDIS   GE TVAS VVF +  
Sbjct: 359 XXXXXXXXXXXXKNTFALKLEAIQKSLALPNPIARIECFDISHTLGEATVASCVVFGEEG 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K +YRRF+I G    D D  A+ + ++RR+ R L+E + +                  
Sbjct: 419 PIKKDYRRFNISGVTPGD-DYGALRQALTRRYVR-LKEGEGI------------------ 458

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEED 546
                  P+++++DGG  Q+  A   L++L +  V +  +AK       LE++++ G  +
Sbjct: 459 ------LPDVLLIDGGMGQLRQAAEVLEELQVSGVILTAIAKGPGRKAGLEKLFVWGRRE 512

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            I LP  +   +L+Q++RDEAHRFAI+ H  +RAK    S L +I G+GP RR  LLK+F
Sbjct: 513 EIHLPADNIAFHLIQQIRDEAHRFAITAHCNRRAKRRVESTLQEIEGIGPKRRQKLLKYF 572

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G ++ L +A+  EIA VPG+ E  A+ IY+
Sbjct: 573 GGLQELQRASIEEIARVPGVSETLAKAIYD 602


>UVRC_COXB2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  310 bits (793), Expect = 3e-86
 Identities = 201/630 (31%), Positives = 310/630 (49%), Gaps = 45/630 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++PT  GVY+ +D  G+VIYVGKA+NL+ R+SSYF+    L  +TQ M++    +  T+ 
Sbjct: 12  TLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFR--RQLDSKTQAMMAQVQSIQTTIT 69

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
             E EAL LE S+IK++ PR+NV  RDDKSYPYL +  +++FPR+   RGA++   RYFG
Sbjct: 70  RNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           PY  A ++R+ + L+ ++F +R CS   FK   +  RPCL   I +C+APCVG +  +EY
Sbjct: 130 PYPNAGSVRENLALIQKLFKLRQCSESFFK---NRTRPCLQYQIKRCTAPCVGYVNEQEY 186

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           R   ED   F  G+  + +                      RD                G
Sbjct: 187 RRQVEDAILFFEGKNDQVIIKLTERMEVASENLVFEEAAHYRDXXXXXXXXXXXXXXT-G 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + D+I IAE        + ++R GR+ G + +  +     +    + +F+ Q Y   
Sbjct: 246 GKGNIDIIGIAESNGAIGFAILFIRSGRMIGHKPFFPNTPLGTTLQTALVEFIPQYY--- 302

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
                   IP  ++ S    DR     W+ +   + ++ ++     KRA  +        
Sbjct: 303 LSPLRNGDIPERIVTSEPLEDR----LWIQRALSSGLNRKLAITDQKRAPYKXXXXXXXX 358

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
                         T +                 RIECFDIS   GE TVAS VVF +  
Sbjct: 359 XXXXXXXXXXXXKNTFALKLEAIQKSLALPNPIARIECFDISHTLGEATVASCVVFGEEG 418

Query: 433 ARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
             K +YRRF+I G    D D  A+ + ++RR+ R L+E + +                  
Sbjct: 419 PIKKDYRRFNISGVTPGD-DYGALRQALTRRYVR-LKEGEGI------------------ 458

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEED 546
                  P+++++DGG  Q+  A   L++L +  V +  +AK       LE++++ G  +
Sbjct: 459 ------LPDVLLIDGGMGQLRQAAEVLEELQVSGVILTAIAKGPGRKAGLEKLFVWGRRE 512

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            I LP  +   +L+Q++RDEAHRFAI+ H  +RAK    S L +I G+GP RR  LLK+F
Sbjct: 513 EIHLPADNIAFHLIQQIRDEAHRFAITAHCNRRAKRRVESTLQEIEGIGPKRRQKLLKYF 572

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G ++ L +A+  EIA VPG+ E  A+ IY+
Sbjct: 573 GGLQELQRASIEEIARVPGVSETLAKAIYD 602


>UVRC_BURVG RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 683

 Score =  308 bits (790), Expect = 7e-86
 Identities = 215/681 (31%), Positives = 326/681 (47%), Gaps = 74/681 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TV  
Sbjct: 20  LPHMPGVYRYYDATGAVLYVGKARDLKKRVSSYFTK-TQLSPRIAMMVTRIARIETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T +  FPR+   RG+  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTAHR-FPRMAYYRGSVDKQNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  AWA+R+++ +L RVF +RTC   VF    +  RPCLL  I +C+APCVG I  ++Y 
Sbjct: 138 FPSAWAVRESIQILQRVFQLRTCEDSVF---NNRTRPCLLHQIGRCTAPCVGAITEDDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
               +   F+ G     +                     +R+ + +L TV+ +QA+ +G 
Sbjct: 195 IDVSNAARFLLGRQSEVMNELEQKMHAFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGG 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVST---------------- 297
            +D D++A+        V +  VRGGR  G++ +    VE   T                
Sbjct: 255 DSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTXXXXXXXXXXXXXXXX 314

Query: 298 ---------------------------------GKLVEQFLAQTYGGADDEESTTAIPRE 324
                                               ++ F++Q Y G         +P  
Sbjct: 315 XXXMPDQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDAFISQHYLG-------NRVPPV 367

Query: 325 VLVSAEPADRDAVVAWLSKRRGAAVD-VRVPQRGDKRALMETVLKNAEQTLARHKSQRAS 383
           ++VS  PA RD ++  LS++ G  V  VR PQ G +RA +    +NA   LAR  S++ S
Sbjct: 368 LVVSHAPASRD-LLELLSEQAGHKVSLVRQPQ-GQRRAWLTMAEQNARIALARLLSEQGS 425

Query: 384 DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSI 443
               R++               LRIECFDIS   GE T AS VV+     +  EYRR++I
Sbjct: 426 Q-QARTRALAETLGLECDDLATLRIECFDISHTMGEATQASCVVYHHHKMQSGEYRRYNI 484

Query: 444 RGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLV 503
            G    D D AAM +V++RR+ + +E             +G    + R+A   +  PN+V
Sbjct: 485 AGITPGD-DYAAMRQVLTRRYEKMVE--LXXXXXXXXXXTGIDGESTRQAEASSLLPNIV 541

Query: 504 VVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGL 557
           ++DGG+ QV  A++   +LG++   + G+AK       LE +       P+ L + S  L
Sbjct: 542 LIDGGKGQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRTPLELGKESAAL 601

Query: 558 YLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATA 617
            L+ ++RDEAHRFAI+  R KRAKA   S L+++ G+G  RR  LL  FG +R       
Sbjct: 602 MLVAQIRDEAHRFAITGMRAKRAKARQTSRLEELDGVGAKRRQRLLARFGGLRGXXXXXX 661

Query: 618 AEIAEVPGIGERTAQTIYERL 638
                  GI    A+ IY++L
Sbjct: 662 XXXXXXDGISHALAEQIYKQL 682


>UVRC_NITEU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 604

 Score =  308 bits (789), Expect = 9e-86
 Identities = 205/634 (32%), Positives = 303/634 (47%), Gaps = 52/634 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYR  +  G VIYVGKA +LR R+SSYFQ  S L PR Q M+S  A ++ TV 
Sbjct: 14  TLPAQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQK-SGLSPRIQLMVSQIAGIETTVT 72

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
            +           IK  +PR+N+ +RDDKSYPYL +T    FPR+   RGA     +YFG
Sbjct: 73  RSXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYLLLT-RHIFPRLAFYRGALDDRHQYFG 131

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P+  A  ++ ++ LL +VF +RTC   VF       RPCLL  I +CS PCVG I  E Y
Sbjct: 132 PFPNAGVVKSSIQLLQKVFRLRTCENSVFDHRT---RPCLLYQIKRCSGPCVGLITPEAY 188

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
           +   +    F+ G+    L+                    +RD +QALR + EKQ V  G
Sbjct: 189 QQDVKSAAMFLQGKQDEVLKTIEQKMFTASDQQDYEQAAQLRDQMQALRKIQEKQFVDSG 248

Query: 253 DSTDCDVI--AIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            + D DVI  AI  D    AV +  +R GR  G++ +    V +     ++E F+ Q Y 
Sbjct: 249 KALDADVIACAIEPDSHAVAVNLVMIRSGRHLGDKTFFPQNVYEADISTVLEAFVTQHY- 307

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
                    ++P  +++  +      +   LS + G  + +     G++R  ++   +N 
Sbjct: 308 ------LNRSVP-PLIILGQKIRVTLLQKLLSDQAGHKITLTTNPIGERRKWLDMAAEN- 359

Query: 371 EQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFED 430
                              +                RIECFDIS   GE T+AS VV++ 
Sbjct: 360 ----XXXXXXXXXXXXXXXEDRLQALQEALNLPGLARIECFDISHTMGEATIASCVVYDR 415

Query: 431 GLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE 490
              R  EYRR++I G    D D AAM +V+ RR+ +   E  ++                
Sbjct: 416 FAMRNGEYRRYNITGIVPGD-DYAAMRDVLQRRYAKLAMEEGKL---------------- 458

Query: 491 RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGE 544
                    P+L+++DGG+ Q+  A   + +LG+ D+ + G+AK       LE++ LP +
Sbjct: 459 ---------PDLILIDGGKGQIRVASEVMIELGLNDIPLVGVAKGETRKPGLEQLILPWQ 509

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
           E+             +Q++RDEAHRFAI  HR KRAK    S L+ I G+G  RR +LL 
Sbjct: 510 EEXXXXXXXXXXXXXIQQIRDEAHRFAIQGHRAKRAKTRKISTLEQISGIGTKRRQSLLT 569

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            FG ++ +  A+  E+ +  GI    A+ IY  L
Sbjct: 570 RFGGLKGVKNASIEELQQTEGISRSLAEKIYREL 603


>UVRC_DECAR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 603

 Score =  308 bits (789), Expect = 9e-86
 Identities = 215/627 (34%), Positives = 307/627 (48%), Gaps = 46/627 (7%)

Query: 18  PGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNTEVE 77
           PGVYR  D  G V+YVGKAKNL+ R++SYF++ +   PR   M+S  A +          
Sbjct: 16  PGVYRMLDIGGNVLYVGKAKNLKKRVASYFRE-NLSSPRIAHMVSQIASIXXXXXXXXXX 74

Query: 78  ALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYA 137
                   IK  +PR+N+ +RDDKSYPY+ ++  + FPR+   RG   R   YFGPY  +
Sbjct: 75  XXXXXXXXIKSLAPRYNILFRDDKSYPYIVLSKGK-FPRLGFFRGNPDRKADYFGPYPSS 133

Query: 138 WAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAE 197
           WA+RD++ L+ ++F +RTC   VF    +  RPCLL  I +CS PCVG I  ++Y A  +
Sbjct: 134 WAVRDSIHLMQKMFRLRTCEDTVFS---NRSRPCLLYQIKRCSGPCVGFISADDYAADIQ 190

Query: 198 DFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDSTDC 257
               F+ G+     R                     RD IQ+L  V EKQ V      D 
Sbjct: 191 LAAMFLLGKQQEVTRRLTKSMEEASAKLAFEQAAVFRDQIQSLHQVQEKQFVSSSKGEDV 250

Query: 258 DVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEES 317
           DV+   ++  +  V +  VRGGR  G+R +      D         F+ Q Y        
Sbjct: 251 DVLVAIKEAGQLCVNLAMVRGGRHLGDRPFFPTNAADSEPSDACAAFIRQHYAAHPAPAR 310

Query: 318 TTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARH 377
             + P   L S + A    V   L++  G  V V+  +    +A +E  ++NA   +   
Sbjct: 311 ILSYP---LPSEDEAGETEVA--LAELAGRPVPVQEGRGATHKAWVEMAIQNARLAILAK 365

Query: 378 KSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSE 437
                                        RIECFDIS   GE TVAS VV+E    +KS+
Sbjct: 366 NXXXXXXXXXXXXXXXXXXXPEPI----ARIECFDISHTMGEATVASCVVYEGNRMKKSD 421

Query: 438 YRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFA 497
           YRRF+IR  +  D D AAM + +SRR+             D++       G E  A    
Sbjct: 422 YRRFNIRDIQAGD-DYAAMRQAVSRRY-------------DSIA------GGEGTA---- 457

Query: 498 YPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILP 551
             P+L+++DGG+ QV++A  AL DLG+  + + G+AK       LE +  P   +     
Sbjct: 458 --PDLILIDGGKGQVSSAFSALADLGLTHLPMIGVAKGEERKPGLETLIFPEGREXXXXX 515

Query: 552 RTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRR 611
                   +Q +RDEAHRFAI+ HR +R KA   S L+ +PG+GP RR AL+  FG +  
Sbjct: 516 XXXXXXXXIQEIRDEAHRFAITGHRAQRGKARKTSKLESLPGIGPARRKALVARFGGLPG 575

Query: 612 LAQATAAEIAEVPGIGERTAQTIYERL 638
           +  A+  ++AEVPG+    A+ I+  L
Sbjct: 576 VLAASIDQLAEVPGVSREMAEKIHSAL 602


>UVRC_SHIDS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 575

 Score =  308 bits (788), Expect = 1e-85
 Identities = 203/607 (33%), Positives = 313/607 (51%), Gaps = 58/607 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++ + PGVYR  D  G VIYVGKAK+L+ RLSSYF+   A   +T+ +++    +D TV 
Sbjct: 13  TVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASR-KTEALVAQIQQIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK Y PR+NV  RDDKSYP++ ++  +  PR+ + RGA+     YFG
Sbjct: 72  HTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLS-GDTHPRLAMHRGAKHAKGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           P+   +A+R+T+ LL ++FP+R C   V+   R+  RPCL   I +C  PCV G +  EE
Sbjct: 131 PFPNGYAVRETLALLQKIFPIRQCENSVY---RNRSRPCLQYQIGRCLGPCVEGLVSEEE 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F++G+  + L                     IRD IQA+R V EKQ  V 
Sbjct: 188 YAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVTEKQ-FVS 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D DVI +A D   A V V ++R G++ G R +           ++VE F+ Q Y  
Sbjct: 247 NTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFVGQFYLQ 306

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                +   +P E+L+    +D+  +   LS+  G  ++V+   RGD+   ++    NA 
Sbjct: 307 GSQMRT---LPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLARTNAA 363

Query: 372 QTLARHKSQRAS---DLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVF 428
             L    SQ+++    LT  +                 R+ECFDIS   GE TVAS VVF
Sbjct: 364 TALTSKLSQQSTVHQRLTALASVLKLPEVK--------RMECFDISHTMGEQTVASCVVF 415

Query: 429 EDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQG 488
           +     ++EYRR++I G    D D AAM +V+ RR+ + +++S+                
Sbjct: 416 DANGPLRAEYRRYNITGITPGD-DYAAMNQVLRRRYGKAIDDSK---------------- 458

Query: 489 AERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEE 538
                      P+++++DGG+ Q+A A+    +L +        + G+AK       LE 
Sbjct: 459 ----------IPDVILIDGGKGQLAQAKNVFAELDVSWDKNHPLLLGVAKGADRKAGLET 508

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           ++   E +   LP  S  L+++Q +RDE+H  AI  HR+KRAK    S L+ I G+GP R
Sbjct: 509 LFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAIGGHRKKRAKVKNTSSLETIEGVGPKR 568

Query: 599 RAALLKH 605
           R  ++++
Sbjct: 569 RQNVVEN 575


>UVRC_RALSO RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 654

 Score =  308 bits (788), Expect = 1e-85
 Identities = 218/660 (33%), Positives = 321/660 (48%), Gaps = 71/660 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P+ PGVYR+ D  G V+YVGKA++L+ R+SSYF   + L PR   M++  A ++ TVV 
Sbjct: 30  LPSLPGVYRYFDAQGSVLYVGKARDLKKRVSSYFTK-TLLSPRIAMMVAKIAHIETTVVR 88

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +                PR+N+ +RDDKSYPYL +T    +PR+   RGA  R  +YFGP
Sbjct: 89  SXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-QHAYPRMAYYRGATDRKHQYFGP 147

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +  A A+R+++ +L +VF +RTC   VF       RPCLL  I +C+APCV  I  E+Y 
Sbjct: 148 FPSAHAVRESMQILQKVFQLRTCEDTVFNNRT---RPCLLHQIHRCTAPCVQAISAEDYA 204

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVV-LG 252
               +   F+ G     ++                    +RD I AL TV+ +Q+V  +G
Sbjct: 205 RDVANAAGFLLGRQDEVMQTLQDKMQRHAAALEFEQAATVRDQIGALSTVLTRQSVEEVG 264

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVE------------DVSTGK- 299
            ++D D++A+A     A V +  VRGGR  G++ +    VE            DV  G  
Sbjct: 265 QASDIDILAVAIKGGHACVNLAMVRGGRHLGDKAYFPTHVEEGAAIVGVDVEADVPEGAE 324

Query: 300 ---------------LVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKR 344
                          ++E F+AQ Y               VLV + P             
Sbjct: 325 TQPEPARDPERMARDILEAFVAQHY--------LDQFVPPVLVVSHPIRXXXXXXXXXXX 376

Query: 345 RGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXX 404
               V V    +G +RA +E   K AE +LAR  S++ S    R++              
Sbjct: 377 XXRRVSVVRQPQGARRAWLEMAEKGAELSLARRLSEQGSQ-QARTRALAETIGVDLEDLA 435

Query: 405 PLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRF 464
            LR+ECFDIS   GE T AS VVF     +  EYRR++I+     D D AAM +V++RR+
Sbjct: 436 ALRVECFDISHTAGEATQASCVVFHSHAMQNGEYRRYNIQDIIPGD-DYAAMRQVLTRRY 494

Query: 465 TRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI 524
            + +E+                  A   AP     P +V++DGG+ QV  A++  ++LG+
Sbjct: 495 QKVVEQ------------------AAEDAPDM---PRVVLIDGGKGQVEVARQVFEELGL 533

Query: 525 EDVAVCGLAKR------LEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRK 578
           +   + G+AK       LE +        + L + S  L L+ ++RDEAHRFAI+  R K
Sbjct: 534 DIGLLVGVAKGEGRKVGLETLVFADGRPSLELGQGSAALMLVAQIRDEAHRFAITGMRAK 593

Query: 579 RAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           RAKA   S L++I G+G  RR  LL  FG +R +  A+  E+A V GI +  A+ IY +L
Sbjct: 594 RAKARNTSRLEEIEGIGAKRRQRLLARFGGLRGVMAASVEELATVEGISQTLAEEIYRQL 653


>UVRC_BACHD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 591

 Score =  308 bits (788), Expect = 1e-85
 Identities = 209/637 (32%), Positives = 318/637 (49%), Gaps = 58/637 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           ++ K   +P  PG Y  +D  G +IYVGKAK L+ R+ SYF    +   +TQ ++   AD
Sbjct: 5   IKQKLTVLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFT--GSHDAKTQRLVGEIAD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V ++ +EAL LE + IK++ P++NV  +DDKSYPYL +T NEE PR+   R  ++ 
Sbjct: 63  FEYIVTSSNIEALILEMNLIKKHDPKYNVMLKDDKSYPYLKLT-NEEHPRLVTTRKLKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
           G +YFGPY  A A  +T  LL R++P+R C            + CL  +I +C APCV  
Sbjct: 122 GGKYFGPYPNAGAANETKKLLDRLYPLRKCRT-------LPDKVCLYYHIGQCLAPCVYE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+   + ++   F+                             +RD +  +  VMEK
Sbjct: 175 VTPEQNEQMVQEITRFLKYGHKEVKVELEKKMHKAAEELNFERAKELRDTLGYMEAVMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++     L   F+ 
Sbjct: 235 QTMMVNDRVDRDVFGYAYDKGWMCVQVFFVRQGKLIERDVSIFPFYKEAEEDFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y   D  +     P EVL+   PA  DA +      +   V V +P+RG K+ L++  
Sbjct: 293 QFYLQKDHIK-----PGEVLL---PAGTDAALV----EQLLDVSVHIPKRGKKKELVDVA 340

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
           ++NA   L + K         R+               P RIE FD S +QG   V++MV
Sbjct: 341 MRNATMAL-KEKFALIERNEERTIKAVEQLGEAMGIPTPYRIEAFDNSNIQGTDPVSAMV 399

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
            F DG   K EYR++ I+   G D D  +M           L+E + +            
Sbjct: 400 AFIDGKPNKKEYRKYKIKTVTGPD-DYESMXXXXXXXXXXLLKEQRSL------------ 446

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RLEEVWL 541
                        P+L+V+DGG+ Q+AAAQ  L D+LG+  + VCGLAK    R  ++ L
Sbjct: 447 -------------PDLIVIDGGKGQIAAAQEILHDELGLS-IPVCGLAKDEKHRTSQLLL 492

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
                 + L R S   YLLQR++DE HRFA+++HR+ R+K    SVLDD+PG+G  R+  
Sbjct: 493 GDPPQVVPLKRDSHEFYLLQRIQDEVHRFALTFHRQTRSKTFFQSVLDDVPGIGEKRKRQ 552

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLKHFGSV+++ +A+  +   +  I +  A+T+Y +L
Sbjct: 553 LLKHFGSVKKMKEASIDDFLAL-SIPKSVAETLYNKL 588


>UVRC_ACTP2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  308 bits (788), Expect = 1e-85
 Identities = 209/637 (32%), Positives = 311/637 (48%), Gaps = 52/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D    +IYVGKAK+L+ RLSSYF+   A   +T+ +++           
Sbjct: 11  VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLA-SKKTEALVANXXXXXXXXXX 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
               AL LE+++IKE  P++NV  RDDKSYPY+ +T ++  PR+   RG+++    YFGP
Sbjct: 70  XXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLTKHQH-PRITSFRGSKKVAGEYFGP 128

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           Y  A A+R+T++LL ++FP+R C    +K   +  RPCL   I +C APCV G     EY
Sbjct: 129 YPNAGAVRETLNLLQKLFPIRQCEDSYYK---NRSRPCLQYQIGRCLAPCVEGYYSQAEY 185

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
                    F+ G+ G+ +                      RD IQ++R V EKQ V   
Sbjct: 186 DNQVNLVRLFLQGKDGQVVEHLVQKMENAAQELDFEAAARFRDQIQSVRAVQEKQFVSNE 245

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+I+IA     A V + +VR G++ G R +      +    +L + F+ Q Y   
Sbjct: 246 RLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYFPKVPNNTDLSELADTFVGQFYLQM 305

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQ-RGDKRALMETVLKNAE 371
           +   +   IP ++++    ++  A+   LS++ G  V +     RGDK   +     NAE
Sbjct: 306 NQHRT---IPNQIIIDQSLSEVTALANVLSEQAGHKVSIADKNIRGDKSRYLALAKTNAE 362

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L     Q      T  +                R+ECFDIS   G  TVAS VVF+  
Sbjct: 363 AALTLQLKQ-----DTHIRQRYDSLKALLNLAEIKRMECFDISHTMGNQTVASCVVFDKN 417

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G  G D D AAM + + + + R LEE +                   
Sbjct: 418 GPLKSDYRRFNIEGITGGD-DYAAMEQALLKLYDRNLEEEKI------------------ 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q+  A      L +        + G+AK       LE + +
Sbjct: 459 --------PDIIFIDGGKGQLNRALETFTSLNVSWDKRKPLLVGVAKGVERKAGLETLLI 510

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
              +  I LP  S  L+L+Q +RDE+H  AI+ HR+KR KA T S L+ I G+G  RR A
Sbjct: 511 SKWDKEIHLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQA 570

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ +  AT  EI  VPGI ++ A+ I++ L
Sbjct: 571 LLKYLGGMQGVKAATLEEIQSVPGISKQLAEVIFDTL 607


>UVRC_HYPNA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 614

 Score =  306 bits (785), Expect = 3e-85
 Identities = 227/636 (35%), Positives = 329/636 (51%), Gaps = 45/636 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P+ PGVYR   E G V+YVGKA++L+AR+S+Y +       R   MIS    +++ V  
Sbjct: 14  LPSRPGVYRMFGEAGEVLYVGKARDLKARVSNYTR-MGGHTQRIARMISLTRAMEFVVXX 72

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
                     S +K   PRFNV  RDDKS+PY+ +  N E P+++  RG+++    YFGP
Sbjct: 73  XXXXXXXXXXSLVKSLKPRFNVLLRDDKSFPYILIRRNHEAPQIKKYRGSKQDEGDYFGP 132

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T+D L + F +RTC   V+  AR+  RPC+L  I +C+APCVG +  E+Y 
Sbjct: 133 FANAGAVMRTLDTLQKAFLLRTCEDSVYS-ART--RPCMLHQIKRCAAPCVGLVSKEDYT 189

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
           ALA++   F+ G+ G   +                              V   Q V    
Sbjct: 190 ALADEAADFLRGKAGELQKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXHVRSTQDVNPDG 249

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV AIA D   + VQVF++R G+  G         +D +  +++  FL Q Y    
Sbjct: 250 IEEADVFAIAMDGGVSCVQVFFIRAGQNWGASAHFPRHEKDQTAPEILAAFLVQFYDKRP 309

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
                   P+ +LVS  P   D +   L+ + G  +++R P+RG KR L+    +NA + 
Sbjct: 310 P-------PKLILVSEPPDQADLIEEALALKAGRRIELRRPERGTKRDLLTQAERNASEA 362

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L+R  ++ AS    + +              P RIE +D S +QG + V  M+V      
Sbjct: 363 LSRKLAESAS----QERLLTEVQKVFDLAEAPQRIEVYDNSHIQGTNAVGGMIVAGPEGF 418

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           RK  YR+F+I+  E     D   M EV+ RRF R ++E                    + 
Sbjct: 419 RKQAYRKFNIKDTEITPGDDYGMMREVMRRRFARAMKE--------------------KV 458

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGI--EDVAVCGLAKRL------EEVWLPGE 544
           A   +  P+LV++DGG  Q               +DV +  +AK +      E+ + PG+
Sbjct: 459 AGNVSDWPDLVLIDGGLGQXXXXXXXXXXXXXXPDDVTLVSIAKGVDRNAGREQFFRPGK 518

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
             P  LP  +  LY LQR+RDEAHR+AI  HR+KRA     S LD+I G+GP R+ ALL 
Sbjct: 519 A-PFKLPENAPVLYYLQRLRDEAHRWAIGAHRQKRAAEAARSPLDEIEGIGPTRKKALLH 577

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           HFGS R +++A  A++ EV G+ E  A  IY    S
Sbjct: 578 HFGSARGVSRAKVADLMEVDGVNEALAIRIYGHFNS 613


>UVRC_DESHY RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 607

 Score =  306 bits (785), Expect = 3e-85
 Identities = 208/637 (32%), Positives = 328/637 (51%), Gaps = 60/637 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           LR K   +P  PGVY  +D  G++IYVGKAK L+ R+ SYF    + + +TQ MIS  AD
Sbjct: 20  LREKLSLLPDKPGVYLMKDASGQIIYVGKAKVLKNRVRSYFT--GSHNGKTQLMISLIAD 77

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            +  + ++EVEAL LE + IK+++P++N+  RDDK+YP++ +T +E  PR+ V R  ++ 
Sbjct: 78  FETIITDSEVEALLLECNLIKKHNPKYNILLRDDKTYPFITIT-DEAHPRILVTRQVKKG 136

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +Y+GPY  A A ++   LL R+FP R C        +   +PCL  ++ +C  PC   
Sbjct: 137 AGKYYGPYPNATAAKEAARLLNRLFPFRKCR-------QIPNKPCLYYHLGQCLGPCQVD 189

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E Y  + ++  AF+ G+ G  L+                     RD ++ L+ V EK
Sbjct: 190 VPKEAYDKIRKEAAAFLKGDQGAILKALEKKMKEASENLEFERAKEYRDLMEDLKKVGEK 249

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q + L D  D DV+  A  Q +  +Q+FY+R G++     ++    E+     +   FLA
Sbjct: 250 QNITLNDFVDRDVVGYAYTQDQLCIQIFYLRQGKLLSRDNFIFPYYEEPEEAFV--SFLA 307

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y        ++A+P+E+L+   P D    ++ L+K       + VPQ+G KR L++  
Sbjct: 308 QFY------TESSALPQEILLP--PLD----ISVLTK----LFPMVVPQKGQKRDLVQMA 351

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
           ++NA+ TL    S    +LT  ++                 IE FDIS + G H+VA M+
Sbjct: 352 MENAQTTLHEQISIEIRNLTECTQALAEIGNALGIPSLRT-IESFDISNIAGTHSVAGMI 410

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
            F DG   +S+YR+F I+     D D A+M++VI RR+ R  +E+  +            
Sbjct: 411 QFLDGKPNRSQYRKFKIQPMPNMD-DTASMHQVIERRYARLQQENLPL------------ 457

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAK--RLEEVWLPGE 544
                        P+L++VDGG+ Q+              + V G+ K  + +   L   
Sbjct: 458 -------------PDLILVDGGKGQIXXXXXXXXXXXXX-IPVAGMVKNDKHQTSALIDA 503

Query: 545 EDPI-ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
            D I  L R S G  LL+R+++E HRFAI++HR++RAK++T S LD I G+GP RR  LL
Sbjct: 504 MDRIHSLDRRSAGFRLLERIQNEVHRFAITFHRQQRAKSMTLSELDGIAGVGPKRRQQLL 563

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           K F S+  + QAT  E+ +  G+    A  +Y+   S
Sbjct: 564 KFFKSIDSIRQATLEELQQ-SGLPAPAAAAVYQHFNS 599


>UVRC_CHRSD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 604

 Score =  306 bits (785), Expect = 3e-85
 Identities = 205/633 (32%), Positives = 305/633 (48%), Gaps = 48/633 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  D  G V+YVGKAK L+ARL+SYF+   AL+ +TQ ++S   D+     
Sbjct: 11  TVSESPGVYRMLDAEGNVLYVGKAKRLKARLASYFR--GALNAKTQALVSRIEDIQVXXX 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV-RYF 131
                        IKE  P +N+  RDDKSYP++ V+    +P ++  R  ++RG  RY 
Sbjct: 69  XXXXXXXXXXXXXIKEQRPPYNILLRDDKSYPFIFVSDRHPYPALEFKRARQKRGDGRYL 128

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GP+    A+R+++ L+ ++F +R C   VF       RPCL   I +CSAPCV  IG EE
Sbjct: 129 GPFPSTTAVRESLSLMQKIFRIRNCEDSVFAHRT---RPCLQYQIQRCSAPCVDYIGREE 185

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +     + G + +                                       V  
Sbjct: 186 YQRDIDHAIMCLEGRSEQVTAQLTRDMETASQALDFEEAAXXXXXXXXXXXXXXXXIVDT 245

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
           GD  D D+ A+AE      +    VRGGR+ G R  +     D++   L+ +F++  Y G
Sbjct: 246 GDG-DADIFALAERPGGLCISALAVRGGRMLGARHHMPQNGLDLTAEALLGEFISHYYLG 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
            + E     IP EV+ +   AD D + A LS+R G  + +    RG +   +     NAE
Sbjct: 305 HERE-----IPAEVITALPLADSDVIQAALSERAGKRIRLAHQVRGHRAQWLRLAETNAE 359

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
           Q L    + R+      +K              P R+ECFDIS   GE TVAS VVF+  
Sbjct: 360 QHLTTQLANRSQ----LAKRFASLRDAMQLQETPTRLECFDISHSHGEATVASCVVFDQD 415

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G    D D AAM + ++RR+ R  ++  ++                 
Sbjct: 416 GPVKSDYRRFNIEGVAAGD-DYAAMRQALTRRYKRLTQDDSKL----------------- 457

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEE 545
                   P +++VDGG+ Q+  A+  L+D+GI    + G+AK       LE ++L   +
Sbjct: 458 --------PGILIVDGGKGQLNMAREVLEDVGITGTHLLGVAKGTTRKPGLETLFLETVD 509

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           + + L   S GL+L+Q +RDEAHRFAI+ HR++R K    S L DIPG+GP         
Sbjct: 510 NSLALDSASPGLHLIQHIRDEAHRFAITGHRQQRDKQRRTSTLQDIPGIGPKXXXXXXXX 569

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
               + + QA+  E+A VPGI  + A TI++ L
Sbjct: 570 XXXXQGVRQASRDELARVPGISAQMATTIHQAL 602


>UVRC_THEEB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 626

 Score =  306 bits (784), Expect = 3e-85
 Identities = 219/636 (34%), Positives = 325/636 (51%), Gaps = 50/636 (7%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVY  +D+  +++Y+GK+K LR+R+ SYF++ + L PR + M+   A++++ V +
Sbjct: 19  LPLAPGVYFLKDKTDQILYIGKSKRLRSRVRSYFREPAQLGPRLERMVYQVAEIEFIVTD 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMR------GARRRG 127
           T           IK++ P FNV  +DDK YPY+ +T +E +PR+ + R      G   R 
Sbjct: 79  TXXXXXXXXXXXIKQHQPHFNVLLKDDKKYPYVCITWSEPYPRIFITRKRQFGNGGDPRS 138

Query: 128 ----VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPC 183
                RY+GPY  ++ +R T+ L+                       CL   I +C   C
Sbjct: 139 DSAKDRYYGPYVDSFRLRQTLALV-----KXXXXXXXXXXXXXXXXXCLNYDIGRCPGVC 193

Query: 184 VGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTV 243
            G I  +EYR   +       G TG  +                     +RD I+ L  +
Sbjct: 194 QGLISPQEYRQTLQRVAMIFQGRTGELVXXXXXXXXXXXXDLNFELAARLRDQIRGLEHL 253

Query: 244 MEKQAVVLGDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
              Q V L D T   D IA+A     AA+Q+F +R GR+ G   +V D  +  S G +++
Sbjct: 254 GVDQKVSLPDDTVSRDAIALAVGDRHAAIQLFQIRAGRLVGRLAFVAD-AQSGSAGTILQ 312

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRAL 362
           + L + Y   +D E    IP E+L+     + D +  +LS+++G AV + VPQR  K  L
Sbjct: 313 RVLEEHYAQVEDVE----IPSEILLQHPLPEPDFLRTYLSEKKGRAVTLTVPQRQAKAEL 368

Query: 363 METVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
           +  V +NAE  LAR   Q+ASD T  +               P RIE +DIS +QG   V
Sbjct: 369 IAMVQRNAELELAR--LQQASDRTQTA--LEDLAQLLGLDTLPHRIEGYDISHIQGSDAV 424

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDT 479
           AS VVF DGL  +  YR ++IR  E   G   D A++ E++ RRF  YLE          
Sbjct: 425 ASRVVFIDGLPAQQHYRHYNIRNPEVKLGHSDDFASLAEILRRRFAPYLE---------- 474

Query: 480 LGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEV 539
            G+   P             P+++++DGG+ Q+ +A                 AK+ E++
Sbjct: 475 -GQGETPDDW----------PDIILIDGGKGQL-SAXXXXXXXXXXXXXXXXXAKQREDI 522

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
           +LP +  P+       G+ LL+RVRDEAHRFA+++HR+KRA+    S LD IPGLG  R+
Sbjct: 523 FLPHQRQPLPADPEQPGVQLLRRVRDEAHRFALNFHRQKRAQRQRRSHLDQIPGLGYQRQ 582

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
             LL  F S+  +  AT  ++A+V G+G R A  IY
Sbjct: 583 KELLATFRSIDYIRMATPEQLAQVNGVGPRLAARIY 618


>UVRC_RHIL3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 680

 Score =  306 bits (784), Expect = 3e-85
 Identities = 200/630 (31%), Positives = 319/630 (50%), Gaps = 30/630 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAADVDWTVV 72
           +P  PGVYR  +  G V+YVGKA++L+ R+++Y      +H  R   M+   A++++   
Sbjct: 64  LPNSPGVYRMFNAEGDVLYVGKARSLKKRVNNYA--VGRVHSNRIAQMVRQTANMEFVXX 121

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                        IK   PRFNV  RDDKS+PY+ +T +   P +   RGAR R   YFG
Sbjct: 122 XXXXXXXXXXXXXIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFG 181

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CS PC   +    Y
Sbjct: 182 PFASAGAVGRTINSLQRAFLIRTCTDSVFE---TRTRPCLLYQIKRCSGPCTHEVSDGGY 238

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L ++   F++G++ +                        RD + AL  V   Q +   
Sbjct: 239 GELVQEAKDFLSGKSQKVKSHMAEAMNQAAEDLDFERAAIYRDRLAALSHVQSHQGINPA 298

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV AI  +   + +QVF+ R G+  G R +       +S+ +++  FLAQ Y   
Sbjct: 299 GVEEADVFAIHHEGGISCIQVFFFRTGQNWGNRAYFPKADPQLSSAEVLNSFLAQFY--- 355

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           DD+     +P+++++S                 G  V + VPQRG+KR L++ V+ NA +
Sbjct: 356 DDKP----VPKQIMLSQTVXXXXXXXXXXXXXXGHKVSMLVPQRGEKRDLVDHVVGNARE 411

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
              R  ++ AS    +S+              P RIE +D S + G + V  MVV     
Sbjct: 412 AHGRKLAETAS----QSRLLEGFKETFGLAYAPQRIEIYDNSHIMGTNAVGGMVVAGPEG 467

Query: 433 ARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             K++YR+F+I+  +     D   M EV++RRF+R ++E    G  D   +   P  A+ 
Sbjct: 468 FVKNQYRKFNIKSTDITPGDDFGMMKEVMTRRFSRLIKEE---GIPDRTAQVATPDAADM 524

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLE-----EVWLPGEE 545
             P +   P+++++DGG+ Q+ A +  L +LGI D V   G+AK ++     E + P   
Sbjct: 525 PFPTW---PDVILIDGGQGQMTAVRAILAELGITDSVTAIGIAKGVDRDAGRERFFPPGR 581

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           +   LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL+H
Sbjct: 582 ESFTLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMIKNPLDEIGGIGPSRKRALLQH 641

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           FG+ + +++A  +++  V GI E  A+ +Y
Sbjct: 642 FGTAKAVSRAALSDLMAVEGISEAVARQVY 671


>UVRC_ANADF RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 716

 Score =  306 bits (783), Expect = 4e-85
 Identities = 240/696 (34%), Positives = 338/696 (48%), Gaps = 109/696 (15%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMI--STA 64
           LR     +P +PG Y  +D  G V+YVGKA +LR+R+ SYF D S    R    +     
Sbjct: 5   LRKTLDELPAEPGCYLMKDRRGAVVYVGKASSLRSRVRSYF-DASRGDDRAFVALLDELL 63

Query: 65  ADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGAR 124
            DV+  V  +E EA+ LE   IK + PRFN+R RDDK +  L +     F          
Sbjct: 64  GDVEVIVTRSEKEAVLLENELIKRHRPRFNIRLRDDKDFIVLRLDERHAFXXXXXXXXXX 123

Query: 125 RRGVR--YFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
                  YFGPYS A +IR+T+ ++ R F +RTC+  VF+  +   RPC+L  I +C AP
Sbjct: 124 XXXXXXXYFGPYSSASSIRETLRVVNRHFQLRTCTDHVFEHRK---RPCILYQIKRCPAP 180

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           CV  +   EYR   ED   F+ G     +                     +RD +QA+  
Sbjct: 181 CVYDVPEAEYRQSVEDAIEFLEGRETELVERLHGRMDEAADALRFEDAARLRDQLQAVER 240

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
            +EKQ V++ D  D DV+ +  +  +  VQV  +R G+++  R +   + ++    + + 
Sbjct: 241 SLEKQRVLMADRADRDVVGLYREGPDLVVQVLAMRAGKLQDSRSYPFHE-QEFPDEETLS 299

Query: 303 QFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRAL 362
            FL+  Y          A P E+LV  EPA+ DA+   LS+RRG  V +  PQRG K  L
Sbjct: 300 SFLSLYY-------EQNAAPEEILVPVEPAEVDALADVLSERRGRRVRLLTPQRGAKADL 352

Query: 363 METVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTV 422
           +E   +NAEQ     +S    D   R +              P  +EC+DIST QG   V
Sbjct: 353 LEVAARNAEQGF---RSWHEKD-ERREQXXXXXXXXXXXXXPPRWMECYDISTFQGALAV 408

Query: 423 ASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGE 482
            S V F DG   K+ YRR+ ++G  G D D A +YEV+SRR  R             LGE
Sbjct: 409 GSGVSFRDGEPDKACYRRYKVKGVAGQD-DFAMLYEVVSRRLRR------------ALGE 455

Query: 483 SGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-----------VAVCG 531
                            P+L+V+DGG+ Q+ AA  A  DLG+             V + G
Sbjct: 456 GAF--------------PDLLVIDGGKGQLNAALAAAKDLGVPTKPSPGNEGAPFVELVG 501

Query: 532 LAK-RLEEVWLPGEEDPII--------------------------------LPRTSEGLY 558
           LAK RL +    G    I                                 L R+ E ++
Sbjct: 502 LAKSRLVDAPALGTTRVIXXXXXXXXXXXXXXXXXXXXXXXXXQEHGFVSELARSPERVF 561

Query: 559 L------------------LQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
           L                  L R+RDEAHRFAI++HR+ R +    SVL++I G+G  R+ 
Sbjct: 562 LPGRKDPVVLRQNSAELFLLARLRDEAHRFAITFHRKLRRERNFQSVLEEISGIGEGRKR 621

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           ALL+HFG++RR+ +AT  EI++V G G + A+ ++E
Sbjct: 622 ALLRHFGALRRVKEATLDEISQVDGFGPKQARAVFE 657


>UVRC_HAEDU RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 612

 Score =  305 bits (782), Expect = 6e-85
 Identities = 205/637 (32%), Positives = 316/637 (49%), Gaps = 52/637 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  D +  +IYVGKAK+L+ RL+SYF+   A   + + ++     +D T+ +
Sbjct: 13  VPHLPGVYRMYDANQAIIYVGKAKDLKKRLASYFRSQVA-SKKIEALVGNIHHIDTTITH 71

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +E EAL LE+++IK++ P++NV  RDDKSYPYL +T   + PR+   RG+++    YFGP
Sbjct: 72  SETEALLLEHNYIKQHQPKYNVLLRDDKSYPYLLLT-KHQHPRLTAFRGSKKVAGEYFGP 130

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEEY 192
           Y    A+R++++LL ++FP+R C    +K   +  RPCL   I +C APCV G    +EY
Sbjct: 131 YPNVSAVRESLNLLQKIFPIRQCEDNYYK---NRSRPCLQHQIGRCLAPCVTGYCSQQEY 187

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
               +    F+ G+  + +                      RD IQ++R V EKQ V   
Sbjct: 188 DNQVKWVRLFLQGKDSQVIDYLMQKMEIAASELDFETAARFRDQIQSVRAVQEKQFVANQ 247

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              D D+I+IA     A   + ++R G++ G R +           +L + F+ Q Y   
Sbjct: 248 RLDDLDIISIAYQSGLACAHILFIRQGKVLGNRAYFPKVPSHTDLTELADTFIGQFYLQL 307

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQ-RGDKRALMETVLKNAE 371
           +   S   IP ++++     + +A+   L+++ G  V +     RGDK   +     NA 
Sbjct: 308 NQHRS---IPNQIILDQPLTESNALAQLLTEQAGHKVTIITNHVRGDKSRYLALAQTNAR 364

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L+    Q     TT  K                R+ECFDIS   G  TVAS VVF++ 
Sbjct: 365 AALSLQLKQS----TTIHKRYDALKILLKLPTIK-RMECFDISHTMGSQTVASCVVFDEN 419

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G  G D D A M + + +R+ + L   +                   
Sbjct: 420 GPLKSDYRRFNIEGITGGD-DYAGMEQALVKRYDKPLPIEK------------------- 459

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI----EDVAVCGLAK------RLEEVWL 541
                   P+++ +DGG+ Q+  A +  + L +        + G+AK       LE + +
Sbjct: 460 -------IPDIIFIDGGKGQLNRALQVFEKLTVAWDKHKPLLIGVAKGAERKAGLETLII 512

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
              +  I LP  S  L+L+Q +RDE+H  AIS HR+KR KA   S L+ I G+G  RR A
Sbjct: 513 GRLKKEIHLPIDSPALHLIQHIRDESHHHAISGHRKKRQKAFVESGLESIAGVGAKRRQA 572

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ +  AT AEI  VPGI +  A  I++ L
Sbjct: 573 LLKYLGGMQGVKSATLAEIESVPGISKTLAGVIFDTL 609


>UVRC_LEPBP RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 614

 Score =  304 bits (779), Expect = 1e-84
 Identities = 190/650 (29%), Positives = 328/650 (50%), Gaps = 43/650 (6%)

Query: 3   VRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIS 62
           V  T++ K  ++ + PG Y +++E G+VIYVGKA  L++R+ SY    +    +T+ +  
Sbjct: 6   VLKTIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNP-NQKDRKTRALFV 64

Query: 63  TAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRG 122
              D+DW                   Y+P+FNVR +DDK YP+L V+ +E++P V + R 
Sbjct: 65  ELYDLDWIXXXXXXXXXXXXXXXXXXYNPKFNVRLKDDKKYPFLCVSTSEDYPMVFLTRK 124

Query: 123 ARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
            +  G RYFGP++   A RDT++L+ R+FP+R              RPCL  ++ +C  P
Sbjct: 125 VKDNGDRYFGPFTDVKAARDTLELIHRIFPIRKTXXXXXXXXXQ--RPCLNFHMGRCLGP 182

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           C G +  + Y  L ++   F+ G+  R +                     ++  I+ +  
Sbjct: 183 CQGNVTKDTYSELVDEILRFLEGKKERLVADLKKAMMDASSKMEYERAGFLKQRIEKINQ 242

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
           + EKQ VV  D  D D++ I++ + E  + +  VRGGR+ G++ + +  +      +   
Sbjct: 243 LREKQTVVSMDGGDEDILGISKREDEGQILILEVRGGRLEGKKSFPLTGLSFSDDEEAFT 302

Query: 303 QFLAQTYGGADDEESTTAIPREV-LVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
            FL   Y       + T +P  V L ++   + D  +  + ++ G ++ ++ P+ G K++
Sbjct: 303 SFLRDYY------LNVTVLPSVVYLPTSAKGNYDVFLEAILEKFGTSIKLKFPEMGPKKS 356

Query: 362 LMETVLKNAEQTLA-RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
           L+    KNA+ +L  R  + +  D T   K              P  IEC+DIS  QG  
Sbjct: 357 LLRLAEKNADLSLTERILATKLRDQTVAMKELQEKLNLPTL---PRTIECYDISHFQGSL 413

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            VAS V+F +G   K  YR + +RG EG + D   ++EVI+RR +  + E + +      
Sbjct: 414 PVASGVMFVEGKPYKPGYRHYKMRGYEGIN-DPGMIHEVIARRLSHLVNEEEPL------ 466

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540
                              P+L+V+DGG  Q++ A  A + L +  + + GLAK+ EE++
Sbjct: 467 -------------------PDLIVIDGGLTQLSRAAEAANALDLGHIPMVGLAKKREEIY 507

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
            PGE+ P    + S  + LL+ +RDEAHRF +++ R +R K    S+LDDIP +G  RR 
Sbjct: 508 FPGEKHPYSFDQHSPMMRLLRNLRDEAHRFGVTFQRLQRKKKALKSILDDIPDIGASRRK 567

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPE 650
           ++L +F + +++  AT  E+ +V GIG   A+ I+   T+++  ++ +P+
Sbjct: 568 SILMYFQAKKKVTDATRQELEKVQGIGPVLAEKIF---TNIQNLKKIEPK 614


>UVRC_LEPBA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 614

 Score =  304 bits (779), Expect = 1e-84
 Identities = 190/650 (29%), Positives = 328/650 (50%), Gaps = 43/650 (6%)

Query: 3   VRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMIS 62
           V  T++ K  ++ + PG Y +++E G+VIYVGKA  L++R+ SY    +    +T+ +  
Sbjct: 6   VLKTIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNP-NQKDRKTRALFV 64

Query: 63  TAADVDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRG 122
              D+DW                   Y+P+FNVR +DDK YP+L V+ +E++P V + R 
Sbjct: 65  ELYDLDWIXXXXXXXXXXXXXXXXXXYNPKFNVRLKDDKKYPFLCVSTSEDYPMVFLTRK 124

Query: 123 ARRRGVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAP 182
            +  G RYFGP++   A RDT++L+ R+FP+R              RPCL  ++ +C  P
Sbjct: 125 VKDNGDRYFGPFTDVKAARDTLELIHRIFPIRKTXXXXXXXXXQ--RPCLNFHMGRCLGP 182

Query: 183 CVGRIGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRT 242
           C G +  + Y  L ++   F+ G+  R +                     ++  I+ +  
Sbjct: 183 CQGNVTKDTYSELVDEILRFLEGKKERLVADLKKAMMDASSKMEYERAGFLKQRIEKINQ 242

Query: 243 VMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVE 302
           + EKQ VV  D  D D++ I++ + E  + +  VRGGR+ G++ + +  +      +   
Sbjct: 243 LREKQTVVSMDGGDEDILGISKREDEGQILILEVRGGRLEGKKSFPLTGLSFSDDEEAFT 302

Query: 303 QFLAQTYGGADDEESTTAIPREV-LVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRA 361
            FL   Y       + T +P  V L ++   + D  +  + ++ G ++ ++ P+ G K++
Sbjct: 303 SFLRDYY------LNVTVLPSVVYLPTSAKGNYDVFLEAILEKFGTSIKLKFPEMGPKKS 356

Query: 362 LMETVLKNAEQTLA-RHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH 420
           L+    KNA+ +L  R  + +  D T   K              P  IEC+DIS  QG  
Sbjct: 357 LLRLAEKNADLSLTERILATKLRDQTVAMKELQEKLNLPTL---PRTIECYDISHFQGSL 413

Query: 421 TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTL 480
            VAS V+F +G   K  YR + +RG EG + D   ++EVI+RR +  + E + +      
Sbjct: 414 PVASGVMFVEGKPYKPGYRHYKMRGYEGIN-DPGMIHEVIARRLSHLVNEEEPL------ 466

Query: 481 GESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVW 540
                              P+L+V+DGG  Q++ A  A + L +  + + GLAK+ EE++
Sbjct: 467 -------------------PDLIVIDGGLTQLSRAAEAANALDLGHIPMVGLAKKREEIY 507

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
            PGE+ P    + S  + LL+ +RDEAHRF +++ R +R K    S+LDDIP +G  RR 
Sbjct: 508 FPGEKHPYSFDQHSPMMRLLRNLRDEAHRFGVTFQRLQRKKKALKSILDDIPDIGASRRK 567

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTSVEGGQRTQPE 650
           ++L +F + +++  AT  E+ +V GIG   A+ I+   T+++  ++ +P+
Sbjct: 568 SILMYFQAKKKVTDATRQELEKVQGIGPVLAEKIF---TNIQNLKKIEPK 614


>UVRC_BRAJA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 686

 Score =  304 bits (778), Expect = 2e-84
 Identities = 198/630 (31%), Positives = 315/630 (50%), Gaps = 38/630 (6%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  + +  V+YVGKAKN++ RLS+Y +  +    R   MI+    V+      
Sbjct: 80  PTSPGVYRMLNANADVLYVGKAKNVKKRLSNYARQSAPQPARILRMIAATVTVEIVSXXX 139

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                      IK+  PRFNV+ RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 140 XXXXXXXXXXXIKQLRPRFNVQLRDDKSFPYILITGDHWAPQILKHRGAQTRPGRYFGPF 199

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           + A A+  T+  L R F +R+C+   F+   S  RPCLL  I +C+ PC   I    Y  
Sbjct: 200 ASAGAVNRTITALQRAFLIRSCTDSFFE---SRSRPCLLYQIRRCAGPCTREIDFPGYTT 256

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G++    +                     RD + AL  +  +Q +     
Sbjct: 257 LVREATDFLSGKSHAVKQELAGEMEKAANELEFETAALYRDRLAALSAIQSQQGINPRTV 316

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI ++   + V+VF+ R G+  G R +     +  +  +++  FLAQ Y   DD
Sbjct: 317 EEADVFAIHQEGGFSCVEVFFFRTGQNWGNRAYFPRAEKTFTPEEVLGSFLAQFY---DD 373

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +      P+                 LS + G  ++V  P+RG+K+ L+   L NA + L
Sbjct: 374 KPP----PKNXXXXXXXXXXXXXANALSIKAGHKIEVTAPKRGEKKELVAHALTNAREAL 429

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+ +              P RIE +D S +QG + V +M+V       
Sbjct: 430 GR----KLADTATQGRLLDAMATTLSLPHAPKRIEVYDNSHIQGTNAVGAMIVAGPDGFV 485

Query: 435 KSEYRRFSIRGAEGAD--SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           K++YR+F+I+ +EG     D   M EV+ RRF R +   +              +GA+ K
Sbjct: 486 KNQYRKFNIK-SEGLTPGDDYGMMREVLERRFKRLINPPE--------------EGAKVK 530

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEED 546
              F   P+LV++DGGR Q+ A +    +LG+  V++  +AK        E +++P E +
Sbjct: 531 DDDFPQWPDLVIIDGGRGQLNAVREIFANLGLTQVSLMSVAKGPDRDAGRETLFMP-ERE 589

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
            I L      LY +QR+RDEAHRF I  HR+ R K +  + L +IPG+GP R+ ALL HF
Sbjct: 590 AIKLEPRDPVLYFIQRLRDEAHRFVIGSHRKLRKKDIREAGLQEIPGIGPSRKRALLHHF 649

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G+++ + +A+ A++ +VPG+   +A+ I+E
Sbjct: 650 GTLKEIERASIADLGKVPGVSAESARRIFE 679


>UVRC_SYNS9 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 661

 Score =  303 bits (777), Expect = 2e-84
 Identities = 213/630 (33%), Positives = 312/630 (49%), Gaps = 26/630 (4%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           IP +PG Y  RD   R++YVGK+K LR+R+ SYF+    L PR + M     ++++ V +
Sbjct: 24  IPAEPGCYLMRDGDDRILYVGKSKTLRSRVRSYFRSRHDLSPRIRLMTRQVCEIEFIVTD 83

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGV--RYF 131
           +E EAL LE + IK + P FNV  +DDK YPYL +T +E +P               R++
Sbjct: 84  SEAEALALESNLIKNHQPHFNVLLKDDKKYPYLCITWSESYPXXXXXXXXXXXSPLDRFY 143

Query: 132 GPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEE 191
           GPY     +R T+ L+ RVFP+R        R     R CL   I +C   C  +I  ++
Sbjct: 144 GPYVDVGLLRRTLFLVKRVFPLRQRP-----RPLHQDRTCLNYSIGRCPGVCQEKISSDD 198

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y            G +                         +RD +Q L  +   Q + L
Sbjct: 199 YHQTLRKVAMVFQGRSDELQNLLQEQMHKYADRTDYESAARVRDQLQGLDQLTADQKMSL 258

Query: 252 GDST-DCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYG 310
            DS+   DV+A+A D+  AAVQ+F +R G++ G  G+  D    +S G ++++ + + Y 
Sbjct: 259 PDSSVSRDVLALACDERLAAVQLFQMRAGKLVGRLGYTADAA-GLSPGLILQRVIEEHYS 317

Query: 311 GADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNA 370
             D  E                  +    WL+++R   V +  PQR  K  L+E V +NA
Sbjct: 318 QVDAVEVXXXXXXXXXXXXXXXXEE----WLTEQRERKVQIHCPQRRQKADLIELVQRNA 373

Query: 371 EQTLARHKS-QRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFE 429
           E  L R K  Q    L+T                   RIE +DIS +QG   VAS VVF 
Sbjct: 374 EFELLRAKQGQEQQALSTEDLAQXXXXXXXXR-----RIEGYDISHIQGSDAVASQVVFI 428

Query: 430 DGLARKSEYRRFSIRGAE---GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           DGL  K  YR++ I+ +    G   D                       +L  L + G  
Sbjct: 429 DGLPAKQHYRKYKIQSSSIRAGHSDDFXXXXXXXXXXXXXXXXXXXDGLDLGALRQKG-- 486

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKRLEEVWLPGEE 545
            G+  +       P+LV++DGG+ Q++A   AL +L + +D+ VC LAK+ EEV+LPGE 
Sbjct: 487 -GSALQTDGLNDWPDLVMIDGGKGQLSAVMEALRELNLHDDLNVCSLAKQREEVFLPGES 545

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
            P+       G+ LL+R+RDEAHRFA+S+HR++R + +  S L DIPGLG  R   LL H
Sbjct: 546 QPLESEADQLGVALLRRLRDEAHRFAVSFHRQQRGERMKRSRLSDIPGLGAKRVRDLLSH 605

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           F S+  +  A+   +++ PG+G   AQ I+
Sbjct: 606 FHSIDAIQLASVDTLSKAPGVGPVLAQDIF 635


>UVRC_RALEJ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 663

 Score =  303 bits (777), Expect = 2e-84
 Identities = 213/666 (31%), Positives = 319/666 (47%), Gaps = 62/666 (9%)

Query: 8   RPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADV 67
           +P    +P  PGVYR+ D  G V+YVGKA+NL+ R+SSYF   + L PR   M++  A +
Sbjct: 24  KPVIARLPGLPGVYRYIDSAGNVLYVGKARNLKKRVSSYFNK-TQLSPRIAMMVAKIARI 82

Query: 68  DWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRG 127
           D TVV T                PR+N+ +RDDKSYP+L +T    FPR+   RGA  R 
Sbjct: 83  DTTVVRTXXXXXXXXXXXXXXXXPRYNILFRDDKSYPFLKLT-GHRFPRMAYYRGATDRK 141

Query: 128 VRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
            +YFGP+  A+A+R+++ +L +VF +RTC   VF    +  RPCLL  I +C+ PCVG I
Sbjct: 142 HQYFGPFPSAYAVRESMQILQKVFQLRTCEDTVF---NNRTRPCLLHQIHRCTGPCVGAI 198

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
              +Y     +  +F+ G     L                     +RD I AL TV+++Q
Sbjct: 199 SEADYARDVGNAASFLQGRETEVLEGLQSKMEEHAMQLEFEQAAAVRDQIAALSTVLKRQ 258

Query: 248 AV-VLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVS---------- 296
           AV  +G + D DV+A+A +   A V +  VRGGR  G++ +     ++ +          
Sbjct: 259 AVEEVGQARDIDVLAVAVEGGRACVNLAMVRGGRHLGDKAYFPAHADEAAMIXXXXXXXX 318

Query: 297 ------------------TGKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVV 338
                               +++  F+ Q Y          A P  ++VS  P D     
Sbjct: 319 XXXXXXXXXXXXLGVERIAARVLSAFMVQHY-------LDQAPPPIIVVSHVPDDXXXXX 371

Query: 339 AWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXX 398
                       VR PQ G ++A +E   +          S++ S    R++        
Sbjct: 372 XXXXXXGRKIALVRQPQ-GQRKAWLEMAQQGXXXXXXXXXSEQGSQ-EARTRALAETIGI 429

Query: 399 XXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYE 458
                  LR+ECFDIS   GE T AS VVF     +  EYRR++I+     D D AAM +
Sbjct: 430 DLEDLALLRVECFDISHTAGEATQASCVVFHHHDMQNGEYRRYNIQDITPGD-DYAAMRQ 488

Query: 459 VISRRFTRYLEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRA 518
           V++RR+ + +E  Q  G LD  GE+ +P             P++V++DGG+ QV  A++ 
Sbjct: 489 VLTRRYQKLVELMQEQGGLDPAGEASSPM------------PHVVLIDGGKGQVEVARQV 536

Query: 519 LDDLGIEDVAVCGLAK------RLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAI 572
            ++LG++   + G+AK       LE +        + L + S  L L+ ++RDEAHRFAI
Sbjct: 537 FEELGLDIGLLVGVAKGEGRKVGLETLVFADGRPSLELGQGSAALMLVAQIRDEAHRFAI 596

Query: 573 SYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQ 632
           +          T S L++I G+G  RR  LL  FG +R +  A+  E+A V GI    A+
Sbjct: 597 TGMXXXXXXXXTTSRLEEIEGVGARRRQKLLTRFGGLRGVMAASIDELASVDGISRGLAE 656

Query: 633 TIYERL 638
            IY +L
Sbjct: 657 EIYRQL 662


>UVRC_HERAR RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  303 bits (777), Expect = 2e-84
 Identities = 206/638 (32%), Positives = 317/638 (49%), Gaps = 53/638 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D    ++YVGKA++L+ R+SSYF    A  PRT  M+   A ++ T+  
Sbjct: 20  LPNLPGVYRYFDAENNLLYVGKARDLKKRVSSYFLKNLA-SPRTALMVEKIARLETTITR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK   PR+N+ +RDDKSYPYL +T  ++FPR+   RGA  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXIKTLQPRYNILFRDDKSYPYLKIT-GQKFPRMAYYRGAVDKKNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +   WA+++++ +L +VF +RTC   VF       RPCLL  I +CSAPCV  I  E+Y 
Sbjct: 138 FPSGWAVKESMQILQKVFLLRTCEDSVFANRT---RPCLLHQIHRCSAPCVNYISQEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              ++   F+ G     L                     +R+ I AL  V+ +Q++    
Sbjct: 195 LDVDNAAKFLRGRQTEVLEVLQAKMLAYAEELKFEQAALVRNQINALSRVLHQQSMXXXX 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG-------KLVEQFLA 306
                          A V +  VRGGR  G+R +    V++V T        ++++ FLA
Sbjct: 255 XXXXXXXXXXXXXXRACVNLAMVRGGRHLGDRAYFPTHVDNVLTNAEESVAAEVMKAFLA 314

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y           IP  ++++ E  + + ++A L ++ G  +++    +G +R  +E  
Sbjct: 315 QHY-------IDKFIPGTLILNTEIDEPELMLA-LMQQCGHRINLIFQPQGPRRQWLEMA 366

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            K AE +LAR  S++ S   TR++                R+ECFDIS  QGE T AS V
Sbjct: 367 QKGAEISLARLLSEQGSQ-QTRTRMLVDALKIDVEDIEAFRVECFDISHTQGEATQASCV 425

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VF     +  EYRR++I      D D AAM +V+ RR+                      
Sbjct: 426 VFHHHAMQNGEYRRYNINDITPGD-DYAAMRQVLMRRY---------------------- 462

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVW 540
              E+ A      P++V++DGG+ QV  A++   +LG++   + G+AK       LE + 
Sbjct: 463 ---EKVANGDGVMPDVVLIDGGKGQVEMARQVFVELGLDISLIVGVAKGEGRKVGLETLV 519

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
                 P  L + S  L L+ ++RDEAHRFAI+  R KRAKA   S L++I G+G  RR 
Sbjct: 520 FVDGRAPQELGKESGALMLIAQIRDEAHRFAITGMRAKRAKARQTSRLEEIEGIGAKRRQ 579

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            LL  FG +R +  A+  +++ V GI  + A+ IY++L
Sbjct: 580 KLLARFGGLRGVVDASVEDLSSVEGISRQLAEDIYKQL 617


>UVRC_RHIME RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 674

 Score =  302 bits (774), Expect = 5e-84
 Identities = 208/630 (33%), Positives = 312/630 (49%), Gaps = 32/630 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR  +E G V+YVGKA++L+ R+S+Y Q     + R   M+   A +++    
Sbjct: 62  LPNGPGVYRMLNEAGDVLYVGKARSLKKRVSNYAQGRGHSN-RIARMVRETAHMEFVTTR 120

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           T            K   PRFNV  RDDKS+PY+ VT +   P +   RGAR R   YFGP
Sbjct: 121 TXXXXXXXXXXXXKRLRPRFNVLLRDDKSFPYIVVTGDTRAPALYKHRGARSRKGDYFGP 180

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           ++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CSAPC   +   +Y 
Sbjct: 181 FASAGAVGRTINSLQRAFLLRTCTDSVFE---TRTRPCLLYQIKRCSAPCTNEVSDADYA 237

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L  +   F++G++                                   V   Q +    
Sbjct: 238 ELVSEAKDFLSGKSQAVKATIASAMAEASENLDFEXXXXXXXXXXXXSHVQSHQGINPAG 297

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             + DV A   +   + +QVF+ R G+  G R +       +   +++  FLAQ Y   D
Sbjct: 298 VEEADVFATHHEGGISCIQVFFFRTGQNWGNRAYFPKADPSIPPAEVLSAFLAQFY---D 354

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
           D+      PR+VL+ A            S++ G  V + VPQRG+K+ L+E  L NA + 
Sbjct: 355 DKPC----PRQVLLCAPVXXXXXXXXXXSEKSGYKVSILVPQRGEKKDLVEHALANAREA 410

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
             R  ++ AS    + +              P RIE +D S + G + V  MVV      
Sbjct: 411 HGRKLAETAS----QGRLLEGFAATFQLPYVPRRIEIYDNSHIMGTNAVGGMVVAGPEGF 466

Query: 434 RKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
            K +YR+F+I+  +     D   M EV++RRF+R L+E    G+ D   E G   G    
Sbjct: 467 VKGQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEE---GKPDRSAEPGEDAG---- 519

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRLE-----EVWLPGEED 546
              F   P+++++DGG+ Q+ A +  L +LGIED V   G+AK ++     E +     +
Sbjct: 520 ---FPAWPDVILIDGGQGQMTAVRTILKELGIEDCVTAIGVAKGVDRDAGRERFFAEGRE 576

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
              LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ ALL HF
Sbjct: 577 SFTLPPRDPVLYFIQRLRDEAHRFAIGSHRARRKKEMVKNPLDEIAGIGPTRKRALLTHF 636

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G+ + +++A   ++  V GI E  A+ +YE
Sbjct: 637 GTAKAVSRAGINDLMSVNGISETVARIVYE 666


>UVRC_AGRT5 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 681

 Score =  302 bits (773), Expect = 6e-84
 Identities = 200/631 (31%), Positives = 314/631 (49%), Gaps = 32/631 (5%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHP-RTQTMISTAADVDWTVV 72
           +P  PGVYR  +E G V+YVGKA++L+ R+ +Y Q    +H  R   M+     +++   
Sbjct: 65  LPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNYAQ--GRVHSNRIAQMVRFTTHMEFVXX 122

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                        IK   PRFNV  RDDKS+PY+ +T +   P +   RGAR R   YFG
Sbjct: 123 XXXXXXXXXXXXXIKRLRPRFNVLLRDDKSFPYILITADNRAPAIFKHRGARARKGDYFG 182

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++ A A+  T++ L R F +RTC+  VF+   +  RPCLL  I +CS PC   +  E Y
Sbjct: 183 PFASAGAVGRTINSLQRAFLIRTCTDSVFE---TRTRPCLLYQIKRCSGPCTHEVSDEGY 239

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L ++   F++G++                          RD + AL  V   Q +   
Sbjct: 240 AELVKEAKDFLSGKSQAVKTAIARQMNEASEDLDFERAAIYRDRLAALSHVQSHQGINPA 299

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV AI  +   + +QVF+ R G+  G R +       +   +++  FLAQ Y   
Sbjct: 300 GIEEADVFAIHHEGGISCIQVFFFRTGQNWGNRAYFPKADPSLPGSEILNAFLAQFY--- 356

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           DD+     +P+++L+S              ++ G  V + VPQRG+K+ + + VL NA +
Sbjct: 357 DDKP----VPKQILLSETVXXXXXXXXXXGEKAGHKVTISVPQRGEKKDITDHVLANARE 412

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
              R    + ++ +++++              P RIE +D S + G + V  MVV     
Sbjct: 413 AHGR----KLAETSSQARLLKGFAETFNLPYVPRRIEIYDNSHIMGTNAVGGMVVAGPEG 468

Query: 433 ARKSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             K++YR+F+I+  +     D   M EV++RRF+R L+E  +     T      P   E 
Sbjct: 469 FVKNQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRAQT------PTPEEA 522

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKRL------EEVWLPGE 544
               F   P+++++DGG+ Q+ A +  LD+LGI D V   G+AK +      E  +  G 
Sbjct: 523 ADLPFPAWPDVILIDGGQGQMTAVRAILDELGIRDCVTAIGVAKGVDREAGRERFFADGR 582

Query: 545 EDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLK 604
            D   LP     LY +QR+RDEAHRFAI  HR +R K +  + LD+I G+GP R+ +LL+
Sbjct: 583 SD-FSLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMVRNPLDEISGIGPGRKRSLLQ 641

Query: 605 HFGSVRRLAQATAAEIAEVPGIGERTAQTIY 635
           HFG+ + +++A   ++  V GI E  A+ IY
Sbjct: 642 HFGTAKAVSRAGLNDLMTVTGISETVARQIY 672


>UVRC_BACC2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  301 bits (771), Expect = 1e-83
 Identities = 198/640 (30%), Positives = 323/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 Y P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R C+           + CL  ++D+C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCT-------NMPDKVCLYYHMDQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTEEQNKEIVDEIIKFLNGGHKEVRSELEIKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    +  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFYLIERDEERTIKA---VDHLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E+  +          
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKENLPL---------- 446

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL-DDLGIEDVAVCGLAK----RLEEV 539
                          P+L+++DGG+  +AAA   L D+LG+  + + GL K    +   +
Sbjct: 447 ---------------PDLIIIDGGKGHLAAASDILEDELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQR++DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVVLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
             LLKHFGS++++ +A+ AE  E  G+ +  A+TIY  LT
Sbjct: 551 KVLLKHFGSLKKMKEASVAEFVEA-GMPKNVAETIYTYLT 589


>UVRC_RHOPA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 704

 Score =  300 bits (769), Expect = 2e-83
 Identities = 204/631 (32%), Positives = 315/631 (49%), Gaps = 33/631 (5%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  +    V+YVGKAKN++ RL+SY +    +  R   MI+            
Sbjct: 91  PTSPGVYRMLNAERDVLYVGKAKNVKKRLASYARPTGQVL-RIARMIALXXXXXXXXXXX 149

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                    + IK+  PRFNV+ RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 150 XXXXXXXXXNLIKQLRPRFNVQLRDDKSFPYILITSDHWAPQILKHRGAQSRPGRYFGPF 209

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           + A A+  T+  L R F VR+C+   F+   S  RPCLL  I +C+ PC G +    Y  
Sbjct: 210 ASAGAVNRTITALQRAFLVRSCTDSFFE---SRTRPCLLYQIRRCAGPCTGEVDFPGYSE 266

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G +                          RD + AL  +  +Q +     
Sbjct: 267 LVREATDFLSGRSRAVKELLAAEMEKASGELEFETAALYRDRLAALSAIQSQQGINPRTV 326

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI +D   + V+VF+ R G+  G R +     +  +  +++  F+AQ Y   DD
Sbjct: 327 EEADVFAIHQDGGYSCVEVFFFRTGQNWGNRAYFPRAEKSFTPAEVLGAFVAQFY---DD 383

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +      P+ +L+S E             + G  V++ VP+RG+K+ L+     NA + L
Sbjct: 384 KPP----PKLILLSHEIXXXXXXXXXXCVKAGHKVEITVPKRGEKKELVAHAQTNAREAL 439

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+++              P RIE +D S +QG + V +M+V       
Sbjct: 440 GR----KLADTATQARLLENLATTLGLPKTPQRIEVYDNSHIQGTNAVGAMIVAGPDGFI 495

Query: 435 KSEYRRFSIRGAEGAD--SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           K++YR+F+IR +EG     D A M EV+ RRF R +                        
Sbjct: 496 KNQYRKFNIR-SEGLTPGDDYAMMREVLQRRFKRLVTSQXXXXXXXXXXXXXXXXXV--- 551

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED-VAVCGLAKR------LEEVWLPGEE 545
            P++   P+LV++DGGR Q+ AA+ AL  +G+ D V + G+AK        E ++LP + 
Sbjct: 552 -PQW---PDLVIIDGGRGQLNAAREALSGIGLTDQVTLLGVAKGPDRDAGRETLFLP-DR 606

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           D I L      LY +QR+RDEAHRF I  HR  R K +  + L +IPG+GP R+ ALL H
Sbjct: 607 DAIKLEPRDPVLYFIQRLRDEAHRFVIGSHRTLRKKDIREAGLQEIPGIGPTRKRALLLH 666

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+++ + +A+ A++ +VPGI   +A+ I+E
Sbjct: 667 FGTLKEIERASIADLGKVPGISAESAKRIFE 697


>UVRC_JANMA RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 618

 Score =  300 bits (769), Expect = 2e-83
 Identities = 206/638 (32%), Positives = 313/638 (49%), Gaps = 53/638 (8%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D    ++YVGKA++L+ R+SSYF    A  PRT  M+   A ++ TV  
Sbjct: 20  LPNLPGVYRYFDAEDNLLYVGKARDLKKRVSSYFLKNLA-SPRTALMVERIARLETTVTR 78

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +           IK   PR+N+ +RDDKSYPYL +T  +E+PR+   RGA  +  +YFGP
Sbjct: 79  SXXXXXXXXXXXIKTLQPRYNILFRDDKSYPYLKIT-GQEYPRMAYYRGAVDKKNQYFGP 137

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           +   WA+++++ +L +VF +RTC   VF       RPCLL  I +CS PCV  I  E+Y 
Sbjct: 138 FPSGWAVKESMQILQKVFLLRTCEDSVFANRT---RPCLLHQIHRCSGPCVNFISKEDYA 194

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
              E+   F+ G     L                     +R+ I AL  V+ +Q++    
Sbjct: 195 LDVENAAKFLRGRQSEVLETLQGKMLAYAEELKFEQAALVRNQINALSRVLHQQSMETXX 254

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTG-------KLVEQFLA 306
                          A V +  VRGGR  G+R +    V++           ++++ FLA
Sbjct: 255 XXXXXXXXXXXXXXRACVNLAMVRGGRHLGDRAYFPTHVDNALASAEESIATEVMKAFLA 314

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y           IP  ++++ E  + + ++A L ++ G  ++V    +G +R  +E  
Sbjct: 315 QHY-------IEKFIPGTLILNTEMDEPELMLA-LMEQCGHRINVVFQPQGQRRQWLEMA 366

Query: 367 LKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMV 426
            K AE +LAR  S++ S    R++                R+ECFDIS  QGE T AS V
Sbjct: 367 HKGAEISLARLLSEQGSQ-QARTRMLVDALGIDVPDLESFRVECFDISHTQGEATQASCV 425

Query: 427 VFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAP 486
           VF     +  EYRR++I      D D AAM +V+ RR+                      
Sbjct: 426 VFHHHAMQNGEYRRYNINDITPGD-DYAAMRQVLLRRY---------------------- 462

Query: 487 QGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVW 540
              E+ A      P++V++DGG+ QV  A++   +LG++   + G+AK       LE + 
Sbjct: 463 ---EKVANGDGVMPDVVLIDGGKGQVEMARQVFVELGLDISLIVGVAKGEGRKVGLETLV 519

Query: 541 LPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRA 600
                 P  L + S  L L+ ++RDEAHRFAI+  R KRAKA   S L++I G+G  RR 
Sbjct: 520 FVDGRPPQELGKESGALMLIAQIRDEAHRFAITGMRAKRAKARQTSRLEEIEGIGAKRRQ 579

Query: 601 ALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
            LL  FG +R +  A+  ++A V GI  + A+ IY++L
Sbjct: 580 KLLARFGGLRGVVDASIEDLASVEGISRQLAEDIYKQL 617


>UVRC_HAES2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  300 bits (769), Expect = 2e-83
 Identities = 207/639 (32%), Positives = 312/639 (48%), Gaps = 51/639 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  DE G+VIYVGKAK+L+ RLSSYF+  +    +T  ++           
Sbjct: 10  NVTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRT-NLNSKKTSALVXXXXXXXXXXX 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                      ++IK + PR+NV  RDDKSYPY+ +T  E  PR+   RG+++    YFG
Sbjct: 69  XXXXXXXXXXXNYIKAFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVQGEYFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY +A A+R+T+ LL ++FP+R C   V+    +  RPCL   I +CS PC+ G +  EE
Sbjct: 128 PYPHAGAVRETLSLLQKLFPIRQCENSVYN---NRSRPCLQYQIGRCSGPCIDGLVSDEE 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F+ G+  + L                      RD IQA+R V+EKQ V  
Sbjct: 185 YQQQVDFARLFLQGKDQQVLEHLIKKMEQASMQLNFEQAAYFRDQIQAIRAVIEKQFVSN 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D D++AIA     A VQV ++R G++ G R +      +    +L E F+ Q Y  
Sbjct: 245 ERLDDMDILAIAYQLGIACVQVLFIRQGKVLGNRSYFPKVPANTDLSELTETFVGQFYLQ 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                    IP  ++V     ++  +   L+++ G  V+++   +G+K   +     NA+
Sbjct: 305 GHQGR---IIPSTIIVDHVLNEKHELEVLLTEQAGRKVNIQDNVKGNKSKFLHLAQMNAQ 361

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L     Q A+ +  R +                R+ECFDIS   GE T+AS VVF+  
Sbjct: 362 AALVTQLKQ-ANLIQERYQALQELLSLTTIK----RMECFDISHTMGEQTIASCVVFDTE 416

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G    D D AAM + + +R+ R LE  +                   
Sbjct: 417 GPLKSDYRRFNISGITAGD-DYAAMEQALLKRYDRPLENEKI------------------ 457

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q+  A +    L +        + G+AK       LE + +
Sbjct: 458 --------PDIIFIDGGKGQLNRALQVFAQLNVSWDKNKPLLIGVAKGVDRKAGLETLII 509

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             +   + L   S  L+L+Q +RDE+H  AI  HR+KR +A T S L+ I G+G  RR A
Sbjct: 510 SKQNKEVNLLPDSLALHLIQHIRDESHYHAIGGHRKKRQQAFTQSGLEAIKGVGAKRRQA 569

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           LLK+ G ++ +  AT AEI+ VPGI    A+ IYE L S
Sbjct: 570 LLKYLGGMQGVKNATLAEISSVPGISAALAERIYETLRS 608


>UVRC_HAES1 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 609

 Score =  300 bits (769), Expect = 2e-83
 Identities = 207/639 (32%), Positives = 312/639 (48%), Gaps = 51/639 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  DE G+VIYVGKAK+L+ RLSSYF+  +    +T  ++           
Sbjct: 10  NVTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRT-NLNSKKTSALVXXXXXXXXXXX 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                      ++IK + PR+NV  RDDKSYPY+ +T  E  PR+   RG+++    YFG
Sbjct: 69  XXXXXXXXXXXNYIKAFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVQGEYFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY +A A+R+T+ LL ++FP+R C   V+    +  RPCL   I +CS PC+ G +  EE
Sbjct: 128 PYPHAGAVRETLSLLQKLFPIRQCENSVYN---NRSRPCLQYQIGRCSGPCIDGLVSDEE 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+   +    F+ G+  + L                      RD IQA+R V+EKQ V  
Sbjct: 185 YQQQVDFARLFLQGKDQQVLEHLIKKMEQASMQLNFEQAAYFRDQIQAIRAVIEKQFVSN 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D D++AIA     A VQV ++R G++ G R +      +    +L E F+ Q Y  
Sbjct: 245 ERLDDMDILAIAYQLGIACVQVLFIRQGKVLGNRSYFPKVPANTDLSELTETFVGQFYLQ 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
                    IP  ++V     ++  +   L+++ G  V+++   +G+K   +     NA+
Sbjct: 305 GHQGR---IIPSTIIVDHVLNEKHELEVLLTEQAGRKVNIQDNVKGNKSKFLHLAQMNAQ 361

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L     Q A+ +  R +                R+ECFDIS   GE T+AS VVF+  
Sbjct: 362 AALVTQLKQ-ANLIQERYQALQELLSLTTIK----RMECFDISHTMGEQTIASCVVFDTE 416

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G    D D AAM + + +R+ R LE  +                   
Sbjct: 417 GPLKSDYRRFNISGITAGD-DYAAMEQALLKRYDRPLENEKI------------------ 457

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAKR------LEEVWL 541
                   P+++ +DGG+ Q+  A +    L +        + G+AK       LE + +
Sbjct: 458 --------PDIIFIDGGKGQLNRALQVFAQLNVSWDKNKPILIGVAKGVDRKAGLETLII 509

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             +   + L   S  L+L+Q +RDE+H  AI  HR+KR +A T S L+ I G+G  RR A
Sbjct: 510 SKQNKEVNLLPDSLALHLIQHIRDESHYHAIGGHRKKRQQAFTQSGLEAIEGVGAKRRQA 569

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLTS 640
           LLK+ G ++ +  AT AEI+ VPGI    A+ IYE L S
Sbjct: 570 LLKYLGGMQGVKNATLAEISSVPGISAALAERIYETLRS 608


>UVRC_GEOSM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 649

 Score =  300 bits (767), Expect = 3e-83
 Identities = 206/645 (31%), Positives = 300/645 (46%), Gaps = 68/645 (10%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           + P+ PGVY  +     VIYVGKA+NL+ R+ SY  D        + M+     VD+ V 
Sbjct: 9   NFPSSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDTRDSRIHIRFMVQLVHSVDYLVT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE + IK++ P++N+  RDDK+Y  L + + E+FPR+ ++R     G RYFG
Sbjct: 69  DTEKEALILENTLIKQHRPKYNINLRDDKTYFSLRMDMKEQFPRLSIVRKIPSDGARYFG 128

Query: 133 PYSYAWAIRDTVDLLLRVFPVR-----TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           PY+ A A ++ +  L ++FP+R     TC A          RPCL   I +CSAPC G I
Sbjct: 129 PYASATAAKEVLKQLYKMFPLRHYPLATCMA--------RKRPCLYHQIKQCSAPCCGLI 180

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
                            G+     R                     RD ++A+   +E+Q
Sbjct: 181 SXXXXXXXXXXXXXXXEGKNNEVARLYRSKMNLASEQMRYEDAARYRDLLRAIEVTVERQ 240

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            +V   S D DV  +  +     + + ++RGG + G R ++ D   ++ T + +  FL +
Sbjct: 241 KMV-AQSGDSDVFGVHREADRMQIALLHIRGGTLTGGRSFLFD--WELETEEGLASFLNE 297

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y      +                         S++ G  V + VPQRG K  +++   
Sbjct: 298 YY------DLDAXXXXXXXXXXXXXXXXXXXXXXSEKAGKKVTIAVPQRGPKLEMVKLAG 351

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           KNAE       ++ +S  T  ++              P RIEC+DIS +QGE  V S VV
Sbjct: 352 KNAETAAQERLARESSSATLLTE----LAEKLNLPHPPRRIECYDISNIQGEMAVGSRVV 407

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           F DG A KS YRR+ I+G   +D D A M EV+SRRF                       
Sbjct: 408 FIDGRADKSLYRRYRIKGVLQSD-DFAMMREVLSRRF----------------------- 443

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL----------- 536
               KA      P+                 LD+L +  V   GLAK             
Sbjct: 444 ----KADSHEEKPDXXXXXXXXXXXXXXNAVLDELEVTGVEAAGLAKSRVARDMESEEIE 499

Query: 537 ---EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
              E V+ PG ++ I L ++S  L LL R+RDEAHRFA++YH+  R+K LT S LD + G
Sbjct: 500 RSDERVFRPGRKNAIALRQSSAPLLLLVRIRDEAHRFAVTYHKDVRSKVLTGSELDGVAG 559

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +G  R+ ALLKHFGS++R+ +AT  E+   PG+ E  A+ + ERL
Sbjct: 560 IGEKRKKALLKHFGSLKRVKEATLEELKGAPGMTESAARALVERL 604


>UVRC_RHOPB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 699

 Score =  299 bits (766), Expect = 4e-83
 Identities = 200/630 (31%), Positives = 311/630 (49%), Gaps = 36/630 (5%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  +    V+YVGKAKN++ RL+SY +    +  R   MI+    V+      
Sbjct: 91  PTSPGVYRMLNAASDVLYVGKAKNVKKRLASYARPTGHV-VRISRMIAATVSVEIISXXX 149

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                    + IK+  PRFNV  RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 150 XXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITGDHWAPQIIKHRGAQSRPGRYFGPF 209

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           +   ++  T+  L R F +R+C+   F+   S  RPCLL  I +C+ PC G I    Y A
Sbjct: 210 ASVGSVNRTITALQRAFLMRSCTDAFFE---SRTRPCLLYQIKRCAGPCTGEIDFPGYTA 266

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G +    +                     RD + AL  +  +Q +     
Sbjct: 267 LVREATDFLSGRSRLVKQELAGEMEKASAELEFETAALYRDRLAALSAIQSQQGINPRTV 326

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI ++     V+VF+ R G+  G R +     +  +  +++  FLAQ Y   DD
Sbjct: 327 EEADVFAIHQEGGYFCVEVFFFRTGQNWGNRAYFPRAEKTFTVEEVLAAFLAQFY---DD 383

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +    A P+++L+S               + G  V++  PQRG+K+ L+   L NA + L
Sbjct: 384 K----APPKQILLSHRIXXXXXXXXXXXIKSGHKVEILTPQRGEKKELVGHALTNAREAL 439

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+++              P RIE +D S +QG + V +M+V       
Sbjct: 440 GR----KLADTATQTRLLQGLVTTLKLPHTPKRIEVYDNSHIQGTNAVGAMIVAGPDGFI 495

Query: 435 KSEYRRFSIRGAEGAD--SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           K++YR+F+IR +EG     D   M EV+ RRF R L             +   PQ     
Sbjct: 496 KNQYRKFNIR-SEGITPGDDYGMMREVLERRFKRLLXXXXXXXXXXXXXDDEVPQW---- 550

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEED 546
                  P+LV++DGGR Q+ A Q     LG+  V +  +AK        E +++P +  
Sbjct: 551 -------PDLVIIDGGRGQLNAVQEIFQALGLSTVTLMAVAKGPDRDAGRETLFMP-DRL 602

Query: 547 PIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHF 606
           PI L      LY +QR+RDEAHRF I  HR+ R K +  + L +IPG+GP R+ ALL HF
Sbjct: 603 PIKLEPRDPVLYFIQRLRDEAHRFVIGSHRKLRKKDIREAGLQEIPGIGPSRKRALLHHF 662

Query: 607 GSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           G+++ + +A+  ++ +VPGI   +A+ I++
Sbjct: 663 GTLKEIERASLGDLGKVPGISAESAKRIFD 692


>UVRC_RHOFD RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 671

 Score =  299 bits (766), Expect = 4e-83
 Identities = 236/666 (35%), Positives = 334/666 (50%), Gaps = 71/666 (10%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PGVYR+ D  G V+YVGKA NL+ R+SSYFQ       R   M+S    ++ TVV 
Sbjct: 35  LPPLPGVYRYFDFDGAVLYVGKAINLKKRVSSYFQKNHG-GTRIGHMVSKIVRLETTVVR 93

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVT-------LNEEFPRVQVMRGARRR 126
           +           IK  +P++N+ +RDDKSYPYL +T           FPRV   RGA  +
Sbjct: 94  SXXXXXXXXXXXIKTLNPKYNILFRDDKSYPYLKMTGASSSSNPGTSFPRVSYYRGAVEK 153

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  AWA+++ + L+ +VF +RTC   VF    +  RPCLL  I +CSAPCVG 
Sbjct: 154 KHQYFGPYPSAWAVKEAILLMQKVFHLRTCEDPVF---NNRTRPCLLYQIKRCSAPCVGH 210

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           I   +Y     +   F+ G+  + +                     +R+ + AL  V+ +
Sbjct: 211 ISAADYAQDVANAERFLRGDARQVMEALEARMMAHAEKLEFEQAAELRNQVAALSNVLHQ 270

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGER----------------GWVVD 290
           Q+V      D D++A+      A V +  VRGGR  G+R                G   +
Sbjct: 271 QSVDNVADRDVDILAVKVQGGRACVNLAMVRGGRHLGDRPYFPAHVEDATEIYNAGGFEE 330

Query: 291 KVEDVSTG--------KLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLS 342
            VED +T         +++E F+AQ Y           +P  ++VSA P ++  + A L+
Sbjct: 331 AVEDSTTAPPVPSVETQVLEAFVAQHY-------LNVPVPPTLIVSA-PVNKQLLEA-LA 381

Query: 343 KRRGAAVDVRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXX 402
            + G  V      R  +R  +E    NA   LAR  S+  S    R++            
Sbjct: 382 IQSGVKVTAVHQPREQRRVWLEMAQTNAGLQLARLLSEEGSQ-QARTRXXXXXXXXXXXX 440

Query: 403 XXPLRIECFDISTLQGEHTVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISR 462
               R+ECFDIS   GE T AS VVF     + +EYRR++I      D D AAM +V+ R
Sbjct: 441 XXXXRVECFDISHTAGEATQASCVVFAHHKMQNAEYRRYNINDITPGD-DYAAMRQVLLR 499

Query: 463 RFTRY---LEESQRVGELDTLGESGAPQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRAL 519
           R+ +    L E+Q+ G++        P G  R        P+LV+VDGGR QV+ A+   
Sbjct: 500 RYGKLAETLREAQQTGQM--------PAGTGRL-------PDLVLVDGGRGQVSMAREVF 544

Query: 520 DDLGIE------DVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAIS 573
           + LG++                          + + L + S  L L+ ++RDEAHRFAI+
Sbjct: 545 EQLGLDLSLIXXXXXXXXXXXXXXXXXFADGREKVYLGKDSAALMLVAQIRDEAHRFAIT 604

Query: 574 YHRRKRAKA-LTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQ 632
             R KRAK  +    L++IPG+GP RR+ LL+ FG VR +A A A +IA V GI    A+
Sbjct: 605 GMRAKRAKVRVDGGKLEEIPGIGPKRRSKLLQRFGGVRGVALAGAEDIATVAGISRELAE 664

Query: 633 TIYERL 638
            IY  L
Sbjct: 665 EIYRAL 670


>UVRC_VIBCM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  299 bits (765), Expect = 5e-83
 Identities = 201/635 (31%), Positives = 313/635 (49%), Gaps = 48/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RL+SYF+  +    +T+ ++S  A +D TV 
Sbjct: 13  TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ ++  PR+   RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKH-PRLSSHRGAKKRRGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY  + A+R+T+ L+ ++FPVR C   V+    +  RPCL+  I +C+ PCV G I  + 
Sbjct: 131 PYPDSGAVRETLHLIQKIFPVRQCEDTVYS---NRTRPCLMYQIGRCAGPCVKGLISDQG 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+ +      F+ G+  + L                      RD IQA+R V E+Q    
Sbjct: 188 YQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFXXX 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
                      A++   A + +  +R G++ G R        D S  ++ E FL+Q Y  
Sbjct: 248 XXXXXXXXXGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQVEVFESFLSQYYLS 307

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
             +  S  A  R +L      + +A+   +S+  G  V   V   G +            
Sbjct: 308 HSEARSIPA--RIILNRGLTEETEALQIAISELAGRKVTFHVNPTGTRGRYXXXXXXXXX 365

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                  + + + ++ R K                R+ECFDIS   GE T+AS VVF   
Sbjct: 366 XXXXXXMNHKMT-ISQRFKALQEELGMDAI----TRMECFDISHTMGESTMASCVVFNQE 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              K EYRR++I G  G D D AAM +V+ RR+++ L+ S+                   
Sbjct: 421 GPLKQEYRRYNITGITGGD-DYAAMAQVLERRYSKQLDSSK------------------- 460

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE---DVAVCGLAKRLE-----EVWLPG 543
                   P+++ +DGG+ Q+  A   +     +      + G+AK +      E  +  
Sbjct: 461 -------IPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITI 513

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           + D   LP  +  L+L+Q +RDE+H  AI+ HR +R K    S L+ I G+GP RR ALL
Sbjct: 514 DGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALL 573

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           K+ G ++ L +A+  EIA+VPGI    A+ IY+ L
Sbjct: 574 KYLGGMQELKRASVEEIAKVPGISHALAENIYQAL 608


>UVRC_VIBCH RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  299 bits (765), Expect = 5e-83
 Identities = 201/635 (31%), Positives = 313/635 (49%), Gaps = 48/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RL+SYF+  +    +T+ ++S  A +D TV 
Sbjct: 13  TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ ++  PR+   RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKH-PRLSSHRGAKKRRGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY  + A+R+T+ L+ ++FPVR C   V+    +  RPCL+  I +C+ PCV G I  + 
Sbjct: 131 PYPDSGAVRETLHLIQKIFPVRQCEDTVYS---NRTRPCLMYQIGRCAGPCVKGLISDQG 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+ +      F+ G+  + L                      RD IQA+R V E+Q    
Sbjct: 188 YQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFXXX 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
                      A++   A + +  +R G++ G R        D S  ++ E FL+Q Y  
Sbjct: 248 XXXXXXXXXGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQVEVFESFLSQYYLS 307

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
             +  S  A  R +L      + +A+   +S+  G  V   V   G +            
Sbjct: 308 HSEARSIPA--RIILNRGLTEETEALQIAISELAGRKVTFHVNPTGTRGRYXXXXXXXXX 365

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                  + + + ++ R K                R+ECFDIS   GE T+AS VVF   
Sbjct: 366 XXXXXXMNHKMT-ISQRFKALQEELGMDAI----TRMECFDISHTMGESTMASCVVFNQE 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              K EYRR++I G  G D D AAM +V+ RR+++ L+ S+                   
Sbjct: 421 GPLKQEYRRYNITGITGGD-DYAAMAQVLERRYSKQLDSSK------------------- 460

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE---DVAVCGLAKRLE-----EVWLPG 543
                   P+++ +DGG+ Q+  A   +     +      + G+AK +      E  +  
Sbjct: 461 -------IPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITI 513

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           + D   LP  +  L+L+Q +RDE+H  AI+ HR +R K    S L+ I G+GP RR ALL
Sbjct: 514 DGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALL 573

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           K+ G ++ L +A+  EIA+VPGI    A+ IY+ L
Sbjct: 574 KYLGGMQELKRASVEEIAKVPGISHALAENIYQAL 608


>UVRC_VIBC3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 610

 Score =  299 bits (765), Expect = 5e-83
 Identities = 201/635 (31%), Positives = 313/635 (49%), Gaps = 48/635 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++   PGVYR  +    VIYVGKAK+L+ RL+SYF+  +    +T+ ++S  A +D TV 
Sbjct: 13  TVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRK-NLDSEKTKALVSNIAKIDVTVT 71

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ ++  PR+   RGA++R   YFG
Sbjct: 72  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHKH-PRLSSHRGAKKRRGEYFG 130

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY  + A+R+T+ L+ ++FPVR C   V+    +  RPCL+  I +C+ PCV G I  + 
Sbjct: 131 PYPDSGAVRETLHLIQKIFPVRQCEDTVYS---NRTRPCLMYQIGRCAGPCVKGLISDQG 187

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y+ +      F+ G+  + L                      RD IQA+R V E+Q    
Sbjct: 188 YQEIVHYLRLFLQGKDNQVLSILVEKMEQASRELRFEDAAKARDQIQAIRRVQEQQFXXX 247

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
                      A++   A + +  +R G++ G R        D S  ++ E FL+Q Y  
Sbjct: 248 XXXXXXXXXGFAQENGIACIHILMIRQGKVLGSRSHFPKIPSDTSQVEVFESFLSQYYLS 307

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
             +  S  A  R +L      + +A+   +S+  G  V   V   G +            
Sbjct: 308 HSEARSIPA--RIILNRGLTEETEALQIAISELAGRKVTFHVNPTGTRGRYXXXXXXXXX 365

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                  + + + ++ R K                R+ECFDIS   GE T+AS VVF   
Sbjct: 366 XXXXXXMNHKMT-ISQRFKALQEELGMDAI----TRMECFDISHTMGESTMASCVVFNQE 420

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              K EYRR++I G  G D D AAM +V+ RR+++ L+ S+                   
Sbjct: 421 GPLKQEYRRYNITGITGGD-DYAAMAQVLERRYSKQLDSSK------------------- 460

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE---DVAVCGLAKRLE-----EVWLPG 543
                   P+++ +DGG+ Q+  A   +     +      + G+AK +      E  +  
Sbjct: 461 -------IPDIIFIDGGKGQLNRAYEIISSCWQDWPKYPKIIGIAKGVTRKPGLETLITI 513

Query: 544 EEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALL 603
           + D   LP  +  L+L+Q +RDE+H  AI+ HR +R K    S L+ I G+GP RR ALL
Sbjct: 514 DGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAQRGKTRRTSTLEGIEGVGPKRRQALL 573

Query: 604 KHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           K+ G ++ L +A+  EIA+VPGI    A+ IY+ L
Sbjct: 574 KYLGGMQELKRASVEEIAKVPGISHALAENIYQAL 608


>UVRC_NITHX RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 690

 Score =  298 bits (763), Expect = 9e-83
 Identities = 206/629 (32%), Positives = 319/629 (50%), Gaps = 33/629 (5%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  +    V+YVGKAKN+R RLSSY +    +  R   MI+            
Sbjct: 81  PTSPGVYRMMNAARDVLYVGKAKNVRKRLSSYARPTGQVM-RIARMIAAXXXXXXXXXXX 139

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                    + IK+  PRFNV+ RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 140 XXXXXXXXXNLIKQLRPRFNVQLRDDKSFPYILITGDHWAPQILKHRGAQSRPGRYFGPF 199

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           + A A+  T+  L R F VR+C+   F+      RPCLL  I +C+ PC G I    Y A
Sbjct: 200 ASAGAVGRTITALQRAFLVRSCTDSFFE---GRTRPCLLYQIKRCAGPCTGEIDFPGYTA 256

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G +                                   +  +Q +     
Sbjct: 257 LVREATDFLSGRSRAVKEELAREMEKASGDLAFEXXXXXXXXXXXXXXIQSQQGINPRTV 316

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI ++   + V+VF+ R G+  G R +     +  +  +++  FLAQ Y   DD
Sbjct: 317 EEADVFAIHQEGGYSCVEVFFFRTGQNWGNRAYFPRAEKSFTPEEVLGAFLAQFY---DD 373

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +      P+ +L+S    + + +   LS + G  V V +PQRG+K+ L+   L NA + L
Sbjct: 374 KPP----PKVILLSHRIEESELLADALSIKAGHKVGVLMPQRGEKKELVAHALTNAREAL 429

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+S+              P RIE +D S +QG + V +M+V       
Sbjct: 430 GR----KLADTATQSRLLQGLATVLGLPHAPRRIEVYDNSHIQGTNAVGAMIVAGPEGLL 485

Query: 435 KSEYRRFSIRGAE-GADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
           K++YR+F+IR        D A M EV+ RRF R L  +Q+  + D      A +  +   
Sbjct: 486 KNQYRKFNIRSENLTPGDDYAMMREVLERRFKRLL--TQKAADPDK-----ADEPEKDAV 538

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKR------LEEVWLPGEEDP 547
           P++   P+LV++DGG  Q+ A +   D LG+  V++  +AK        E ++LP     
Sbjct: 539 PQW---PDLVIIDGGLGQLNAVRGIFDALGLSQVSLMAVAKGPDRDAGRETLFLPDRPAI 595

Query: 548 IILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFG 607
            + PR    LY +QR+RDEAHRF I  HR+ R K +  + L ++PG+GP R+ ALL HFG
Sbjct: 596 KLEPRDPV-LYFIQRLRDEAHRFVIGSHRKLRRKDIREAGLQEVPGIGPARKRALLHHFG 654

Query: 608 SVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           +++ + +A+ A++ +VPGI   +A+ I++
Sbjct: 655 TLKEIERASVADLGKVPGISAESARKIFD 683


>UVRC_RHOPS RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 695

 Score =  298 bits (762), Expect = 1e-82
 Identities = 203/631 (32%), Positives = 318/631 (50%), Gaps = 38/631 (6%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  +    V+YVGKAKN++ RLSSY +    +  R   MI+    V+      
Sbjct: 87  PTSPGVYRMLNAADDVLYVGKAKNVKKRLSSYARPTGHV-VRIARMIAATVTVEIISXXX 145

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                    + IK+  PRFNV  RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 146 XXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITGDHWAPQILKHRGAQSRPGRYFGPF 205

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           +   A+  T+  L R F VR+C+   F+   S  RPCLL  I +C+ PC G +    Y  
Sbjct: 206 ASVGAVNRTITALQRAFLVRSCTDSFFE---SRTRPCLLYQIRRCAGPCTGEVDFPGYTE 262

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G +    +                     RD + AL  +  +Q +     
Sbjct: 263 LVREATDFLSGRSRAVKQELAVEMEKASNELEFETAALYRDRLAALSAIQSQQGINPRTV 322

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI ++   + V+VF+ R G+  G R +     +  +  +++  FLAQ Y   DD
Sbjct: 323 EEADVFAIHQEGGYSCVEVFFFRTGQNWGNRAYFPRAEKSFTPEEVLASFLAQFY---DD 379

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +      P+ +L+S +  + + +   L  + G  V+V  P+RG+K+ L+   L NA + L
Sbjct: 380 KPP----PKLILLSHDIEECELLANALCIKAGRKVEVAAPKRGEKKELVAHALTNAREAL 435

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+++              P RIE +D S +QG + V +M+V       
Sbjct: 436 GR----KLADTATQTRLMQGLATTLGLPRPPQRIEVYDNSHIQGTNAVGAMIVAGPDGFI 491

Query: 435 KSEYRRFSIRGAEGAD--SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           K++YR+F+IR +EG     D A M EV+ RRF R L                 P      
Sbjct: 492 KNQYRKFNIR-SEGLTPGDDYAMMREVLQRRFKR-LXXXXXXXXXXXXXXXXTPLW---- 545

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGI-EDVAVCGLAKR------LEEVWLPGEE 545
                  P+LV++DGGR Q+ AA+  L +LG+  +V + G+AK        E +++P E 
Sbjct: 546 -------PDLVIIDGGRGQLNAARGVLTELGLGAEVTLLGVAKGPDRDAGRETLFMP-ER 597

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           + I L      LY +QR+RDEAHRF I  HR+ R K +  + L +IPG+GP R+ ALL H
Sbjct: 598 EAIKLEPRDPVLYFIQRLRDEAHRFVIGSHRKLRKKDIREAGLQEIPGIGPTRKRALLHH 657

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+++ + +A+  ++ +VPGI   +A+ I++
Sbjct: 658 FGTLKEIERASIGDLGKVPGISAESARRIFD 688


>UVRC_GEOBB RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 623

 Score =  298 bits (762), Expect = 1e-82
 Identities = 206/645 (31%), Positives = 299/645 (46%), Gaps = 68/645 (10%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           + P  PGVY  +     VIYVGKA+NL+ R+ SY  D        + M+     VD+ V 
Sbjct: 9   NFPPSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDTRDSRIHIRFMVQLVHSVDYLVT 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE + IK++ P++N+  RDDK+Y  L + + E+FPR+ ++R     G RYFG
Sbjct: 69  DTEKEALILENTLIKQHRPKYNINLRDDKTYFSLRMDMKEQFPRLSIVRKIPSDGARYFG 128

Query: 133 PYSYAWAIRDTVDLLLRVFPVR-----TCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRI 187
           PY+ A A ++ +  L ++FP+R     TC A          RPCL   I +CSAPC G I
Sbjct: 129 PYASATAAKEVLKQLYKMFPLRHYPLATCMA--------RKRPCLYHQIKQCSAPCCGLI 180

Query: 188 GVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQ 247
                            G+     R                     RD ++A+   +E+Q
Sbjct: 181 SXXXXXXXXXXXXXXXEGKNTEVARLYRSKMNLAAEQMRYEDAARYRDLLRAIEVTVERQ 240

Query: 248 AVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQ 307
            +V   S D DV  +  +     + + ++RGG + G R ++ D   ++ T + +  FL +
Sbjct: 241 KMV-AQSDDSDVFGLHREADRMQIALLHIRGGTLTGGRSFLFD--WELETEEGLASFLNE 297

Query: 308 TYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVL 367
            Y      +                         S++ G  V + VPQRG K  +++   
Sbjct: 298 YY------DLDAXXXXXXXXXXXXXXXXXXXXXXSEKAGKKVTIAVPQRGPKLEMVKLAG 351

Query: 368 KNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVV 427
           KNAE       ++ +S  T  ++              P RIEC+DIS +QGE  V S VV
Sbjct: 352 KNAETAAQERLARESSSATLLTE----LAEKLNLPHPPRRIECYDISNIQGEMAVGSRVV 407

Query: 428 FEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQ 487
           F DG A KS YRR+ I+G   +D D A M EV+SRRF                       
Sbjct: 408 FIDGRADKSLYRRYRIKGVLQSD-DFAMMREVLSRRF----------------------- 443

Query: 488 GAERKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRL----------- 536
               KA      P+                 LD+L +  V   GLAK             
Sbjct: 444 ----KAESSEEKPDXXXXXXXXXXXXXXNAVLDELEVTGVEAAGLAKSRVARDMESEEIE 499

Query: 537 ---EEVWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPG 593
              E V+ PG ++ I L ++S  L LL R+RDEAHRFA++YH+  R+K LT S LD + G
Sbjct: 500 RSDERVFRPGRKNAIALRQSSAPLLLLVRIRDEAHRFAVTYHKDVRSKVLTGSELDGVAG 559

Query: 594 LGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           +G  R+ ALLKHFGS++R+ +AT  E+   PG+ E  A+ + ERL
Sbjct: 560 IGEKRKKALLKHFGSLKRVKEATLEELKGAPGMTESAAKALVERL 604


>UVRC_STRU0 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 591

 Score =  297 bits (761), Expect = 2e-82
 Identities = 200/633 (31%), Positives = 322/633 (50%), Gaps = 58/633 (9%)

Query: 14  IPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVN 73
           +P  PG Y  +D+HG +IYVGKAKNLR R+ SYF+   +   +T+ ++S   D ++ V  
Sbjct: 12  LPDSPGCYLHKDKHGTIIYVGKAKNLRNRVRSYFR--GSHDTKTEMLVSEIEDFEFIVTG 69

Query: 74  TEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGP 133
           +  EAL LE + I++  P++N++ +DDKSYP++ +T NE FPR+ + R  +++   YFGP
Sbjct: 70  SNTEALLLEINLIQKNMPKYNIKLKDDKSYPFIKIT-NEPFPRLLITRQIKKQDGLYFGP 128

Query: 134 YSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYR 193
           Y  ++   +   LL R+FP + C   + K        C   ++ +C+A  + +     + 
Sbjct: 129 YPDSYTANEVKKLLDRIFPFKKCKNPINK-------VCFYYHLGQCNAHSICQTDKAYWD 181

Query: 194 ALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGD 253
            L ED   F+ G+  + +                      RD I  + T+  KQ ++  D
Sbjct: 182 GLVEDVKLFLTGKDDKIVTGLKEKMLAASQAMEFERAAEYRDLISGIATLRTKQRIMSKD 241

Query: 254 STDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGAD 313
             D D+     D+    VQVF+VR G++      +     +       E FL  TY G  
Sbjct: 242 LQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNMFPYYNEAE-----EDFL--TYIGQF 294

Query: 314 DEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQT 373
             +    +P+EV +  +  D+D V A +  +      +  PQRG+K+ L+    KNA  +
Sbjct: 295 YLDQKHFLPKEVFIP-DTIDQDLVQAVVPTK------IVKPQRGEKKQLVALATKNARVS 347

Query: 374 LARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLA 433
           L +       DL  ++K              P RIE FD S +QG   VA+MVVF+DG  
Sbjct: 348 LQQKFDLLEKDLR-KTKGAIDHLGQLLQIDRPYRIEAFDNSNIQGTSPVAAMVVFKDGKP 406

Query: 434 RKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERKA 493
            K +YR+F I+   G D D A+M EVI RR++R L++   +                   
Sbjct: 407 SKKDYRKFKIKTVTGPD-DYASMREVIFRRYSRVLKDKLEM------------------- 446

Query: 494 PRFAYPPNLVVVDGGRPQVAAAQRALDD-LGIEDVAVCGLAK----RLEEVWLPGEEDPI 548
                 P+L+++DGG+ QV  A+  +++ LG++ + + GL K    +  E+      + +
Sbjct: 447 ------PDLIIIDGGQGQVNVAKDVIENQLGLQ-IPIAGLQKNDRHQTHELLFGDPLEVV 499

Query: 549 ILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGS 608
            LPR SE  +LL R++DE HRFAI++HR+ R+K   +S LD I GLGP R+ ALLKHF +
Sbjct: 500 ELPRNSEEFFLLHRIQDEVHRFAITFHRQVRSKNSFSSKLDGIEGLGPKRKQALLKHFKN 559

Query: 609 VRRLAQATAAEIAEVPGIGERTAQTIYERLTSV 641
           +  ++QA+  E+  + GI E+ AQ + +    V
Sbjct: 560 MTAISQASVDEVRSL-GIPEKVAQALLDSFNEV 591


>UVRC_MANSM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  296 bits (759), Expect = 3e-82
 Identities = 210/637 (32%), Positives = 313/637 (49%), Gaps = 51/637 (8%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++  DPGVYR  D+   VIYVGKAK+L+ RLSSYF+  +    +T+ ++++   +     
Sbjct: 10  NVTHDPGVYRMFDDKDTVIYVGKAKDLKKRLSSYFRA-NLSSKKTEALVASICRIXXXXX 68

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                     +++IK + PR+NV  RDDKSYPY+ +T  E  PR+   RG+++    YFG
Sbjct: 69  XXXXXXXXXXHNYIKTFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVTGEYFG 127

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY +A A+R+T+ LL ++FP+R C   V+    +  RPCL   I +C APCV G +  EE
Sbjct: 128 PYPHAGAVRETLSLLQKLFPIRQCENSVYA---NRSRPCLQYQIGRCLAPCVSGYVSDEE 184

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y         F+ G+  + L                      RD IQA+R+V+EKQ V  
Sbjct: 185 YNQQVGYARLFLQGKDQQVLDHLIGKMERASRALNFEEAARYRDQIQAVRSVIEKQFVSN 244

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
               D D+IAIA     A V V ++R G+I G R +     E+ S  +L E F+ Q Y  
Sbjct: 245 ERLDDMDIIAIAYKLGIACVHVLFIRQGKILGNRSYFPKVPENTSLSELTETFVGQFYLQ 304

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
           A    +   IP  ++V              + + G  V ++   +G+K +          
Sbjct: 305 AHQGRT---IPNSIIVDRXXXXXXXXXXXXTDQAGRKVSIQDNIKGNK-SKYXXXXXXXX 360

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
                     +S +  R K                R+ECFDIS   G+ T+AS VVF + 
Sbjct: 361 XXXXXXXXXXSSLIHERYKELQQLLGIEKIH----RMECFDISHTMGQQTIASCVVFNEE 416

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KS+YRRF+I G  G D D AAM + + +R+ + L       EL+ +           
Sbjct: 417 GPLKSDYRRFNIEGITGGD-DYAAMEQALKKRYDKDL-------ELEKI----------- 457

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE----DVAVCGLAK------RLEEVWL 541
                   P+++ +DGG+ Q+  A +   +L ++       + G+AK       LE + +
Sbjct: 458 --------PDIIFIDGGKGQLNRALKVFHELQVKWDKNRPHLIGVAKGVDRKVGLETLII 509

Query: 542 PGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAA 601
             +E  I LP  S  L+L+Q +RDE+H  AIS HR+KR KA T S L+ I G+G  RR A
Sbjct: 510 SKQEREINLPADSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQA 569

Query: 602 LLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           LLK+ G ++ +  AT  EIA VPGI    A+ I+E L
Sbjct: 570 LLKYLGGMQGVKNATQDEIASVPGISVALAEKIFEAL 606


>UVRC_ALISL RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 608

 Score =  296 bits (759), Expect = 3e-82
 Identities = 209/640 (32%), Positives = 318/640 (49%), Gaps = 60/640 (9%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           S+   PGVYR  +    VIYVGKAK+L+ RLSSYF+  +    +T+ +++  A +D TV 
Sbjct: 12  SVTHQPGVYRMYNAEAEVIYVGKAKDLKKRLSSYFRS-NIPSEKTKALVTHIAQIDVTVT 70

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
           +TE EAL LE+++IK+Y P++NV  RDDKSYPY+ ++ N + PR+ + RG +R+   YFG
Sbjct: 71  HTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFIS-NHKHPRISIHRGTKRKKGEYFG 129

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCV-GRIGVEE 191
           PY  + A+RD++ L+ ++FP+R C   V+       RPCL+  I +C APCV G I  E+
Sbjct: 130 PYPDSGAVRDSLHLIQKLFPIRQCEDSVYANRH---RPCLMHQIGRCLAPCVKGIISDED 186

Query: 192 YRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVL 251
           Y    E    F+ G+  + ++                    IRD IQ++R V E+Q    
Sbjct: 187 YAEQTEFIRLFLQGKDRQVIQSLVEQMEGASQALNFEKAATIRDQIQSMRRVQEQQYXXX 246

Query: 252 GDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGG 311
                        +   A + +  +R G+I G R +           ++   FL Q Y  
Sbjct: 247 XXXXXXXXXGFTIENGLACIHLLMIRHGKILGSRSFFPKIPAKTEKEEVFSSFLTQYYL- 305

Query: 312 ADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAE 371
             +      IP  V+ S E  + + +   L++  G  V  ++  +G K   ++    NA 
Sbjct: 306 --NHSQGRTIPNRVITSFE-FESEGLEQALTELSGRKVLFQLNPKGMKGRYLKLADTNAL 362

Query: 372 QTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDG 431
             L    + +   LT   +                R+ECFDIS   GE TVAS VVF   
Sbjct: 363 SALTSKANHK---LTVYQRFKQLEEALSLASIQ--RMECFDISHTMGEKTVASCVVFNQE 417

Query: 432 LARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
              KSEYRR++I G  G D D AAM +V+ RR+++ L+       +D +           
Sbjct: 418 GPVKSEYRRYNITGITGGD-DYAAMAQVLERRYSKQLD-------IDKI----------- 458

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGI------EDVAVCGLAKRLEE------- 538
                   P++V +DGG+ Q+    RA D +        +   + G+AK +         
Sbjct: 459 --------PDIVFIDGGKGQL---NRAYDVIRQHWGDWPKRPLLLGIAKGVTRKHGLETL 507

Query: 539 VWLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVR 598
           V + GEE    +P  S  L+L+Q +RDE+H  AIS HR +RAK    S L  I G+GP R
Sbjct: 508 VKITGEE--FSMPSDSPALHLIQHIRDESHNHAISGHRAQRAKVRKTSTLQHIEGVGPKR 565

Query: 599 RAALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERL 638
           R ALL++ G ++ L +A+  EI++VPGI    A+ I + L
Sbjct: 566 RQALLQYLGGLQELKKASVEEISKVPGISRSLAEKIQDAL 605


>UVRC_MARMM RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 633

 Score =  296 bits (758), Expect = 3e-82
 Identities = 199/634 (31%), Positives = 308/634 (48%), Gaps = 48/634 (7%)

Query: 13  SIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVV 72
           ++P  PGVYR   E G V+YVGKA+NL+ R+S+Y       + R   MI     +++ V 
Sbjct: 34  NLPPKPGVYRMFGEDGAVLYVGKARNLKNRVSNYANGRGHSN-RIALMIGLTRKMEFVVT 92

Query: 73  NTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFG 132
                      + IK   PRFN+  RDDKS+PY+ +  +    ++   RGAR+    YFG
Sbjct: 93  QXXXXXXXXXXNLIKSLKPRFNILLRDDKSFPYILIRKDHPAAQLTKHRGARKAKGDYFG 152

Query: 133 PYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEY 192
           P++   A+  T++ L + F VRTCS  V++      R C+L  I +C+ PCV  I    Y
Sbjct: 153 PFASVGAVNQTLNTLQKAFLVRTCSDSVYE---GRSRACMLHQIKRCAGPCVDLIDPAAY 209

Query: 193 RALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLG 252
             L      F+ G +                         +RD I+A+  V   Q +   
Sbjct: 210 DELVGQATDFLRGRSNALREDLQTRMAQASEAMDFETAAKLRDRIRAIAAVTTDQGINPD 269

Query: 253 DSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGA 312
              + DV+A+  D  ++ VQVF+ R G+  G + +      +    +++  F+AQ Y   
Sbjct: 270 GVEEADVVAVHSDGGKSCVQVFFFRAGQNWGNQSFFPRHDMEAEPAEVLAAFIAQFY--- 326

Query: 313 DDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQ 372
           DD+ +    P  +L+S               R    V +  P+RG+KR L++  L NA +
Sbjct: 327 DDKPA----PALILLSHXXXXXXXXXXXXXXRTERKVSLHTPRRGEKRKLVDRTLTNARE 382

Query: 373 TLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGL 432
            LAR  ++ AS    +++              P RIE +D S +QG + + +M+V     
Sbjct: 383 ALARRMAESAS----QTQLLKGVQRVFDLTDLPQRIEVYDNSHIQGTNALGAMIVAGPEG 438

Query: 433 ARKSEYRRFSIRGAEGA-DSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAER 491
             K+ YRRF+++G + A + D A M  ++ RRF+R L+E           + GAP     
Sbjct: 439 FEKNHYRRFNMKGDDAATNDDFAMMKAMLKRRFSRLLKER----------DDGAPV---- 484

Query: 492 KAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIED---VAVCGLAKRLEE------VWLP 542
                   P+LV++DGG+ Q+++     ++LGI D   + +  +AK  E        +LP
Sbjct: 485 --------PDLVLIDGGKGQLSSVMEIAEELGITDETGITIAAIAKGPERDAGREAFYLP 536

Query: 543 GEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAAL 602
           G+  P  LP     LY LQR+RDEAHRFAI  HR KR K +T + LD I G+GP R+ AL
Sbjct: 537 GKP-PFKLPMKDPVLYYLQRLRDEAHRFAIGGHRAKRKKQMTDNPLDGIDGIGPSRKKAL 595

Query: 603 LKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           L HFGS + +  A  A++  V GI    A+ I++
Sbjct: 596 LAHFGSAKAVRNAALADLEAVDGISRAMARKIHD 629


>UVRC_BACWK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  296 bits (758), Expect = 3e-82
 Identities = 196/640 (30%), Positives = 320/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 Y P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R CS           + CL  ++ +C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCS-------NMPDKVCLYYHMGQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTDEQNKEIVDEIIKFLNGGHKEIRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    H  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFHLIERDEERTVKA---IDNLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E+  +          
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKENLPL---------- 446

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEV 539
                          P+L+++DGG+  +AA    L+ +LG+  + + GL K    +   +
Sbjct: 447 ---------------PDLIIIDGGKGHLAATSDVLENELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQR++DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVMLERNSQEFYLLQRIQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
             LLKHFGS++++ +A+ AE  E  G+ +  A+ IY  LT
Sbjct: 551 KVLLKHFGSLKKMKEASIAEFVEA-GMPKNVAEMIYTYLT 589


>UVRC_RHOP2 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 695

 Score =  296 bits (757), Expect = 4e-82
 Identities = 203/631 (32%), Positives = 317/631 (50%), Gaps = 38/631 (6%)

Query: 15  PTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWTVVNT 74
           PT PGVYR  +    V+YVGKAKN++ RLSSY +    +  R   MI+            
Sbjct: 87  PTSPGVYRMLNAAHDVLYVGKAKNVKKRLSSYARPTGHVM-RIARMIAAXXXXXXXXXXX 145

Query: 75  EVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPY 134
                    + IK+  PRFNV  RDDKS+PY+ +T +   P++   RGA+ R  RYFGP+
Sbjct: 146 XXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITGDHWAPQILKHRGAQSRPGRYFGPF 205

Query: 135 SYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRA 194
           +   A+  T+  L R F VR+C+   F+   S  RPCLL  I +CS PC G +    Y  
Sbjct: 206 ASVGAVNRTITALQRAFLVRSCTDSFFE---SRTRPCLLYQIRRCSGPCTGEVDFPGYTE 262

Query: 195 LAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEKQAVVLGDS 254
           L  +   F++G +    +                     RD + AL  +  +Q +     
Sbjct: 263 LVREAKDFLSGRSRAVKQELAVEMEKASNELEFETAALYRDRLAALSAIQSQQGINPRTV 322

Query: 255 TDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADD 314
            + DV AI ++   + V+VF+ R G+  G R +     +  +  +++  FLAQ Y   DD
Sbjct: 323 EEADVFAIYQEGGYSCVEVFFFRTGQNWGNRAYFPRAEKSFTPEEVLASFLAQFY---DD 379

Query: 315 EESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETVLKNAEQTL 374
           +      P+ +L+S +  D   +   L  +    V++  P+RG+K+ L+   L NA + L
Sbjct: 380 KPP----PKLILLSHDIEDCALLADALCIKADRKVEISTPKRGEKKELVAHALTNAREAL 435

Query: 375 ARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVASMVVFEDGLAR 434
            R    + +D  T+++              P RIE +D S +QG + V +M+V       
Sbjct: 436 GR----KLADTATQTRLLQGLATTLGLPKPPQRIEVYDNSHIQGTNAVGAMIVAGPDGFI 491

Query: 435 KSEYRRFSIRGAEGAD--SDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAERK 492
           K++YR+F+IR +EG     D A M EV+ RRF R L             +   PQ     
Sbjct: 492 KNQYRKFNIR-SEGLTPGDDYAMMREVLERRFKR-LXXXXXXXXXXXPNDDETPQW---- 545

Query: 493 APRFAYPPNLVVVDGGRPQVAAAQRALDDLGIE-DVAVCGLAKR------LEEVWLPGEE 545
                  P+LV++DGGR Q+ AA+  L +LG++ +V + G+AK        E +++P E 
Sbjct: 546 -------PDLVIIDGGRGQLNAARGVLTELGLDAEVTLLGVAKGPDRDAGRETLFMP-ER 597

Query: 546 DPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKH 605
           + I L      LY +QR+RDEAHRF I  HR+ R K +  + L +IPG+GP R+ ALL H
Sbjct: 598 EAIKLEPRDPVLYFIQRLRDEAHRFVIGSHRKLRKKDIREAGLQEIPGIGPSRKRALLHH 657

Query: 606 FGSVRRLAQATAAEIAEVPGIGERTAQTIYE 636
           FG+++ + +A+  ++ +VPGI   +A+ I++
Sbjct: 658 FGTLKEIERASLGDLGKVPGISAESARRIFD 688


>UVRC_BACHK RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  294 bits (753), Expect = 1e-81
 Identities = 198/640 (30%), Positives = 321/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 + P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R CS           + CL  ++ +C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCS-------NMPDKVCLYYHMGQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    +  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFYLIERDEERTIKA---VENLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E             G
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKE-------------G 443

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEV 539
            P             P+L+++DGG+  +AAA   L+ +LG+  + + GL K    +   +
Sbjct: 444 LPL------------PDLIIIDGGKGHLAAASDVLENELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQRV+DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
             LLKHFGS++++ +A+  E  E  G+ +  A+TIY  LT
Sbjct: 551 KVLLKHFGSLKKMKEASIEEFVEA-GMPKNVAETIYTYLT 589


>UVRC_BACCZ RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  294 bits (753), Expect = 1e-81
 Identities = 198/640 (30%), Positives = 321/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 + P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R CS           + CL  ++ +C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCS-------NMPDKVCLYYHMGQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    +  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFYLIERDEERTIKA---VENLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E             G
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKE-------------G 443

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEV 539
            P             P+L+++DGG+  +AAA   L+ +LG+  + + GL K    +   +
Sbjct: 444 LPL------------PDLIIIDGGKGHLAAASDVLENELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQRV+DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
             LLKHFGS++++ +A+  E  E  G+ +  A+TIY  LT
Sbjct: 551 KVLLKHFGSLKKMKEASIEEFVEA-GMPKNVAETIYTYLT 589


>UVRC_BACC3 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  294 bits (753), Expect = 1e-81
 Identities = 198/640 (30%), Positives = 321/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 + P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R CS           + CL  ++ +C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCS-------NMPDKVCLYYHMGQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    +  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFYLIERDEERTIKA---VENLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E             G
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKE-------------G 443

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEV 539
            P             P+L+++DGG+  +AAA   L+ +LG+  + + GL K    +   +
Sbjct: 444 LPL------------PDLIIIDGGKGHLAAASDVLENELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQRV+DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query: 600 AALLKHFGSVRRLAQATAAEIAEVPGIGERTAQTIYERLT 639
             LLKHFGS++++ +A+  E  E  G+ +  A+TIY  LT
Sbjct: 551 KVLLKHFGSLKKMKEASIEEFVEA-GMPKNVAETIYTYLT 589


>UVRC_BACC0 RecName: Full=UvrABC system protein C;       
           Short=Protein uvrC;AltName: Full=Excinuclease ABC
           subunit C;
          Length = 594

 Score =  294 bits (753), Expect = 1e-81
 Identities = 198/640 (30%), Positives = 321/640 (50%), Gaps = 62/640 (9%)

Query: 7   LRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAAD 66
           L+ K   +P  PG Y  +D+ G VIYVGKAK L+ R+ SYF    +   +T  ++    D
Sbjct: 5   LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFT--GSHDGKTLRLVGEIVD 62

Query: 67  VDWTVVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRR 126
            ++ V                 + P++N++ +DDK+YP++ +T  ++ PR+ + R  ++ 
Sbjct: 63  FEYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQ-PRLLITRNVKKD 121

Query: 127 GVRYFGPYSYAWAIRDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGR 186
             +YFGPY  A +  +T  LL R++P+R CS           + CL  ++ +C APCV  
Sbjct: 122 KGKYFGPYPNAQSAHETKKLLDRMYPLRKCS-------NMPDKVCLYYHMGQCLAPCVKE 174

Query: 187 IGVEEYRALAEDFCAFMAGETGRFLRXXXXXXXXXXXXXXXXXXXXIRDDIQALRTVMEK 246
           +  E+ + + ++   F+ G                           +RD I  +  +MEK
Sbjct: 175 VTEEQNKEIVDEIIKFLNGGHKEVRSELETKMYEASEKLEFERAKELRDQIAHIDAIMEK 234

Query: 247 QAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGRIRGERGWVVDKVEDVSTGKLVEQFLA 306
           Q +++ D  D DV   A D+    VQVF+VR G++      +    ++   G L   F+ 
Sbjct: 235 QKMIMSDLVDRDVFGYAVDKGWMCVQVFFVRKGKLIERDVSMFPIYDEPEEGFLT--FIG 292

Query: 307 QTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVDVRVPQRGDKRALMETV 366
           Q Y     E S+   P+E++V     D + V  +L       V+   P+RG K+ L+E  
Sbjct: 293 QFY-----ENSSHFKPKEIVVPGS-IDSELVERFLE------VEATQPKRGKKKDLVELA 340

Query: 367 LKNAEQTLAR--HKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEHTVAS 424
            KNA+  L    +  +R  + T ++               P RIE FD S +QG + V++
Sbjct: 341 NKNAKIALEEKFYLIERDEERTIKA---VENLGKQLGIETPYRIEAFDNSNIQGTNPVSA 397

Query: 425 MVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESG 484
           M+ F DG   K EYR++ I+  +G D D  +M EV+ RR+TR L+E             G
Sbjct: 398 MIAFIDGKPAKKEYRKYKIKTVQGPD-DYESMREVVRRRYTRALKE-------------G 443

Query: 485 APQGAERKAPRFAYPPNLVVVDGGRPQVAAAQRALD-DLGIEDVAVCGLAK----RLEEV 539
            P             P+L+++DGG+  +AAA   L+ +LG+  + + GL K    +   +
Sbjct: 444 LPL------------PDLIIIDGGKGHLAAASDVLENELGLY-IPMAGLVKDDKHKTSHL 490

Query: 540 WLPGEEDPIILPRTSEGLYLLQRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRR 599
            +    +P++L R S+  YLLQRV+DE HRFAI++HR+   K++  S LDDIPG+G  R+
Sbjct: 491 IIGDPPEPVMLERNSQEFYLLQRVQDEVHRFAITFHRQLHGKSVIQSALDDIPGIGDKRK 550

Query