BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ56191.1 tfus0 AAZ56191.1 GIB00263CH01 "putative
long-chain-fatty-acid-CoA ligase"
         (515 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

LCFB_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   371   e-105
LCFA_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   330   2e-92
LCFA_ECO57 RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   308   9e-86
LCFA_ECOLI RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   306   2e-85
LCFA_ECOL6 RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   306   2e-85
LCFA_SALTY RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   299   4e-83
LCFA_SALTI RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   299   4e-83
LCFA_YERPE RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   296   4e-82
LCFA_HAEIN RecName: Full=Long-chain-fatty-acid--CoA ligase;     ...   257   1e-70
CAIC_SALAR RecName: Full=Probable crotonobetaine/carnitine-CoA l...   249   3e-68
ACSF2_RAT RecName: Full=Acyl-CoA synthetase family member 2, mit...   249   5e-68
CAIC_CITK8 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   248   6e-68
CAIC_ECOSM RecName: Full=Probable crotonobetaine/carnitine-CoA l...   245   7e-67
CAIC_ECO27 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   244   2e-66
CAIC_ECOUT RecName: Full=Probable crotonobetaine/carnitine-CoA l...   243   3e-66
CAIC_ECOK1 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   243   3e-66
CAIC_ECO81 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   243   3e-66
CAIC_ECO45 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   243   3e-66
4CL2_SOLTU RecName: Full=4-coumarate--CoA ligase 2;         Shor...   243   4e-66
ACSF2_MOUSE RecName: Full=Acyl-CoA synthetase family member 2, m...   242   5e-66
CAIC_SHIFL RecName: Full=Probable crotonobetaine/carnitine-CoA l...   242   6e-66
CAIC_ECO7I RecName: Full=Probable crotonobetaine/carnitine-CoA l...   241   8e-66
CAIC_ECO5E RecName: Full=Probable crotonobetaine/carnitine-CoA l...   241   8e-66
CAIC_ECO57 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   241   8e-66
CAIC_ECOLC RecName: Full=Probable crotonobetaine/carnitine-CoA l...   240   2e-65
CAIC_ECOL6 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   240   2e-65
CAIC_ECOL5 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   240   2e-65
CAIC_ECO55 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   240   2e-65
4CL1_SOLTU RecName: Full=4-coumarate--CoA ligase 1;         Shor...   240   2e-65
CAIC_ECO8A RecName: Full=Probable crotonobetaine/carnitine-CoA l...   239   3e-65
CAIC_ECOHS RecName: Full=Probable crotonobetaine/carnitine-CoA l...   239   4e-65
CAIC_ESCF3 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   239   5e-65
CAIC_ECO24 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   7e-65
CAIC_ECOSE RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   9e-65
CAIC_ECOLU RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   9e-65
CAIC_SHISS RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   1e-64
CAIC_ECOLI RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   1e-64
CAIC_ECODH RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   1e-64
CAIC_ECOBW RecName: Full=Probable crotonobetaine/carnitine-CoA l...   238   1e-64
CAIC_SALPK RecName: Full=Probable crotonobetaine/carnitine-CoA l...   236   3e-64
CAIC_SALPA RecName: Full=Probable crotonobetaine/carnitine-CoA l...   236   3e-64
ACSF2_MACFA RecName: Full=Acyl-CoA synthetase family member 2, m...   236   3e-64
CAIC_SALNS RecName: Full=Probable crotonobetaine/carnitine-CoA l...   236   3e-64
CAIC_PROMH RecName: Full=Probable crotonobetaine/carnitine-CoA l...   236   4e-64
ACSF2_PONAB RecName: Full=Acyl-CoA synthetase family member 2, m...   235   6e-64
4CL1_TOBAC RecName: Full=4-coumarate--CoA ligase 1;         Shor...   234   1e-63
CAIC_SALSV RecName: Full=Probable crotonobetaine/carnitine-CoA l...   234   1e-63
CAIC_SALDC RecName: Full=Probable crotonobetaine/carnitine-CoA l...   234   1e-63
CAIC_SHIDS RecName: Full=Probable crotonobetaine/carnitine-CoA l...   234   2e-63
CAIC_SALTI RecName: Full=Probable crotonobetaine/carnitine-CoA l...   233   2e-63
CAIC_SALPC RecName: Full=Probable crotonobetaine/carnitine-CoA l...   233   2e-63
CAIC_SALPB RecName: Full=Probable crotonobetaine/carnitine-CoA l...   233   2e-63
CAIC_SALEP RecName: Full=Probable crotonobetaine/carnitine-CoA l...   233   2e-63
CAIC_SALCH RecName: Full=Probable crotonobetaine/carnitine-CoA l...   233   3e-63
CAIC_SALTY RecName: Full=Probable crotonobetaine/carnitine-CoA l...   231   8e-63
CAIC_SALHS RecName: Full=Probable crotonobetaine/carnitine-CoA l...   231   8e-63
CAIC_SALA4 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   231   8e-63
ACSF2_HUMAN RecName: Full=Acyl-CoA synthetase family member 2, m...   231   8e-63
YDAB_BACSU RecName: Full=Putative acyl--CoA ligase ydaB;        ...   230   2e-62
CAIC_PROSL RecName: Full=Probable crotonobetaine/carnitine-CoA l...   229   3e-62
MENE_BACLD RecName: Full=2-succinylbenzoate--CoA ligase;        ...   229   5e-62
ACSF2_BOVIN RecName: Full=Acyl-CoA synthetase family member 2, m...   228   7e-62
4CLL6_ARATH RecName: Full=4-coumarate--CoA ligase-like 6;       ...   228   1e-61
4CL2_TOBAC RecName: Full=4-coumarate--CoA ligase 2;         Shor...   227   2e-61
MENE_BACP2 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   226   3e-61
MENE_GEOSW RecName: Full=2-succinylbenzoate--CoA ligase;        ...   226   4e-61
4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5;       ...   226   4e-61
4CL_VANPL RecName: Full=4-coumarate--CoA ligase;         Short=4...   224   1e-60
FADK_ECOLI RecName: Full=Short-chain-fatty-acid--CoA ligase;    ...   224   2e-60
4CL2_PETCR RecName: Full=4-coumarate--CoA ligase 1;         Shor...   224   2e-60
4CL1_PETCR RecName: Full=4-coumarate--CoA ligase 1;         Shor...   224   2e-60
4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1;       ...   223   4e-60
ACSF2_DANRE RecName: Full=Acyl-CoA synthetase family member 2, m...   218   9e-59
MENE_GEOKA RecName: Full=2-succinylbenzoate--CoA ligase;        ...   217   2e-58
CAIC_SHIF8 RecName: Full=Probable crotonobetaine/carnitine-CoA l...   217   2e-58
4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2;       ...   216   4e-58
4CLL3_ARATH RecName: Full=4-coumarate--CoA ligase-like 3;       ...   216   5e-58
4CL2_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 2;    ...   215   6e-58
4CLL8_ARATH RecName: Full=4-coumarate--CoA ligase-like 8;       ...   214   1e-57
4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7;       ...   214   2e-57
4CL1_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 1;    ...   213   2e-57
MENE_BACC7 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   213   4e-57
4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4;       ...   212   5e-57
4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4;       ...   212   5e-57
FAT2_SCHPO RecName: Full=Putative peroxisomal-coenzyme A synthet...   212   7e-57
3HBCL_THAAR RecName: Full=3-hydroxybenzoate--CoA/4-hydroxybenzoa...   207   2e-55
4CL2_ARATH RecName: Full=4-coumarate--CoA ligase 2;         Shor...   206   3e-55
MENE_BACSU RecName: Full=2-succinylbenzoate--CoA ligase;        ...   206   5e-55
ALKK_PSEOL RecName: Full=Medium-chain-fatty-acid--CoA ligase;   ...   204   1e-54
MENE_BACC0 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   203   2e-54
4CL3_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 3;    ...   203   2e-54
4CL2_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 2;    ...   203   3e-54
MENE_BACCZ RecName: Full=2-succinylbenzoate--CoA ligase;        ...   202   4e-54
MENE_BACHK RecName: Full=2-succinylbenzoate--CoA ligase;        ...   202   7e-54
MENE_BACAN RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   9e-54
MENE_BACAH RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   9e-54
MENE_BACAC RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   9e-54
MENE_BACAA RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   9e-54
MENE_BACCQ RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   1e-53
MENE_BACC1 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   201   2e-53
ACSM2_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM2, mito...   200   2e-53
4CL1_ARATH RecName: Full=4-coumarate--CoA ligase 1;         Shor...   200   3e-53
MENE_BACWK RecName: Full=2-succinylbenzoate--CoA ligase;        ...   199   3e-53
4CLL9_ARATH RecName: Full=4-coumarate--CoA ligase-like 9;       ...   199   3e-53
MENE_BACCR RecName: Full=2-succinylbenzoate--CoA ligase;        ...   199   6e-53
MENE_LISMO RecName: Full=2-succinylbenzoate--CoA ligase;        ...   198   8e-53
4CL3_ARATH RecName: Full=4-coumarate--CoA ligase 3;         Shor...   198   8e-53
ACSM3_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM3, mito...   196   3e-52
BCLA_THAAR RecName: Full=Benzoate--CoA ligase;         EC=6.2.1....   195   8e-52
MENE_OCEIH RecName: Full=2-succinylbenzoate--CoA ligase;        ...   194   1e-51
MENE_BACCN RecName: Full=2-succinylbenzoate--CoA ligase;        ...   194   1e-51
MENE_LISMF RecName: Full=2-succinylbenzoate--CoA ligase;        ...   194   1e-51
ACSM3_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM3, mitoch...   191   9e-51
LUCI_LUCMI RecName: Full=Luciferin 4-monooxygenase;         Shor...   190   3e-50
ACSM2_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM2, mitoch...   190   3e-50
4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6;       ...   188   1e-49
ACSM5_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM5, mito...   187   1e-49
4CLL9_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 9;       ...   186   3e-49
FAT2_YEAST RecName: Full=Peroxisomal-coenzyme A synthetase;     ...   185   9e-49
ACSF3_MOUSE RecName: Full=Acyl-CoA synthetase family member 3, m...   185   9e-49
LUCI_PHOPY RecName: Full=Luciferin 4-monooxygenase;         Shor...   184   1e-48
4CL1_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 1;    ...   184   1e-48
ACSM4_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM4, mitoch...   184   1e-48
4CL2_SOYBN RecName: Full=4-coumarate--CoA ligase 2;         Shor...   183   3e-48
ACSF3_BOVIN RecName: Full=Acyl-CoA synthetase family member 3, m...   182   6e-48
4CL4_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 4;    ...   182   6e-48
4CL5_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 5;    ...   182   7e-48
MENE_LISIN RecName: Full=2-succinylbenzoate--CoA ligase;        ...   180   2e-47
ACSM5_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM5, mitoch...   180   2e-47
4CL4_ARATH RecName: Full=4-coumarate--CoA ligase 4;         Shor...   180   2e-47
LUCI_LUCCR RecName: Full=Luciferin 4-monooxygenase;         Shor...   180   3e-47
LUCI_LUCLA RecName: Full=Luciferin 4-monooxygenase;         Shor...   179   4e-47
ACSM3_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM3, mito...   179   5e-47
ACSM5_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM5, mito...   179   6e-47
4HBCL_RHOPA RecName: Full=4-hydroxybenzoate--CoA/benzoate--CoA l...   177   1e-46
4CL_PINTA RecName: Full=4-coumarate--CoA ligase;         Short=4...   177   1e-46
MENE_STAAW RecName: Full=2-succinylbenzoate--CoA ligase;        ...   177   2e-46
MENE_STAAS RecName: Full=2-succinylbenzoate--CoA ligase;        ...   177   2e-46
LUCI_PHOPE RecName: Full=Luciferin 4-monooxygenase;         Shor...   177   2e-46
4CL3_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 3;    ...   177   2e-46
ACSM3_PONAB RecName: Full=Acyl-coenzyme A synthetase ACSM3, mito...   177   2e-46
ACS2B_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2B, mit...   176   3e-46
MENE_STAAB RecName: Full=2-succinylbenzoate--CoA ligase;        ...   176   5e-46
MENE_BACA2 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   175   9e-46
MENE_STAAN RecName: Full=2-succinylbenzoate--CoA ligase;        ...   174   1e-45
MENE_STAAM RecName: Full=2-succinylbenzoate--CoA ligase;        ...   174   1e-45
MENE_STAA9 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   174   1e-45
MENE_STAA2 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   174   1e-45
MENE_STAA1 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   174   1e-45
ACS2A_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2A, mit...   174   1e-45
DHBE_BACSU RecName: Full=2,3-dihydroxybenzoate-AMP ligase;      ...   174   2e-45
ACSM4_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM4, mito...   174   2e-45
ACSM4_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM4, mito...   174   2e-45
MENE_STAAR RecName: Full=2-succinylbenzoate--CoA ligase;        ...   172   4e-45
ACSM1_BOVIN RecName: Full=Acyl-coenzyme A synthetase ACSM1, mito...   172   6e-45
ACSF3_HUMAN RecName: Full=Acyl-CoA synthetase family member 3, m...   172   6e-45
ACSA_XANP2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   172   6e-45
MENE_STAAU RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_STAAT RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_STAAE RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_STAAC RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_STAA8 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_STAA3 RecName: Full=2-succinylbenzoate--CoA ligase;        ...   170   2e-44
MENE_ENTFA RecName: Full=2-succinylbenzoate--CoA ligase;        ...   169   4e-44
ACSA_NOVAD RecName: Full=Acetyl-coenzyme A synthetase;         E...   169   5e-44
4CLL3_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 3;       ...   169   6e-44
ACSM1_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM1, mito...   168   8e-44
ACSA_BACSU RecName: Full=Acetyl-coenzyme A synthetase;         E...   168   8e-44
ACSM1_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM1, mito...   167   2e-43
4CL1_SOYBN RecName: Full=4-coumarate--CoA ligase 1;         Shor...   165   9e-43
ACSA_PSYIN RecName: Full=Acetyl-coenzyme A synthetase;         E...   163   3e-42
ACSA_SHEFN RecName: Full=Acetyl-coenzyme A synthetase;         E...   163   4e-42
ACSA_METPB RecName: Full=Acetyl-coenzyme A synthetase;         E...   162   8e-42
ACSA_DESAA RecName: Full=Acetyl-coenzyme A synthetase;         E...   162   8e-42
ACSA_SYNFM RecName: Full=Acetyl-coenzyme A synthetase;         E...   161   1e-41
ACSA_METRJ RecName: Full=Acetyl-coenzyme A synthetase;         E...   161   1e-41
ACSA_SHEAM RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   2e-41
ACSA_METC4 RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   2e-41
ACSA_METEP RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   2e-41
MENE_LACLA RecName: Full=2-succinylbenzoate--CoA ligase;        ...   160   3e-41
ACSA_XANAC RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   3e-41
ACSA_RHOP5 RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   3e-41
ACSA_PARL1 RecName: Full=Acetyl-coenzyme A synthetase;         E...   160   3e-41
ACSF3_XENLA RecName: Full=Acyl-CoA synthetase family member 3, m...   159   5e-41
ACSA2_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 2;       ...   159   5e-41
ACSA_SHESA RecName: Full=Acetyl-coenzyme A synthetase;         E...   159   7e-41
ACSA_SHESM RecName: Full=Acetyl-coenzyme A synthetase;         E...   158   1e-40
ACSA_BRAJA RecName: Full=Acetyl-coenzyme A synthetase;         E...   158   1e-40
ACSA_SHESR RecName: Full=Acetyl-coenzyme A synthetase;         E...   157   2e-40
ACSA_BRASO RecName: Full=Acetyl-coenzyme A synthetase;         E...   157   2e-40
ACSA_XANOM RecName: Full=Acetyl-coenzyme A synthetase;         E...   157   3e-40
4CLL5_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 5;       ...   157   3e-40
ACSA_SODGM RecName: Full=Acetyl-coenzyme A synthetase;         E...   156   3e-40
ACSA_SHEON RecName: Full=Acetyl-coenzyme A synthetase;         E...   156   3e-40
ACSA_HALHL RecName: Full=Acetyl-coenzyme A synthetase;         E...   156   4e-40
ACSA_XANCP RecName: Full=Acetyl-coenzyme A synthetase;         E...   155   6e-40
ACSA_XANC8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   155   6e-40
4CLL1_ARATH RecName: Full=4-coumarate--CoA ligase-like 1;       ...   155   6e-40
LGRC_BREPA RecName: Full=Linear gramicidin synthetase subunit C;...   155   7e-40
4CLL7_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 7;       ...   155   1e-39
ACSA_XYLFA RecName: Full=Acetyl-coenzyme A synthetase;         E...   153   4e-39
ACSA_XYLFT RecName: Full=Acetyl-coenzyme A synthetase;         E...   152   5e-39
ACSA_BEII9 RecName: Full=Acetyl-coenzyme A synthetase;         E...   152   8e-39
ACSA_VIBCH RecName: Full=Acetyl-coenzyme A synthetase;         E...   151   1e-38
PPSB_BACSU RecName: Full=Plipastatin synthetase subunit B;      ...   150   3e-38
ACSA_YERPS RecName: Full=Acetyl-coenzyme A synthetase;         E...   150   3e-38
ACSA_YERP3 RecName: Full=Acetyl-coenzyme A synthetase;         E...   150   3e-38
ACSA_RHILO RecName: Full=Acetyl-coenzyme A synthetase;         E...   150   3e-38
ACSA_PSEA6 RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   4e-38
ACSA_ALCBS RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   4e-38
ACSA_YERPP RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   5e-38
ACSA_YERPN RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   5e-38
ACSA_YERPE RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   5e-38
ACSA_YERPA RecName: Full=Acetyl-coenzyme A synthetase;         E...   149   5e-38
4CLL2_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 2;       ...   149   5e-38
ACSA_YERE8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   148   9e-38
ACSA_AERS4 RecName: Full=Acetyl-coenzyme A synthetase;         E...   148   9e-38
ACSA_NEUCR RecName: Full=Acetyl-coenzyme A synthetase;         E...   148   1e-37
ACSA_AGRRK RecName: Full=Acetyl-coenzyme A synthetase;         E...   148   1e-37
ACSA_AGRT5 RecName: Full=Acetyl-coenzyme A synthetase;         E...   147   2e-37
ACSA_AERHH RecName: Full=Acetyl-coenzyme A synthetase;         E...   147   2e-37
ACSA_METSO RecName: Full=Acetyl-coenzyme A synthetase;         E...   147   3e-37
ACSA_RHOCA RecName: Full=Acetyl-coenzyme A synthetase;         E...   146   3e-37
ACSA_EMENI RecName: Full=Acetyl-coenzyme A synthetase;         E...   146   3e-37
ACSA_MAGSM RecName: Full=Acetyl-coenzyme A synthetase;         E...   146   4e-37
ACSA_RHOBA RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   6e-37
ACSA_METSB RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   8e-37
ACSA_LEPIN RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   1e-36
ACSA_LEPIC RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   1e-36
ACSA_ECOLI RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   1e-36
ACSA_ECOL6 RecName: Full=Acetyl-coenzyme A synthetase;         E...   145   1e-36
MENE_STAEQ RecName: Full=2-succinylbenzoate--CoA ligase;        ...   144   1e-36
ACSA_ENTS8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   144   1e-36
ACSA_BARHE RecName: Full=Acetyl-coenzyme A synthetase;         E...   144   1e-36
ENTE_ECOLI RecName: Full=Enterobactin synthetase component E;Alt...   144   2e-36
ACSA_VIBVY RecName: Full=Acetyl-coenzyme A synthetase;         E...   144   2e-36
ACSA_VIBVU RecName: Full=Acetyl-coenzyme A synthetase;         E...   144   2e-36
ACSA_CITK8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   144   2e-36
ACSA_CHRVO RecName: Full=Acetyl-coenzyme A synthetase;         E...   143   4e-36
ACSA_GEMAT RecName: Full=Acetyl-coenzyme A synthetase;         E...   142   5e-36
ENTE_ECO57 RecName: Full=Enterobactin synthetase component E;Alt...   142   6e-36
MENE_STAES RecName: Full=2-succinylbenzoate--CoA ligase;        ...   142   8e-36
ACSA_PHOLL RecName: Full=Acetyl-coenzyme A synthetase;         E...   141   1e-35
DHBF_BACSU RecName: Full=Dimodular nonribosomal peptide synthetase;   140   2e-35
ACSA_LEPBJ RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   2e-35
ACSA_BDEBA RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   2e-35
ACSA_ALHEH RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   2e-35
TYCB_BREPA RecName: Full=Tyrocidine synthetase 2;AltName: Full=T...   140   2e-35
ACSA_ECO57 RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   2e-35
ACSA_BART1 RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   2e-35
GRSB_BREBE RecName: Full=Gramicidin S synthetase 2;AltName: Full...   140   3e-35
BACA_BACLI RecName: Full=Bacitracin synthetase 1;         Short=...   140   3e-35
ACSA_LARHH RecName: Full=Acetyl-coenzyme A synthetase;         E...   140   3e-35
ACSA_SHESW RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   4e-35
ACSA_SHEPC RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   4e-35
ACSA_PHOPR RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   4e-35
VIBE_VIBCH RecName: Full=Vibriobactin-specific 2,3-dihydroxybenz...   139   5e-35
ACSA_SHEB8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   5e-35
ACSA_SHEB5 RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   5e-35
ACSA_BARBK RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   5e-35
4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ligase-like ...   139   5e-35
ACVS_NOCLA RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cystei...   139   7e-35
ACSA_VIBPA RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   7e-35
ACSA_SHEHH RecName: Full=Acetyl-coenzyme A synthetase;         E...   139   7e-35
GRSB_ANEMI RecName: Full=Gramicidin S synthetase 2;AltName: Full...   138   9e-35
ACSA_METFK RecName: Full=Acetyl-coenzyme A synthetase;         E...   138   9e-35
ACSA_MARMS RecName: Full=Acetyl-coenzyme A synthetase;         E...   138   9e-35
ACSA_LEPBL RecName: Full=Acetyl-coenzyme A synthetase;         E...   138   9e-35
AAS_SALTI RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   9e-35
ACSA_SALTY RecName: Full=Acetyl-coenzyme A synthetase;         E...   138   1e-34
ACSA_PRB01 RecName: Full=Acetyl-coenzyme A synthetase;         E...   138   1e-34
AAS_SALSV RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
AAS_SALPB RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
AAS_SALHS RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
AAS_SALG2 RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
AAS_SALEP RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
AAS_SALA4 RecName: Full=Bifunctional protein aas;Includes:  RecN...   138   1e-34
ACSA_PASMU RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   2e-34
AAS_SALPC RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
AAS_SALCH RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
ACSA_SHEDO RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   2e-34
ACSA_SALTI RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   2e-34
ACSA_SACD2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   2e-34
ACSA_RHISN RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   2e-34
AAS_SALTY RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
AAS_SALPK RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
AAS_SALPA RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
AAS_SALNS RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
AAS_ENT38 RecName: Full=Bifunctional protein aas;Includes:  RecN...   137   2e-34
LGRB_BREPA RecName: Full=Linear gramicidin synthetase subunit B;...   137   3e-34
ACSA_RHIE6 RecName: Full=Acetyl-coenzyme A synthetase;         E...   137   3e-34
ACSA_SHEB9 RecName: Full=Acetyl-coenzyme A synthetase;         E...   136   5e-34
ACSA_PSEHT RecName: Full=Acetyl-coenzyme A synthetase;         E...   135   6e-34
ACSA_BARQU RecName: Full=Acetyl-coenzyme A synthetase;         E...   135   6e-34
ACSA_AGRVS RecName: Full=Acetyl-coenzyme A synthetase;         E...   135   6e-34
ACSA2_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 2;       ...   135   6e-34
ACSA_RHIEC RecName: Full=Acetyl-coenzyme A synthetase;         E...   135   8e-34
ACSA_PYRAE RecName: Full=Acetyl-coenzyme A synthetase;         E...   135   8e-34
LGRD_BREPA RecName: Full=Linear gramicidin synthetase subunit D;...   135   1e-33
AAS_SALDC RecName: Full=Bifunctional protein aas;Includes:  RecN...   135   1e-33
AAS_ENTS8 RecName: Full=Bifunctional protein aas;Includes:  RecN...   135   1e-33
ACSA_MARAV RecName: Full=Acetyl-coenzyme A synthetase;         E...   134   1e-33
ACSA_LEPBP RecName: Full=Acetyl-coenzyme A synthetase;         E...   134   1e-33
ACSA_LEPBA RecName: Full=Acetyl-coenzyme A synthetase;         E...   134   1e-33
TYCC_BREPA RecName: Full=Tyrocidine synthetase 3;AltName: Full=T...   134   2e-33
SRFAA_BACSU RecName: Full=Surfactin synthetase subunit 1;             134   2e-33
ACSA_SYNAS RecName: Full=Acetyl-coenzyme A synthetase;         E...   134   2e-33
AAS_KLEP3 RecName: Full=Bifunctional protein aas;Includes:  RecN...   134   2e-33
ACSA_SHEPA RecName: Full=Acetyl-coenzyme A synthetase;         E...   133   3e-33
ACSA_RHILW RecName: Full=Acetyl-coenzyme A synthetase;         E...   133   3e-33
AAS_SHISS RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_SHIFL RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_SHIF8 RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_SHIB3 RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECOSE RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECOLC RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECOHS RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECO5E RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECO57 RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECO55 RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
AAS_ECO24 RecName: Full=Bifunctional protein aas;Includes:  RecN...   133   4e-33
ACSA_THEEB RecName: Full=Acetyl-coenzyme A synthetase;         E...   132   5e-33
AAS_ECOLU RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   5e-33
AAS_ECOLI RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   7e-33
AAS_ECODH RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   7e-33
AAS_ECOBW RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   7e-33
AAS_ECO7I RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   7e-33
PPSD_BACSU RecName: Full=Plipastatin synthetase subunit D;      ...   132   9e-33
BACC_BACLI RecName: Full=Bacitracin synthetase 3;         Short=...   132   9e-33
ACSA_SHESH RecName: Full=Acetyl-coenzyme A synthetase;         E...   132   9e-33
ACSA_SCHPO RecName: Full=Probable acetyl-coenzyme A synthetase; ...   132   9e-33
ACSA1_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 1;       ...   132   9e-33
AAS_ECOSM RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   9e-33
AAS_ECOL6 RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   9e-33
AAS_ECO27 RecName: Full=Bifunctional protein aas;Includes:  RecN...   132   9e-33
ACVS_CEPAC RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cystei...   131   1e-32
AAS_KLEP7 RecName: Full=Bifunctional protein aas;Includes:  RecN...   131   1e-32
AAS_ESCF3 RecName: Full=Bifunctional protein aas;Includes:  RecN...   131   1e-32
AAS_ECOUT RecName: Full=Bifunctional protein aas;Includes:  RecN...   131   1e-32
AAS_ECOK1 RecName: Full=Bifunctional protein aas;Includes:  RecN...   131   1e-32
AAS_ECO45 RecName: Full=Bifunctional protein aas;Includes:  RecN...   131   1e-32
ACSA_NITEU RecName: Full=Acetyl-coenzyme A synthetase;         E...   130   2e-32
ACS1_CANAL RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   130   3e-32
ACSA_PENCH RecName: Full=Acetyl-coenzyme A synthetase;         E...   129   4e-32
ACSA_AGRRH RecName: Full=Acetyl-coenzyme A synthetase;         E...   129   4e-32
ACVS2_PENCH RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cyste...   129   6e-32
ACVS1_PENCH RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cyste...   129   6e-32
ACSA_SERP5 RecName: Full=Acetyl-coenzyme A synthetase;         E...   129   6e-32
AAS_ECOL5 RecName: Full=Bifunctional protein aas;Includes:  RecN...   129   6e-32
ACSA2_RHIME RecName: Full=Acetyl-coenzyme A synthetase 2;       ...   129   7e-32
ACSA_SINMW RecName: Full=Acetyl-coenzyme A synthetase;         E...   128   1e-31
ACSA_RUBXD RecName: Full=Acetyl-coenzyme A synthetase;         E...   128   1e-31
ACS2L_MOUSE RecName: Full=Acetyl-coenzyme A synthetase 2-like, m...   128   1e-31
ACSA_PSESM RecName: Full=Acetyl-coenzyme A synthetase;         E...   128   1e-31
ACSA_NITEC RecName: Full=Acetyl-coenzyme A synthetase;         E...   128   1e-31
ACSA_CAUCR RecName: Full=Acetyl-coenzyme A synthetase;         E...   128   1e-31
AAS_PECCP RecName: Full=Bifunctional protein aas;Includes:  RecN...   128   1e-31
FCSA_DICDI RecName: Full=Fatty acyl-CoA synthetase A;         EC...   127   2e-31
ACSA_PSE14 RecName: Full=Acetyl-coenzyme A synthetase;         E...   127   2e-31
ACSA1_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 1;       ...   127   3e-31
AAS_ERWT9 RecName: Full=Bifunctional protein aas;Includes:  RecN...   127   3e-31
ACSA_PSEU2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   126   4e-31
AAS_ERWCT RecName: Full=Bifunctional protein aas;Includes:  RecN...   126   4e-31
AAS_CITK8 RecName: Full=Bifunctional protein aas;Includes:  RecN...   126   4e-31
ACSA_SHELP RecName: Full=Acetyl-coenzyme A synthetase;         E...   125   8e-31
AAS_YERE8 RecName: Full=Bifunctional protein aas;Includes:  RecN...   125   8e-31
ACS2_CANAL RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   125   1e-30
ACSL1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 1;  ...   124   1e-30
ACSA_DROME RecName: Full=Acetyl-coenzyme A synthetase;         E...   124   1e-30
ACS2L_HUMAN RecName: Full=Acetyl-coenzyme A synthetase 2-like, m...   124   2e-30
PPSA_BACSU RecName: Full=Plipastatin synthetase subunit A;      ...   123   4e-30
AAS_YERPY RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
AAS_YERPS RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
AAS_YERPP RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
AAS_YERPG RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
AAS_YERPB RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
AAS_YERP3 RecName: Full=Bifunctional protein aas;Includes:  RecN...   123   4e-30
ACS2_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   122   5e-30
ACSA_MYCTU RecName: Full=Acetyl-coenzyme A synthetase;         E...   122   7e-30
ACSA_MYCBO RecName: Full=Acetyl-coenzyme A synthetase;         E...   122   7e-30
PPSC_BACSU RecName: Full=Plipastatin synthetase subunit C;      ...   122   9e-30
ACSL1_CAVPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;  ...   121   2e-29
ACSA_PSYCK RecName: Full=Acetyl-coenzyme A synthetase;         E...   121   2e-29
LGRA_BREPA RecName: Full=Linear gramicidin synthetase subunit A;...   120   2e-29
ACVS_EMENI RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cystei...   120   3e-29
AAS_YERPE RecName: Full=Bifunctional protein aas;Includes:  RecN...   120   3e-29
AAS_YERPA RecName: Full=Bifunctional protein aas;Includes:  RecN...   120   3e-29
ACSA_SYNY3 RecName: Full=Acetyl-coenzyme A synthetase;         E...   120   3e-29
ACSA_COPCI RecName: Full=Acetyl-coenzyme A synthetase;         E...   119   5e-29
ACS1_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   119   5e-29
S27A2_RAT RecName: Full=Very long-chain acyl-CoA synthetase;    ...   119   6e-29
ACSL6_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 6;    ...   119   6e-29
ACSL6_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 6;  ...   119   6e-29
ACSL1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 1;    ...   119   6e-29
ACSA_STRCO RecName: Full=Acetyl-coenzyme A synthetase;         E...   119   6e-29
ACVS_STRCL RecName: Full=N-(5-amino-5-carboxypentanoyl)-L-cystei...   119   8e-29
ACSL1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 1;  ...   119   8e-29
TYCA_BREPA RecName: Full=Tyrocidine synthetase 1;AltName: Full=T...   118   1e-28
ACSA_DEIRA RecName: Full=Acetyl-coenzyme A synthetase;         E...   118   1e-28
MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;     ...   118   1e-28
ACSA_RALEJ RecName: Full=Acetyl-coenzyme A synthetase;         E...   117   2e-28
BACB_BACLI RecName: Full=Bacitracin synthetase 2;         Short=...   117   3e-28
ACSA_COPC7 RecName: Full=Acetyl-coenzyme A synthetase;         E...   117   3e-28
MYCC_BACSU RecName: Full=Mycosubtilin synthetase subunit C;     ...   116   4e-28
ACSL6_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 6;  ...   116   4e-28
ACSA_PSYA2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   116   4e-28
ACSA_DICDI RecName: Full=Acetyl-coenzyme A synthetase;         E...   115   7e-28
S27A3_MOUSE RecName: Full=Long-chain fatty acid transport protei...   115   8e-28
SRFAB_BACSU RecName: Full=Surfactin synthetase subunit 2;             115   1e-27
GRSA_BREBE RecName: Full=Gramicidin S synthetase 1;AltName: Full...   115   1e-27
ACSA_THIDA RecName: Full=Acetyl-coenzyme A synthetase;         E...   115   1e-27
ACS2_CANGA RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   115   1e-27
S27A2_MOUSE RecName: Full=Very long-chain acyl-CoA synthetase;  ...   114   2e-27
ACSA_THET2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   113   3e-27
SRFAC_BACSU RecName: Full=Surfactin synthetase subunit 3;             113   4e-27
PRPE_SALTY RecName: Full=Propionate--CoA ligase;         EC=6.2....   113   4e-27
GRSA_ANEMI RecName: Full=Gramicidin S synthetase 1;AltName: Full...   113   4e-27
ACSA_THET8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   113   4e-27
ACSA_RALEH RecName: Full=Acetyl-coenzyme A synthetase;         E...   112   6e-27
ACS1_KLULA RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   112   6e-27
BAIB_EUBSP RecName: Full=Bile acid-coenzyme A ligase;         EC...   112   7e-27
ACSA_PSEU5 RecName: Full=Acetyl-coenzyme A synthetase;         E...   112   7e-27
ACSA_RALSO RecName: Full=Acetyl-coenzyme A synthetase;         E...   111   2e-26
ACSA_PHYBL RecName: Full=Acetyl-coenzyme A synthetase;         E...   111   2e-26
ACS1_CANGA RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   111   2e-26
ACSA_RALME RecName: Full=Acetyl-coenzyme A synthetase;         E...   110   2e-26
ACS2_ZYGBA RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   110   2e-26
PRPE_ECOLI RecName: Full=Propionate--CoA ligase;         EC=6.2....   110   3e-26
ACSA_BURS3 RecName: Full=Acetyl-coenzyme A synthetase;         E...   110   3e-26
DLTA_BACC2 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   109   5e-26
ACS2_KLULA RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   109   5e-26
DLTA_BACCR RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   109   6e-26
DLTA_BACC4 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   109   6e-26
ACSA_OCHA4 RecName: Full=Acetyl-coenzyme A synthetase;         E...   109   6e-26
ACS1_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   109   6e-26
LCFH_HAEIN RecName: Full=Putative long-chain-fatty-acid--CoA lig...   108   8e-26
ACS2_YEAST RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   108   8e-26
ACS1_YEAST RecName: Full=Acetyl-coenzyme A synthetase 1;        ...   108   8e-26
ACSL5_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 5;  ...   108   1e-25
ACSA_CUPTR RecName: Full=Acetyl-coenzyme A synthetase;         E...   108   1e-25
ACBG1_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...   108   1e-25
S27A2_HUMAN RecName: Full=Very long-chain acyl-CoA synthetase;  ...   107   2e-25
DLTA_BACWK RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   2e-25
DLTA_BACC1 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   2e-25
DLTA_BACHK RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   3e-25
DLTA_BACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   3e-25
DLTA_BACC0 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   3e-25
DLTA_BACAH RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   107   3e-25
ACSA_PYRAR RecName: Full=Acetyl-coenzyme A synthetase;         E...   107   3e-25
ENTF_ECO57 RecName: Full=Enterobactin synthetase component F;   ...   106   4e-25
DLTA_BACCZ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   4e-25
DLTA_BACCQ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   4e-25
DLTA_BACAN RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   4e-25
DLTA_BACAC RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   4e-25
DLTA_BACAA RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   4e-25
ACSA_CRYPV RecName: Full=Acetyl-coenzyme A synthetase;         E...   106   4e-25
ACS2_ASHGO RecName: Full=Acetyl-coenzyme A synthetase 2;        ...   106   4e-25
ACBG1_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG1...   106   4e-25
PPSE_BACSU RecName: Full=Plipastatin synthetase subunit E;      ...   106   5e-25
DLTA_BACC7 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   106   5e-25
ACBG1_MACFA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...   106   5e-25
ACSA_BURP8 RecName: Full=Acetyl-coenzyme A synthetase;         E...   105   7e-25
ACBG1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...   105   7e-25
S27A5_RAT RecName: Full=Bile acyl-CoA synthetase;         Short=...   105   9e-25
ACSA_RALPJ RecName: Full=Acetyl-coenzyme A synthetase;         E...   104   1e-24
ACSA_HERAR RecName: Full=Acetyl-coenzyme A synthetase;         E...   104   1e-24
AAS_PHOLL RecName: Full=Bifunctional protein aas;Includes:  RecN...   104   2e-24
LCF2_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 2;   ...   103   3e-24
ACSL5_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 5;  ...   103   3e-24
ENTF_SHIFL RecName: Full=Enterobactin synthetase component F;   ...   103   4e-24
ENTF_ECOLI RecName: Full=Enterobactin synthetase component F;   ...   103   4e-24
DLTA_BACCN RecName: Full=D-alanine--poly(phosphoribitol) ligase ...   103   4e-24
MENE_SALTY RecName: Full=2-succinylbenzoate--CoA ligase;        ...   102   6e-24
ACSA_HUMAN RecName: Full=Acetyl-coenzyme A synthetase, cytoplasm...   102   6e-24
S27A5_MOUSE RecName: Full=Bile acyl-CoA synthetase;         Shor...   102   7e-24
ACSL5_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 5;    ...   102   7e-24
MENE_ECOLI RecName: Full=2-succinylbenzoate--CoA ligase;        ...   102   1e-23
S27A1_BOVIN RecName: Full=Long-chain fatty acid transport protei...   101   1e-23
ACSA_BRUSU RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUSI RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUO2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUME RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUC2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUAB RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUA2 RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
ACSA_BRUA1 RecName: Full=Acetyl-coenzyme A synthetase;         E...   101   1e-23
S27A6_HUMAN RecName: Full=Long-chain fatty acid transport protei...   100   3e-23
ACSA_BURTA RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   3e-23
S27A4_MACFA RecName: Full=Long-chain fatty acid transport protei...   100   4e-23
ACSA_BURPS RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURP6 RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURP1 RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURP0 RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURMS RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURMA RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURM9 RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
ACSA_BURM7 RecName: Full=Acetyl-coenzyme A synthetase;         E...   100   5e-23
DLTA_BACLD RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    99   8e-23
S27A4_MOUSE RecName: Full=Long-chain fatty acid transport protei...    98   1e-22
ACSA_BRUMB RecName: Full=Acetyl-coenzyme A synthetase;         E...    98   1e-22
S27A4_HUMAN RecName: Full=Long-chain fatty acid transport protei...    98   2e-22
PKSJ_BACSU RecName: Full=Polyketide synthase pksJ;         Short...    97   2e-22
VRAA_STAAR RecName: Full=Putative long chain fatty acid-CoA liga...    97   3e-22
DLTA_STRPC RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   3e-22
DLTA_STRP6 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   3e-22
DLTA_STRP3 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   3e-22
DLTA_STRP1 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   3e-22
DLTA_STRPZ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
DLTA_STRPM RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
DLTA_STRPG RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
DLTA_STRPF RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
DLTA_STRPD RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
DLTA_STRP8 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    97   4e-22
ACSA_MOUSE RecName: Full=Acetyl-coenzyme A synthetase, cytoplasm...    97   4e-22
MBTB_MYCSS RecName: Full=Phenyloxazoline synthase mbtB;         ...    96   5e-22
ACBG1_BOVIN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...    96   5e-22
MYCB_BACSU RecName: Full=Mycosubtilin synthetase subunit B;     ...    96   7e-22
ACBG2_CHICK RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...    95   1e-21
VRAA_STAAW RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
VRAA_STAAS RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
VRAA_STAAN RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
VRAA_STAAM RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
VRAA_STAAC RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
VRAA_STAA1 RecName: Full=Putative long chain fatty acid-CoA liga...    94   3e-21
S27A3_HUMAN RecName: Full=Long-chain fatty acid transport protei...    94   3e-21
FAD11_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD11...    94   3e-21
ACSA_HELPH RecName: Full=Acetyl-coenzyme A synthetase;         E...    93   5e-21
VRAA_STAHJ RecName: Full=Putative long chain fatty acid-CoA liga...    92   1e-20
S27A4_PONAB RecName: Full=Long-chain fatty acid transport protei...    92   1e-20
DLTA_LISMF RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    92   1e-20
ACSA_HELPG RecName: Full=Acetyl-coenzyme A synthetase;         E...    92   1e-20
ACSA_HELP2 RecName: Full=Acetyl-coenzyme A synthetase;         E...    92   1e-20
PKSN_BACSU RecName: Full=Polyketide synthase pksN;         EC=2....    92   1e-20
ACSA_HELPY RecName: Full=Acetyl-coenzyme A synthetase;         E...    92   1e-20
DLTA_LISMO RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    91   2e-20
DLTA_LISMC RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    91   2e-20
DLTA_STRE4 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    91   2e-20
ACBG2_XENLA RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...    91   2e-20
SID2_USTMA RecName: Full=Ferrichrome siderophore peptide synthet...    91   3e-20
DLTA_LISMH RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    91   3e-20
DLTA_LISIN RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    91   3e-20
ACSS3_PONAB RecName: Full=Acyl-CoA synthetase short-chain family...    91   3e-20
ACSS3_HUMAN RecName: Full=Acyl-CoA synthetase short-chain family...    91   3e-20
DLTA_BACA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    90   4e-20
BGML_DROME RecName: Full=Long-chain-fatty-acid--CoA ligase bubbl...    90   4e-20
ACSA_HELAH RecName: Full=Acetyl-coenzyme A synthetase;         E...    90   4e-20
ACBG2_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...    90   4e-20
LCF1_SCHPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;   ...    90   5e-20
S27A5_HUMAN RecName: Full=Bile acyl-CoA synthetase;         Shor...    89   7e-20
DLTA_STRMU RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    89   7e-20
S27A1_HUMAN RecName: Full=Long-chain fatty acid transport protei...    89   9e-20
LCF1_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 1;   ...    89   9e-20
ANGR_VIBAN RecName: Full=Protein angR;                                 89   1e-19
ACSA_CHLTE RecName: Full=Acetyl-coenzyme A synthetase;         E...    89   1e-19
ACSB_DICDI RecName: Full=Acyl-CoA synthetase short-chain family ...    88   2e-19
MBTM_MYCSS RecName: Full=Long-chain-fatty-acid--[acyl-carrier-pr...    87   2e-19
DLTA_LISW6 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    87   2e-19
VRAA_STAEQ RecName: Full=Putative long chain fatty acid-CoA liga...    87   3e-19
BGM_DROME RecName: Full=Very long-chain-fatty-acid--CoA ligase b...    87   4e-19
ACSS3_MOUSE RecName: Full=Acyl-CoA synthetase short-chain family...    87   4e-19
DLTA_BACSU RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    86   6e-19
DLTA_LACCB RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    86   7e-19
DLTA_LACC3 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    86   7e-19
ACBG2_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase ACSBG2...    86   9e-19
FAD26_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD26...    85   1e-18
ACSL3_PONAB RecName: Full=Long-chain-fatty-acid--CoA ligase 3;  ...    85   1e-18
ACSL3_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 3;  ...    85   1e-18
FCSB_DICDI RecName: Full=Fatty acyl-CoA synthetase B;         EC...    85   2e-18
MBTB_MYCPA RecName: Full=Phenyloxazoline synthase mbtB;         ...    84   2e-18
DLTA_STRZP RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   2e-18
DLTA_STRR6 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   2e-18
DLTA_STRPN RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   2e-18
DLTA_STRP2 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   2e-18
DLTA_LACPL RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   2e-18
DLTA_STRA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   3e-18
ACSL3_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 3;    ...    84   3e-18
DLTA_STRP7 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   4e-18
DLTA_STRA5 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   4e-18
DLTA_STRA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    84   4e-18
ACSL4_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase 4;  ...    83   5e-18
ACSA_STRAW RecName: Full=Acetyl-coenzyme A synthetase;         E...    83   5e-18
Y3568_PSEAE RecName: Full=Uncharacterized protein PA3568;              83   6e-18
ACSS3_BOVIN RecName: Full=Acyl-CoA synthetase short-chain family...    82   8e-18
ACSA_WOLSU RecName: Full=Acetyl-coenzyme A synthetase;         E...    82   8e-18
VRAA_STAES RecName: Full=Putative long chain fatty acid-CoA liga...    82   1e-17
LCF4_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 4;   ...    82   1e-17
DLTA_STRZT RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    82   1e-17
DLTA_STRPJ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    82   1e-17
S27A1_MOUSE RecName: Full=Long-chain fatty acid transport protei...    82   1e-17
ACSL4_RAT RecName: Full=Long-chain-fatty-acid--CoA ligase 4;    ...    81   2e-17
ACSA_CAMJ8 RecName: Full=Acetyl-coenzyme A synthetase;         E...    81   2e-17
ACSA_CAMJJ RecName: Full=Acetyl-coenzyme A synthetase;         E...    80   3e-17
ACSA_CAMJE RecName: Full=Acetyl-coenzyme A synthetase;         E...    80   3e-17
ACSL4_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 4;  ...    80   4e-17
DLTA_STAXY RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    78   2e-16
S27A1_RAT RecName: Full=Long-chain fatty acid transport protein ...    77   3e-16
ACSL3_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 3;  ...    77   4e-16
SIB1_SCHPO RecName: Full=Hydroxamate-type ferrichrome siderophor...    75   1e-15
DLTA_LACRH RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    75   1e-15
MBTB_MYCTU RecName: Full=Phenyloxazoline synthase mbtB;         ...    74   2e-15
MBTB_MYCBO RecName: Full=Phenyloxazoline synthase mbtB;         ...    74   2e-15
FAT1_YEAST RecName: Full=Very long-chain fatty acid transport pr...    74   2e-15
HMWP2_YERE8 RecName: Full=High-molecular-weight protein 2;      ...    73   5e-15
DLTA_STAES RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    73   5e-15
ACBG2_HUMAN RecName: Full=Long-chain-fatty-acid--CoA ligase ACSB...    73   6e-15
MENE_HAEIN RecName: Full=2-succinylbenzoate--CoA ligase;        ...    72   1e-14
FAT1_COCHE RecName: Full=Fatty acid transporter protein;               71   2e-14
LCF2_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 2;   ...    70   4e-14
ACSM6_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM6, mito...    70   4e-14
DLTA_STAAB RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   7e-14
PABL_STRGR RecName: Full=Protein Y;AltName: Full=ORF-3;Flags: Fr...    69   9e-14
LCF3_YEAST RecName: Full=Long-chain-fatty-acid--CoA ligase 3;   ...    69   9e-14
DLTA_STAAW RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAU RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAT RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAS RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAN RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAM RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAE RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAAC RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAA9 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAA8 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAA3 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAA2 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_STAA1 RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
DLTA_LACLA RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    69   9e-14
LYS2_CANGA RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    69   1e-13
MBTM_MYCPA RecName: Full=Long-chain-fatty-acid--[acyl-carrier-pr...    68   2e-13
LYS2_YEAST RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    68   2e-13
DLTA_STAAR RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    68   2e-13
DLTA_STAEQ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    67   3e-13
FAD28_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD28...    66   8e-13
DLTA_STAHJ RecName: Full=D-alanine--poly(phosphoribitol) ligase ...    65   1e-12
ACSF4_MOUSE RecName: Full=Acyl-CoA synthetase family member 4;  ...    64   2e-12
ESYN_FUSEQ RecName: Full=Enniatin synthetase;Includes:  RecName:...    64   4e-12
ORA_PLAFN RecName: Full=Octapeptide-repeat antigen;         Shor...    61   2e-11
HTS1_COCCA RecName: Full=HC-toxin synthetase;         Short=HTS;...    58   2e-10
ACSA_NOSLI RecName: Full=Acetyl-coenzyme A synthetase;         E...    58   2e-10
ACSF4_DANRE RecName: Full=Acyl-CoA synthetase family member 4;  ...    57   3e-10
FAD21_MYCLE RecName: Full=Putative fatty-acid--CoA ligase fadD21...    57   5e-10
MBTM_MYCTU RecName: Full=Long-chain-fatty-acid--[acyl-carrier-pr...    54   4e-09
MBTM_MYCBO RecName: Full=Long-chain-fatty-acid--[acyl-carrier-pr...    54   4e-09
LYS2_PENCH RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    53   5e-09
LYS2_ASHGO RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    52   9e-09
ESYN_GIBPU RecName: Full=Enniatin synthetase;Includes:  RecName:...    52   9e-09
LYS2_SCHPO RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    52   1e-08
FAD25_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD25...    52   2e-08
FAD21_MYCTU RecName: Full=Putative fatty-acid--CoA ligase fadD21...    50   3e-08
FAD21_MYCBO RecName: Full=Putative fatty-acid--CoA ligase fadD21...    50   3e-08
ACSF4_HUMAN RecName: Full=Acyl-CoA synthetase family member 4;  ...    50   3e-08
LYS2_CANAL RecName: Full=L-aminoadipate-semialdehyde dehydrogena...    50   6e-08
PCL_HALHA RecName: Full=4-coumarate--CoA ligase;         Short=4...    47   5e-07
DIP2A_HUMAN RecName: Full=Disco-interacting protein 2 homolog A;...    41   2e-05
PCL_RHOS4 RecName: Full=4-coumarate--CoA ligase;         Short=4...    41   3e-05
PATJ_DROME RecName: Full=Patj homolog;                                 38   2e-04
DIP2A_MOUSE RecName: Full=Disco-interacting protein 2 homolog A;...    38   2e-04
YAC2_METSO RecName: Full=Uncharacterized protein in acs 3'region...    37   3e-04
DIP2B_MOUSE RecName: Full=Disco-interacting protein 2 homolog B;...    37   5e-04
DIP2C_HUMAN RecName: Full=Disco-interacting protein 2 homolog C;...    36   7e-04
DIP2B_HUMAN RecName: Full=Disco-interacting protein 2 homolog B;...    36   7e-04
DIP2B_DANRE RecName: Full=Disco-interacting protein 2 homolog B;...    36   7e-04

>LCFB_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 513

 Score =  371 bits (952), Expect = e-105
 Identities = 217/518 (41%), Positives = 293/518 (56%), Gaps = 14/518 (2%)

Query: 2   LNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           +NL   LE+ A  +P+  A  F D  + Y  +N    + A+ L   G+  GD +AL   N
Sbjct: 1   MNLVSKLEETASEKPDSIACRFKDHMMTYQELNEYIQRFADGLQEAGMEKGDHLALLLGN 60

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
            P F   +FGALKAG VVVP+N L TP EI Y L +   KA+   +    LPL E   ++
Sbjct: 61  SPDFIIAFFGALKAGIVVVPINPLYTPTEIGYMLTNGDVKAIVGVSQL--LPLYESMHES 118

Query: 122 FQEVAECELYIDLPAAAGATTSAIPGAE----TFWAALNGQPGEFESVRTEGDDVAVIIY 177
             +V   EL I          +A P       TF   L       ++     DD AVI+Y
Sbjct: 119 LPKV---ELVILCQTGEAEPEAADPEVRMKMTTFAKILRPTSAAKQNQEPVPDDTAVILY 175

Query: 178 TSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY 237
           TSGTTG+PKGA LTH NL  NA   +       D  D  +  LP+FH+F  T  MNA L 
Sbjct: 176 TSGTTGKPKGAMLTHQNLYSNANDVAGYLGM--DERDNVVCALPMFHVFCLTVCMNAPLM 233

Query: 238 RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
              T+++ P+F       L+++++ TIFAGVPTMY  L   Q ++  K    ++   +SG
Sbjct: 234 SGATVLIEPQFSPASVFKLVKQQQATIFAGVPTMYNYLF--QHENGKKDDFSSIRLCISG 291

Query: 298 GASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD 357
           GAS+P  +    +EKFG+ ILEGYGLSE SPV  FN   R  KPGSIG  I  VE K+VD
Sbjct: 292 GASMPVALLTAFEEKFGVTILEGYGLSEASPVTCFNPFDRGRKPGSIGTSILHVENKVVD 351

Query: 358 ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDR 417
                +     GE+ V+G  VMKGY+  P      ++DGW  TGD+ARRDE+G+++I+DR
Sbjct: 352 PLGRELPAHQVGELIVKGPNVMKGYYKMPMETEHALKDGWLYTGDLARRDEDGYFYIVDR 411

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
            KDMII GGYNVYPRE+EEVL +HP V  A V+GVP    GE +K +V+P     +TE++
Sbjct: 412 KKDMIIVGGYNVYPREVEEVLYSHPDVKEAVVIGVPDPQSGEAVKGYVVPKRSG-VTEED 470

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           ++   ++ LA YK P  + F  ++P  ATGK+L+R LR
Sbjct: 471 IMQHCEKHLAKYKRPAAITFLDDIPKNATGKMLRRALR 508


>LCFA_BACSU RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 560

 Score =  330 bits (846), Expect = 2e-92
 Identities = 197/523 (37%), Positives = 276/523 (52%), Gaps = 21/523 (4%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
           L  +L D A   P++ AI F   +L +  +   A ++A  L   G++ GD+VA+  PN P
Sbjct: 26  LQSILTDSAARFPDKTAISFYGKKLTFHDILTDALKLAAFLQCNGLQKGDRVAVMLPNCP 85

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                Y+G L AG +VV  N L T  E+EY LRD+    +          +  +      
Sbjct: 86  QTVISYYGVLFAGGIVVQTNPLYTEHELEYQLRDAQVSVIITLDLLFPKAIKMKTLSIVD 145

Query: 124 EVAECEL--YIDLPA----------AAGATTSAIPGAETFWAALNGQPGEFESVRT--EG 169
           ++    +  Y+  P                        TF + +  +  E  ++      
Sbjct: 146 QILITSVKDYLPFPKNILYPLTQKQKVHIDFDKTANIHTFASCMKQEKTELLTIPKIDPE 205

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
            D+AV+ YT GTTG PKG  LTH N+L N    +A      +  +  L ++P FH++G T
Sbjct: 206 HDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCAAWMYDVKEGAEKVLGIVPFFHVYGLT 265

Query: 230 TMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG--DHDIKQI 287
            +MN ++     M+L+P+FD  E L +++K K T+F G PT+Y GLL+      +D+  I
Sbjct: 266 AVMNYSIKLGFEMILLPKFDPLETLKIIDKHKPTLFPGAPTIYIGLLHHPELQHYDLSSI 325

Query: 288 SQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLP 347
              L    SG A+LP EV +K ++  G +++EGYGLSE SPV   N    K KPGSIG P
Sbjct: 326 KSCL----SGSAALPVEVKQKFEKVTGGKLVEGYGLSEASPVTHANFIWGKNKPGSIGCP 381

Query: 348 IWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARR 406
               +  +  E    +      GEI V+G  VMKGY N+PE  A V+RDGW  TGD+   
Sbjct: 382 WPSTDAAIYSEETGELAAPYEHGEIIVKGPQVMKGYWNKPEETAAVLRDGWLFTGDMGYM 441

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DEEGF++I DR KD+II GGYN+YPRE+EE L  H  +    V GVP    GE +KAFV+
Sbjct: 442 DEEGFFYIADRKKDIIIAGGYNIYPREVEEALYEHEAIQEIVVAGVPDSYRGETVKAFVV 501

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
             +GA    +EL A+A+ RLA YK P+  EFR ELP TA GKI
Sbjct: 502 LKKGAKADTEELDAFARSRLAPYKVPKAYEFRKELPKTAVGKI 544


>LCFA_ECO57 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
                   Short=Acyl-CoA synthetase;
          Length = 561

 Score =  308 bits (788), Expect = 9e-86
 Identities = 194/491 (39%), Positives = 275/491 (56%), Gaps = 33/491 (6%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA-- 105
           G++ GD+VAL  PN+  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+    
Sbjct: 70  GLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVS 129

Query: 106 -FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI-------------PGAETF 151
            F  T E  + + A    Q V    +   L  A G   + +             P A +F
Sbjct: 130 NFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGTLVNFVVKYIKRLVPKYHLPDAISF 186

Query: 152 WAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP 210
            +AL NG   ++       +D+A + YT GTTG  KGA LTH N+L N    +A +   P
Sbjct: 187 RSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP 244

Query: 211 DSH---DVFLTVLPLFHIFGQTT--MMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIF 265
             H   ++ +T LPL+HIF  T   ++   L     ++  PR D    +  + K   T  
Sbjct: 245 LLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAI 303

Query: 266 AGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLS 324
            GV T++  LLN   + + +Q+   +LH +  GG  +   VA +  +  G  +LEGYGL+
Sbjct: 304 TGVNTLFNALLN---NKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT 360

Query: 325 ETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHN 384
           E +P+VS N        GSIGLP+   E KLVD++ N +    PGE+ VRG  VM GY  
Sbjct: 361 ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVSPGQPGELCVRGPQVMLGYWQ 420

Query: 385 RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV 444
           RP+A  +++++GW  TGDIA  DEEGF  I+DR KDMI+  G+NVYP EIE+V+M HP V
Sbjct: 421 RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV 480

Query: 445 SLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMT 504
              A VGVP  + GE +K FV+  +  +LTE+ L+ + + +L  YK P++VEFR ELP +
Sbjct: 481 QEVAAVGVPSGSSGEAVKIFVVKKD-PSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKS 539

Query: 505 ATGKILKRELR 515
             GKIL+RELR
Sbjct: 540 NVGKILRRELR 550


>LCFA_ECOLI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
                   Short=Acyl-CoA synthetase;
          Length = 561

 Score =  306 bits (785), Expect = 2e-85
 Identities = 193/491 (39%), Positives = 275/491 (56%), Gaps = 33/491 (6%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA-- 105
           G++ GD+VAL  PN+  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+    
Sbjct: 70  GLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVS 129

Query: 106 -FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI-------------PGAETF 151
            F  T E  + + A    Q V    +   L  A G   + +             P A +F
Sbjct: 130 NFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHLPDAISF 186

Query: 152 WAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP 210
            +AL NG   ++       +D+A + YT GTTG  KGA LTH N+L N    +A +   P
Sbjct: 187 RSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP 244

Query: 211 DSH---DVFLTVLPLFHIFGQTT--MMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIF 265
             H   ++ +T LPL+HIF  T   ++   L     ++  PR D    +  + K   T  
Sbjct: 245 LLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAI 303

Query: 266 AGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLS 324
            GV T++  LLN   + + +Q+   +LH +  GG  +   VA +  +  G  +LEGYGL+
Sbjct: 304 TGVNTLFNALLN---NKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT 360

Query: 325 ETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHN 384
           E +P+VS N        GSIGLP+   E KLVD++ N +    PGE+ V+G  VM GY  
Sbjct: 361 ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ 420

Query: 385 RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV 444
           RP+A  +++++GW  TGDIA  DEEGF  I+DR KDMI+  G+NVYP EIE+V+M HP V
Sbjct: 421 RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV 480

Query: 445 SLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMT 504
              A VGVP  + GE +K FV+  +  +LTE+ L+ + + +L  YK P++VEFR ELP +
Sbjct: 481 QEVAAVGVPSGSSGEAVKIFVVKKD-PSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKS 539

Query: 505 ATGKILKRELR 515
             GKIL+RELR
Sbjct: 540 NVGKILRRELR 550


>LCFA_ECOL6 RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
                   Short=Acyl-CoA synthetase;
          Length = 561

 Score =  306 bits (785), Expect = 2e-85
 Identities = 193/491 (39%), Positives = 275/491 (56%), Gaps = 33/491 (6%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA-- 105
           G++ GD+VAL  PN+  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+    
Sbjct: 70  GLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVS 129

Query: 106 -FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI-------------PGAETF 151
            F  T E  + + A    Q V    +   L  A G   + +             P A +F
Sbjct: 130 NFAHTLEKVVDKTA---VQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHLPDAISF 186

Query: 152 WAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP 210
            +AL NG   ++       +D+A + YT GTTG  KGA LTH N+L N    +A +   P
Sbjct: 187 RSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATY--GP 244

Query: 211 DSH---DVFLTVLPLFHIFGQTT--MMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIF 265
             H   ++ +T LPL+HIF  T   ++   L     ++  PR D    +  + K   T  
Sbjct: 245 LLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAI 303

Query: 266 AGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLS 324
            GV T++  LLN   + + +Q+   +LH +  GG  +   VA +  +  G  +LEGYGL+
Sbjct: 304 TGVNTLFNALLN---NKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT 360

Query: 325 ETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHN 384
           E +P+VS N        GSIGLP+   E KLVD++ N +    PGE+ V+G  VM GY  
Sbjct: 361 ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ 420

Query: 385 RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV 444
           RP+A  +++++GW  TGDIA  DEEGF  I+DR KDMI+  G+NVYP EIE+V+M HP V
Sbjct: 421 RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV 480

Query: 445 SLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMT 504
              A VGVP  + GE +K FV+  +  +LTE+ L+ + + +L  YK P++VEFR ELP +
Sbjct: 481 QEVAAVGVPSGSSGEAVKIFVVKKD-PSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKS 539

Query: 505 ATGKILKRELR 515
             GKIL+RELR
Sbjct: 540 NVGKILRRELR 550


>LCFA_SALTY RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 561

 Score =  299 bits (765), Expect = 4e-83
 Identities = 200/536 (37%), Positives = 282/536 (52%), Gaps = 32/536 (5%)

Query: 3   NLSVLLEDGARNRPERDAIV-FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           +L  L E  A    ++ A V  G++     L        A L    G++ GD+VAL  PN
Sbjct: 24  SLVELFEHAATRYADQPAFVNMGEVMTFRKLEERSRAFAAYLQQGLGLKKGDRVALMMPN 83

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
           +  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+   +             +
Sbjct: 84  LLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEKVVEKTS 143

Query: 122 FQEVAECELYIDLPAAAGATTSAI-------------PGAETFWAAL-NGQPGEFESVRT 167
            Q V    +   L  A G   + +             P A +F +AL +G   ++     
Sbjct: 144 VQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHLPDAISFRSALQHGYRMQYVKPEV 203

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSH---DVFLTVLPLFH 224
             +D+A + YT GTTG  KGA LTH N+L N     A +   P  H   ++ +T LPL+H
Sbjct: 204 VAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVKATY--GPLLHPGKELVVTALPLYH 261

Query: 225 IFGQTTMMNAALY----RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG 280
           IF  T  MN  L+        ++  PR D    +  + K   T   GV T++  LLN   
Sbjct: 262 IFALT--MNCLLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAMTGVNTLFNALLN--- 315

Query: 281 DHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA 339
           + + +Q+   +LH +  GG  +   VA +  +  G  +LEGYGL+E +P+VS N      
Sbjct: 316 NKEFQQLDFSSLHLSAGGGMPVQNVVAERWVKLTGQYLLEGYGLTECAPLVSVNPHDIDY 375

Query: 340 KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFR 399
             GSIGLP+   E KLVD++ N +     GE+ V+G  VM GY  RP+A  ++++DGW  
Sbjct: 376 HSGSIGLPVPSTEAKLVDDDDNEVAPGEAGELCVKGPQVMLGYWQRPDATDEIIKDGWLH 435

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDIA  DE+GF  I+DR KDMI+  G+NVYP EIE+V+M H  V   A VGVP  + GE
Sbjct: 436 TGDIAVMDEDGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHSGVQEVAAVGVPSGSSGE 495

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            +K FV+  + A LT+D LI + +  L  YK P+ VEFR ELP +  GKIL+RELR
Sbjct: 496 AVKLFVVKKDPA-LTDDALITFCRRHLTGYKVPKQVEFREELPKSNVGKILRRELR 550


>LCFA_SALTI RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 561

 Score =  299 bits (765), Expect = 4e-83
 Identities = 200/536 (37%), Positives = 282/536 (52%), Gaps = 32/536 (5%)

Query: 3   NLSVLLEDGARNRPERDAIV-FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           +L  L E  A    ++ A V  G++     L        A L    G++ GD+VAL  PN
Sbjct: 24  SLVELFEHAATRYADQPAFVNMGEVMTFRKLEERSRAFAAYLQQGLGLKKGDRVALMMPN 83

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
           +  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+   +             +
Sbjct: 84  LLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIIIVSNFAHTLEKVVEKTS 143

Query: 122 FQEVAECELYIDLPAAAGATTSAI-------------PGAETFWAAL-NGQPGEFESVRT 167
            Q V    +   L  A G   + +             P A +F +AL +G   ++     
Sbjct: 144 VQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHLPDAISFRSALQHGYRMQYVKPEV 203

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSH---DVFLTVLPLFH 224
             +D+A + YT GTTG  KGA LTH N+L N     A +   P  H   ++ +T LPL+H
Sbjct: 204 VAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVKATY--GPLLHPGKELVVTALPLYH 261

Query: 225 IFGQTTMMNAALY----RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG 280
           IF  T  MN  L+        ++  PR D    +  + K   T   GV T++  LLN   
Sbjct: 262 IFALT--MNCLLFIELGGQNLLITNPR-DIPGLVKELAKYPFTAMTGVNTLFNALLN--- 315

Query: 281 DHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA 339
           + + +Q+   +LH +  GG  +   VA +  +  G  +LEGYGL+E +P+VS N      
Sbjct: 316 NKEFQQLDFSSLHLSAGGGMPVQNVVAERWVKLTGQYLLEGYGLTECAPLVSVNPHDIDY 375

Query: 340 KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFR 399
             GSIGLP+   E KLVD++ N +     GE+ V+G  VM GY  RP+A  ++++DGW  
Sbjct: 376 HSGSIGLPVPSTEAKLVDDDDNEVAPGEAGELCVKGPQVMLGYWQRPDATDEIIKDGWLH 435

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDIA  DE+GF  I+DR KDMI+  G+NVYP EIE+V+M H  V   A VGVP  + GE
Sbjct: 436 TGDIAVMDEDGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHSGVQEVAAVGVPSGSSGE 495

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            +K FV+  + A LT+D LI + +  L  YK P+ VEFR ELP +  GKIL+RELR
Sbjct: 496 AVKLFVVKKDPA-LTDDALITFCRRHLTGYKVPKQVEFREELPKSNVGKILRRELR 550


>LCFA_YERPE RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 562

 Score =  296 bits (757), Expect = 4e-82
 Identities = 189/487 (38%), Positives = 265/487 (54%), Gaps = 25/487 (5%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G++ GD+VAL  PN+  +P   FG L+AG +VV +N L TPRE+E+ L DSGA A+   +
Sbjct: 70  GLQKGDRVALMMPNLLQYPIALFGVLRAGMIVVNVNPLYTPRELEHQLSDSGAVAIVIVS 129

Query: 108 GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI-------------PGAETFWAA 154
                          + V    +   L AA G   + +             P A +F   
Sbjct: 130 NFAHTLEKVVFKTQVRHVILTRMGDQLSAAKGTLVNFVVKYIKRLVPKYYLPDAISFRTV 189

Query: 155 L-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP--- 210
           L  G+  ++        D A + YT GTTG  KGA LTH N+  N   + A +  AP   
Sbjct: 190 LQKGRRMQYVKPDVINTDTAFLQYTGGTTGVAKGAILTHRNMQSNLEQAKAAY--APLLQ 247

Query: 211 DSHDVFLTVLPLFHIFGQTT--MMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGV 268
              D+ +T LPL+HIF  T   ++   L     ++  PR D    +  + +   T   GV
Sbjct: 248 PGRDLVVTALPLYHIFALTVNCLLFIELGGRSLLITNPR-DIPGMVKELSRYPFTAITGV 306

Query: 269 PTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSP 328
            T++  LLN +    +     TL  +V GG  +   VA K +   G  +LEGYGL+E SP
Sbjct: 307 NTLFNALLNNEEFTHLD--FSTLRLSVGGGMPVQKAVAEKWETLTGKHLLEGYGLTECSP 364

Query: 329 VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEA 388
           +V+ N    K   GSIGLP+   +++L D++ N +E   PGE+ VRG  VM GY  RP+A
Sbjct: 365 LVTGNPYDLKHYSGSIGLPVPSTDVRLRDDDGNDVELGKPGELWVRGPQVMLGYWQRPDA 424

Query: 389 NAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAA 448
              V++DGW  TGDIA  DE+GF  I+DR KDMI+  G+NVYP EIEEV+  H +V  +A
Sbjct: 425 TDDVLKDGWLATGDIATMDEDGFLRIVDRKKDMILVSGFNVYPNEIEEVVALHAKVLESA 484

Query: 449 VVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGK 508
           V+GVP++  GE +K FV+  + A+LT +EL+   +  L  YK P+IVEFR ELP +  GK
Sbjct: 485 VIGVPNEVSGEAVKVFVVKND-ASLTPEELLTHCRRYLTGYKVPKIVEFRDELPKSNVGK 543

Query: 509 ILKRELR 515
           IL+RELR
Sbjct: 544 ILRRELR 550


>LCFA_HAEIN RecName: Full=Long-chain-fatty-acid--CoA ligase;        
           EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA synthetase;
          Length = 562

 Score =  257 bits (657), Expect = 1e-70
 Identities = 174/530 (32%), Positives = 268/530 (50%), Gaps = 26/530 (4%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYF 65
           + +   R  P+R A +     L +  +   +   A  L +   ++ GD+VAL  PN+  +
Sbjct: 28  MFDKAVREHPDRPAYINMGQVLTFRKLEERSRAFAAYLQNEFKLQRGDRVALMMPNLLQY 87

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAF-------------TGTPEL 112
           P   FG L+AG + V +N L TPRE+E  L+DSGA A+                T    +
Sbjct: 88  PIALFGILRAGLIAVNVNPLYTPRELELQLQDSGAVAIVVVSNFASTLEKVVFNTNVKHV 147

Query: 113 PLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALN-GQPGEFESVRTEGDD 171
            L     Q          +                A TF   L+ G+  ++       +D
Sbjct: 148 ILTRMGDQLSFGKRTLVNFXXXXXXXXXXXXXXXHAVTFREVLSIGKYRQYVRPEISRED 207

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD---VFLTVLPLFHIFGQ 228
           +A + YT GTTG  KGA LTH N++ N   +  + +     H      +  LPL+H+F  
Sbjct: 208 LAFLQYTGGTTGVAKGAMLTHGNIITNVFQAKWIAEPFIGDHSRTRSAILALPLYHVFAL 267

Query: 229 TTMMNAALYRHGTMVLM--PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQ 286
           T      L    T +L+  PR D +  +  ++K +     GV T++  LLN   + + K+
Sbjct: 268 TVNCLLFLELGVTAILITNPR-DIEGFVKELKKYRFEAITGVNTLFNALLN---NENFKE 323

Query: 287 IS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIG 345
           +    L  +V GG ++   VA +  E  G  I+EGYG++E SP+++          G+IG
Sbjct: 324 VDFSALKLSVGGGMAIQQSVATRWHELTGCNIIEGYGMTECSPLIAACPINVVKHNGTIG 383

Query: 346 LPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIAR 405
           +P+   ++K++ ++ +  +    GE+ V+G  VM+GY  RPEA ++V++DGW  TGDI  
Sbjct: 384 VPVPNTDIKIIKDDGSDAKIGEAGELWVKGDQVMRGYWQRPEATSEVLKDGWMATGDIVI 443

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
            DE     I+DR KD+I+  G+NVYP EIE+V+M + +VS A  +GVPH   GE IK FV
Sbjct: 444 MDESYSLRIVDRKKDIILVSGFNVYPNEIEDVVMLNYKVSEAVAIGVPHAVSGETIKIFV 503

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  +  +LT DEL    ++ L  YK P+ +EFR ELP T  GKIL+R LR
Sbjct: 504 VKKDD-SLTRDELRNHCRQYLTGYKVPKEIEFRDELPKTNVGKILRRVLR 552


>CAIC_SALAR RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  249 bits (637), Expect = 3e-68
 Identities = 174/528 (32%), Positives = 264/528 (50%), Gaps = 33/528 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVF----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           +L  + +D A    ++ A++F    G+++  +YA +N   N+ ANL  S GIR GD VAL
Sbjct: 8   HLRQMWDDLAGIYEDKTALIFESCAGEVQHFSYASLNREINRTANLFYSLGIRKGDNVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA+VVP+N  L   E  + L++S    L   T  P  P+  +
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIVVPINARLLREESAWILQNSRTSLLV--TSAPFYPMYRQ 125

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVII 176
             Q      E    +      G T  A  G   F+     QP     +     DD A I+
Sbjct: 126 IQQ------EGRTPLSHICLIGPTLPAEEGVSHFYTLKAQQPDVLLYTPPLTPDDTAEIL 179

Query: 177 YTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAAL 236
           +TSGTT +PKG  +TH NL F    SS  +  A    DV+LTV+P FHI  Q T   AA 
Sbjct: 180 FTSGTTSRPKGVVITHYNLRFAGYYSS--WQCALREDDVYLTVMPAFHIDCQCTAAMAAF 237

Query: 237 YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLN---AQGD--HDIKQISQTL 291
               T VL+ ++        + K   T+   +P M   L+    A  D  H ++++   L
Sbjct: 238 SVGATFVLIEKYSARAFWGQVRKYCATVTECIPMMIRTLMTQTPAADDRHHCLREVMFYL 297

Query: 292 HTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGV 351
           + +V        +      E+FG+ +   YG++ET   +  + P  K +  SIG P +  
Sbjct: 298 NLSV--------QEKEAFTERFGVRLFTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFCY 349

Query: 352 EMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRD 407
           E ++ +E    +     GEI ++G     + K Y  RP+A A+ +  +GW  TGD   RD
Sbjct: 350 EAEIRNEQNRALPPGEIGEICIKGIPGKTLFKSYFERPDATAKALEPNGWLHTGDSGYRD 409

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
           EEGF++ +DR  +M+ RGG NV   E+E ++  HP++    V+G+  D   E IKAFV+ 
Sbjct: 410 EEGFFYFVDRRCNMVKRGGENVSCVELENIIAGHPKIQDVVVIGIKDDIRDEAIKAFVVL 469

Query: 468 AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            EG TLTE++   + +E +A +K P  +E R +LP   +GKI+K+ L+
Sbjct: 470 NEGETLTEEDFFTFCEENMAKFKVPSYLEIREDLPRNCSGKIIKKNLK 517


>ACSF2_RAT RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 615

 Score =  249 bits (635), Expect = 5e-68
 Identities = 181/539 (33%), Positives = 272/539 (50%), Gaps = 41/539 (7%)

Query: 8   LEDGARNRPERDAIVF--GDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           L+  A+  P R+A+V    ++RLN+A +    ++ A+ L+S G+R GD++ +  PN   +
Sbjct: 78  LDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAW 137

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL-------------FAFTGTPEL 112
             +     +AG ++V +N      E+EY LR  G K +                   PEL
Sbjct: 138 VLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQFKTQQYYNILKQVCPEL 197

Query: 113 PLGERAWQAFQEVAECELYIDLPAAAGAT-----TSAIPGAETFWAALNGQPGEFESVRT 167
              +      + + +    I + A    T       A  G E   A L    G       
Sbjct: 198 EKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCY-- 255

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP--LFHI 225
              D   I +TSGTTG PKGA L+H N++ N+            + +    VLP  L+H 
Sbjct: 256 ---DPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHC 312

Query: 226 FGQT--TMMNAALYRHGTMVLM--PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD 281
            G    TM++     HG  +L+  P F+G +AL  + +EK T+  G PTM+  +LN Q D
Sbjct: 313 LGSVGGTMVSVV---HGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILN-QPD 368

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPKR--K 338
                 + T+   V  G+  P E+ R +  K  + E++  YG +E SPV   N P+   +
Sbjct: 369 FSSYDFT-TIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLE 427

Query: 339 AKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDG 396
            K GS+G  +   E ++V+ E     +   PGE+ +RG+CVM+GY   P+   + + +D 
Sbjct: 428 QKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDR 487

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+RTGDIA  DE+GF  I+ RSKDMIIRGG N+YP E+E+    HPQV  A VVGV  D 
Sbjct: 488 WYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDR 547

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GEEI A +    G T TE+E+ A+ K +++ +K PR + F    P+T +GKI K +LR
Sbjct: 548 MGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLR 606


>CAIC_CITK8 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  248 bits (634), Expect = 6e-68
 Identities = 171/528 (32%), Positives = 264/528 (50%), Gaps = 33/528 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A     + A++F        + +YA +N   N+ ANL ++ GI+ GD VAL
Sbjct: 8   NLRQMWDDLAEVYGNKTALIFESSEGVVRQFSYASLNEEINRTANLFLASGIQKGDNVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S A+ +   T     P+   
Sbjct: 68  HLDNCPEFFFCWFGLAKIGAIMVPINARLLREESAWILQNSRAQLIV--TSAEFYPMYR- 124

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVII 176
                Q + E +  ++     G           F    + QP     +     DD A I+
Sbjct: 125 -----QILLEDDTLLNHICLIGENAPVEDNVSHFSQLKDQQPATLCYAPPLSTDDTAEIL 179

Query: 177 YTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAAL 236
           +TSGTT +PKG  +TH NL F    SS  +  A    DV+LTV+P FHI  Q T   AA 
Sbjct: 180 FTSGTTSRPKGVVITHYNLRFAGYYSS--WQCALREDDVYLTVMPAFHIDCQCTAAMAAF 237

Query: 237 YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQTL 291
               T VL+ ++        + K + T+   +P M   L+       +  H ++++   L
Sbjct: 238 SAGSTFVLIEKYSARAFWGQVRKYRATVTECIPMMIRTLMVQPASPEERQHCLREVMFYL 297

Query: 292 HTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGV 351
           + +V       A +AR     FG+ +L  YG++ET   +  + P  K +  SIG P +  
Sbjct: 298 NLSVQ---EKDAFIAR-----FGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRPGFCY 349

Query: 352 EMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRD 407
           E  + DE   ++     GEI ++G     + K Y+ RPEA A+ +  +GW  TGD   RD
Sbjct: 350 EADIRDEQNRSLPAGEIGEICIKGVPGKTIFKEYYARPEATAKALEANGWLHTGDSGYRD 409

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
           EEGF++ +DR  +MI RGG NV   E+E ++  HP++    V+G+      E IKAFV+ 
Sbjct: 410 EEGFFYFVDRRCNMIKRGGENVSCIELENIISAHPKIQDIVVIGIHDSIRDEAIKAFVVL 469

Query: 468 AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            EG TLTE+E  A+ ++ +A +K P  +E R +LP   +GKI+K+ L+
Sbjct: 470 NEGETLTEEEFFAFCEQNMAKFKVPSFLEIRNDLPRNCSGKIIKKNLK 517


>CAIC_ECOSM RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  245 bits (625), Expect = 7e-67
 Identities = 169/502 (33%), Positives = 255/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           I   +P M   L+      N Q  H ++++   L+        L A+      E+FG+ +
Sbjct: 265 ITECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSAQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO27 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  244 bits (622), Expect = 2e-66
 Identities = 169/502 (33%), Positives = 255/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVSLPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T   AA     T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTAAMAAFSTGATFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           I   +P M   L+      N Q  H ++++   L+        L  +      E+FG+ +
Sbjct: 265 ITECIPMMIRTLMVQPLSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGQAGFCYEAEIRDDHNRPLPAGEIGEICIKGVP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K   
Sbjct: 436 LENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVLS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOUT RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  243 bits (620), Expect = 3e-66
 Identities = 166/501 (33%), Positives = 253/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C + + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLIDMALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOK1 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  243 bits (620), Expect = 3e-66
 Identities = 166/501 (33%), Positives = 253/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C + + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLIDMALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO81 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  243 bits (620), Expect = 3e-66
 Identities = 170/504 (33%), Positives = 255/504 (50%), Gaps = 38/504 (7%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL    GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYVLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECEL-YIDLPAAAGATTSAI 145
              E  + L++S  +A    T     P+    +Q  Q+    EL +I L      T  A+
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPM----YQQIQQEDASELRHICL------TDMAL 144

Query: 146 P---GAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA 201
           P   G  +F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    
Sbjct: 145 PADDGVSSFTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYY 204

Query: 202 SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK 261
           S+  +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K +
Sbjct: 205 SA--WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYR 262

Query: 262 VTIFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
            TI   +P M   L+      N Q  H ++++   L+        L  +      E+FG+
Sbjct: 263 ATITECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGV 313

Query: 316 EILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG 375
            +L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G
Sbjct: 314 RLLTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEICDDHNRPLPAGEIGEICIKG 373

Query: 376 ---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
                + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV  
Sbjct: 374 VPGKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSC 433

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKY 491
            E+E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K 
Sbjct: 434 VELENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKV 493

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P  +E R +LP   +GKI+++ L+
Sbjct: 494 PSYLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO45 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  243 bits (620), Expect = 3e-66
 Identities = 166/501 (33%), Positives = 253/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C + + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLIDMALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVSLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>4CL2_SOLTU RecName: Full=4-coumarate--CoA ligase 2;       
           Short=4CL 2;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 2;
          Length = 545

 Score =  243 bits (619), Expect = 4e-66
 Identities = 170/504 (33%), Positives = 258/504 (51%), Gaps = 33/504 (6%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D    YA V + + +VA  L   GI+  D + +  PN P F F + GA   GA+    N 
Sbjct: 53  DRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCPEFVFAFIGASYLGAISTMANP 112

Query: 85  LLTPREIEYHLRDSGAKALFA---FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGAT 141
           L TP E+    + S AK +     F G               +V +  +  DL       
Sbjct: 113 LFTPAEVVKQAKASSAKIVITQACFAG---------------KVKDYAIENDLKVIC--V 155

Query: 142 TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA 201
            SA  G   F   +     E   V+ + DDV  + Y+SGTTG PKG  LTH  L+  +VA
Sbjct: 156 DSAPEGCVHFSELIQSDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVA 214

Query: 202 SSALFDQAP---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLME 258
                + A     S DV + VLPLFHI+   +++  AL     +++M +FD  + L L+ 
Sbjct: 215 QQVDGENANLYMHSDDVLMCVLPLFHIYSLNSVLLCALRVGAAILIMQKFDIAQFLELIP 274

Query: 259 KEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEI 317
           K KVTI   VP +   +  +   H+    S  + T +SG A L  E+   V+ KF   ++
Sbjct: 275 KHKVTIGPFVPPIVLAIAKSPLVHNYDLSS--VRTVMSGAAPLGKELEDAVRAKFPNAKL 332

Query: 318 LEGYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGEIA 372
            +GYG++E  PV++    F       K G+ G  +   EMK+VD +   ++    PGEI 
Sbjct: 333 GQGYGMTEAGPVLAMCLAFAKEPFDIKSGACGTVVRNAEMKIVDPDTGCSLPRNQPGEIC 392

Query: 373 VRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
           +RG  +MKGY N PEA A+ + ++GW  TGDI   D++   FI+DR K++I   G+ V P
Sbjct: 393 IRGDQIMKGYLNDPEATARTIEKEGWLHTGDIGFIDDDDELFIVDRLKELIKYKGFQVAP 452

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKY 491
            E+E +L+ HP +S AAVV +  +  GE   AFV+ + G+T+TEDE+  +  +++  YK 
Sbjct: 453 AELEALLINHPDISDAAVVPMIDEQAGEVPVAFVVRSNGSTITEDEVKDFISKQVIFYKR 512

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
            + V F   +P + +GKIL+++LR
Sbjct: 513 IKRVFFVETVPKSPSGKILRKDLR 536


>ACSF2_MOUSE RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 615

 Score =  242 bits (618), Expect = 5e-66
 Identities = 173/536 (32%), Positives = 270/536 (50%), Gaps = 35/536 (6%)

Query: 8   LEDGARNRPERDAIVF--GDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           L+  A+  P+R+A+V    ++RLN+A +    ++ A+ L+S G+R GD++ +  PN   +
Sbjct: 78  LDATAQRFPDREALVILHENIRLNFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAW 137

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL-------------FAFTGTPEL 112
             +     +AG ++V +N      E+EY LR  G K +                   PEL
Sbjct: 138 VLIQLATAQAGIILVSVNPAYQSSELEYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPEL 197

Query: 113 PLGERAWQAFQEVAECELYIDLPAAAGATTS-----AIPGAETFWAALNGQPGEFESVRT 167
              +      + + +    I + A    T       A  G E   A L      +     
Sbjct: 198 EKAQPGALKSERLPDLTTVISVDAPLPGTLLLDDIVAAGGKEQNLAQLR-----YNQRFL 252

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP--LFHI 225
              D   I +TSGTTG PKGA L+H N++ N++           + +    VLP  L+H 
Sbjct: 253 SCYDPINIQFTSGTTGNPKGATLSHHNIVNNSMLIGQRLKMPTKTAEELRLVLPSPLYHC 312

Query: 226 FGQTTMMNAALYRHGTMVLM-PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDI 284
            G       ++    T++L  P F+G +AL  + +EK T+  G PTM+  +LN Q D   
Sbjct: 313 LGSVGGTMVSMMHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILN-QPDFSS 371

Query: 285 KQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPKR--KAKP 341
              + ++   V  G+  P E+ R +  K  + E++  YG +E SPV   N P+   + K 
Sbjct: 372 YDFT-SIRGGVIAGSPAPPELIRAIINKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKA 430

Query: 342 GSIGLPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVM-RDGWFR 399
           GS+G  +   E ++V+     +     PGE+ +RG+CVM+GY   P+   + + +D W+R
Sbjct: 431 GSVGRIMPHTEAQIVNVETGELTNLNVPGELYIRGYCVMQGYWGEPQKTFETVGQDKWYR 490

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDIA  DE+GF  I+ RSKDMIIRGG N+YP E+E+  + HPQV  A VVGV  +  GE
Sbjct: 491 TGDIALMDEQGFCKIVGRSKDMIIRGGENIYPAELEDFFLKHPQVQEAQVVGVKDERMGE 550

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           EI A +    G T T +E+ A+ K +++ +K PR + F    P+T +GKI K +LR
Sbjct: 551 EICACIRLKSGETTTAEEIKAFCKGKISHFKIPRYIVFVEGYPLTISGKIQKFKLR 606


>CAIC_SHIFL RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  242 bits (617), Expect = 6e-66
 Identities = 165/501 (32%), Positives = 252/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR G+KVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGNKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E E+ L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESEWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV++TV+P FHI  Q T          T VL+ ++         +K + T
Sbjct: 207 --WQCALRDDDVYMTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPSDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO7I RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  241 bits (616), Expect = 8e-66
 Identities = 168/502 (33%), Positives = 253/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           I   +P M   L+      N Q  H ++++   L+        L A+      E+FG+ +
Sbjct: 265 ITECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSAQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++  DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFADRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO5E RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  241 bits (616), Expect = 8e-66
 Identities = 166/501 (33%), Positives = 252/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDTFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  + ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYDAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ IDR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO57 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  241 bits (616), Expect = 8e-66
 Identities = 166/501 (33%), Positives = 252/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDTFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  + ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYDAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ IDR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOLC RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  240 bits (613), Expect = 2e-65
 Identities = 166/502 (33%), Positives = 253/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LCEESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           +   +P M   L+      N Q  H ++++   L+        L  +      E+FG+ +
Sbjct: 265 VTECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRPLPAGEIGEICIKGIP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOL6 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  240 bits (612), Expect = 2e-65
 Identities = 167/502 (33%), Positives = 253/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLTDMVLPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           I   +P M   L+      N Q  H ++++   L+        L  +      E+F + +
Sbjct: 265 ITECIPMMIRTLMVQPLSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFSVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOL5 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  240 bits (612), Expect = 2e-65
 Identities = 167/502 (33%), Positives = 253/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESTWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLTDMVLPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           I   +P M   L+      N Q  H ++++   L+        L  +      E+F + +
Sbjct: 265 ITECIPMMIRTLMVQPLSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFSVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFCFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECO55 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  240 bits (612), Expect = 2e-65
 Identities = 165/501 (32%), Positives = 251/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPSDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>4CL1_SOLTU RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 545

 Score =  240 bits (612), Expect = 2e-65
 Identities = 168/506 (33%), Positives = 258/506 (50%), Gaps = 37/506 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D    YA V + + +VA  L   GI+  D + +  PN P F F + GA   GA+    N 
Sbjct: 53  DRIYTYAEVELTSRKVAVGLNKLGIQQKDTIMILLPNCPEFVFAFIGASYLGAISTMANP 112

Query: 85  LLTPREIEYHLRDSGAKALFA---FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGAT 141
           L TP E+    + S AK +     F G               +V +  +  DL       
Sbjct: 113 LFTPAEVVKQAKASSAKIVITQACFAG---------------KVKDYAIENDLKVIC--V 155

Query: 142 TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA 201
            S   G   F   +     E   V+ + DDV  + Y+SGTTG PKG  LTH  L+  +VA
Sbjct: 156 DSVPEGCVHFSELIQSDEHEIPDVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVA 214

Query: 202 SSALFDQAP---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLME 258
                + A     S DV + VLPLFHI+   +++  AL     +++M +FD  + L L+ 
Sbjct: 215 QQVDGENANLYMHSDDVLMCVLPLFHIYSLNSVLLCALRVGAAILIMQKFDIAQFLELIP 274

Query: 259 KEKVTIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GI 315
           K KVTI   VP +   +  +    ++D+  +     T +SG A L  E+   V+ KF   
Sbjct: 275 KHKVTIGPFVPPIVLAIAKSPLVDNYDLSSV----RTVMSGAAPLGKELEDAVRAKFPNA 330

Query: 316 EILEGYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGE 370
           ++ +GYG++E  PV++    F       K G+ G  +   EMK+VD +   ++    PGE
Sbjct: 331 KLGQGYGMTEAGPVLAMCLAFAKEPFDIKSGACGTVVRNAEMKIVDPDTGCSLPRNQPGE 390

Query: 371 IAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNV 429
           I +RG  +MKGY N PEA A+ + ++GW  TGDI   D++   FI+DR K++I   G+ V
Sbjct: 391 ICIRGDQIMKGYLNDPEATARTIEKEGWLHTGDIGFIDDDDELFIVDRLKELIKYKGFQV 450

Query: 430 YPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAY 489
            P E+E +L+ HP +S AAVV +  +  GE   AFV+ + G+T+TEDE+  +  +++  Y
Sbjct: 451 APAELEALLINHPDISDAAVVPMIDEQAGEVPVAFVVRSNGSTITEDEVKDFISKQVIFY 510

Query: 490 KYPRIVEFRTELPMTATGKILKRELR 515
           K  + V F   +P + +GKIL+++LR
Sbjct: 511 KRIKRVFFVETVPKSPSGKILRKDLR 536


>CAIC_ECO8A RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  239 bits (611), Expect = 3e-65
 Identities = 165/501 (32%), Positives = 251/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVVNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOHS RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  239 bits (610), Expect = 4e-65
 Identities = 165/501 (32%), Positives = 251/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ESCF3 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  239 bits (609), Expect = 5e-65
 Identities = 163/501 (32%), Positives = 252/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG +K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLVKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   ++LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVELPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPVTLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           +   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 VTECIPMMIRTLMVQPPSVNDRQHHLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPQATARVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++  HP++    VVG+      E IKAFV+  EG  L+E+E   + ++ +A +K P  
Sbjct: 437 ENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGEILSEEEFFNFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKALK 517


>CAIC_ECO24 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (608), Expect = 7e-65
 Identities = 165/501 (32%), Positives = 250/501 (49%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++         +K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOSE RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (607), Expect = 9e-65
 Identities = 165/501 (32%), Positives = 251/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLLTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOLU RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (607), Expect = 9e-65
 Identities = 164/501 (32%), Positives = 251/501 (50%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C + + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDASQLRHICLIDMALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+F + +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHCLREVMFYLN--------LSEQEKDAFCERFSVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGELGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_SHISS RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (606), Expect = 1e-64
 Identities = 163/501 (32%), Positives = 250/501 (49%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+  NL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTTNLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           +   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 VTECIPMMIRTLMAQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD    DEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R +LP   +GKI+++ L+
Sbjct: 497 LEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOLI RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (606), Expect = 1e-64
 Identities = 165/502 (32%), Positives = 252/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LCEESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           +   +P M   L+      N Q  H ++++   L+        L  +      E+FG+ +
Sbjct: 265 VTECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRPLPAGEIGEICIKGIP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEE F++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECODH RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (606), Expect = 1e-64
 Identities = 165/502 (32%), Positives = 252/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LCEESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           +   +P M   L+      N Q  H ++++   L+        L  +      E+FG+ +
Sbjct: 265 VTECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRPLPAGEIGEICIKGIP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEE F++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_ECOBW RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  238 bits (606), Expect = 1e-64
 Identities = 165/502 (32%), Positives = 252/502 (50%), Gaps = 34/502 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LCEESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDDVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLL------NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           +   +P M   L+      N Q  H ++++   L+        L  +      E+FG+ +
Sbjct: 265 VTECIPMMIRTLMVQPPSANDQ-QHRLREVMFYLN--------LSEQEKDAFCERFGVRL 315

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG-- 375
           L  YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G  
Sbjct: 316 LTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFCYEAEIRDDHNRPLPAGEIGEICIKGIP 375

Query: 376 -HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
              + K Y   P+A A+V+  DGW  TGD   RDEE F++ +DR  +MI RGG NV   E
Sbjct: 376 GKTIFKEYFLNPQATAKVLEADGWLHTGDTGYRDEEDFFYFVDRRCNMIKRGGENVSCVE 435

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E ++  HP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P 
Sbjct: 436 LENIIAAHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPS 495

Query: 494 IVEFRTELPMTATGKILKRELR 515
            +E R +LP   +GKI+++ L+
Sbjct: 496 YLEIRKDLPRNCSGKIIRKNLK 517


>CAIC_SALPK RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  236 bits (603), Expect = 3e-64
 Identities = 166/530 (31%), Positives = 261/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAEVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFHSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQGNSTPLNHICLIGEQLPADDGVSLFSQLQARQS--ATLCYTPA------LSTDDAAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWGQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALPA RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  236 bits (603), Expect = 3e-64
 Identities = 166/530 (31%), Positives = 261/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAEVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFHSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQGNSTPLNHICLIGEQLPADDGVSLFSQLQARQS--ATLCYTPA------LSTDDAAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWGQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>ACSF2_MACFA RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 618

 Score =  236 bits (603), Expect = 3e-64
 Identities = 171/539 (31%), Positives = 270/539 (50%), Gaps = 41/539 (7%)

Query: 8   LEDGARNRPERDAIV--FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           LE  A+  PER+A+V    ++RL +A +    ++ A+ L+S G+  GD++ +  PN   +
Sbjct: 81  LEATAQRVPEREALVDLHENIRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAW 140

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
             +     +AG ++V +N      E+EY L+  G KAL         P   +  Q +  +
Sbjct: 141 VLIQLATAQAGIILVSVNPAYQATELEYVLKKVGCKALV-------FPKQFKTQQYYNIL 193

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF--ESVRTEGD------------- 170
            +    ++        +  +P   T  +     PG    + V   G              
Sbjct: 194 KQICPEVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVLAAGSTXXXXXXXXXXXX 253

Query: 171 -----DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA---LFDQAPDSHDVFLTVLPL 222
                D   I +TSGTTG PKGA L+H N++ N+        L ++ P+   + L   PL
Sbjct: 254 FLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSSILGERLKLHEKTPEQLRMILPS-PL 312

Query: 223 FHIFGQTTMMNAALYRHGTMVLM-PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD 281
           +H  G        L    T++L  P F+G +AL  + +E+ +   G PTM+  +LN Q D
Sbjct: 313 YHCLGSVGGTMMCLMYGATLILASPVFNGKKALEAISRERGSFLYGTPTMFVDILN-QPD 371

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPKR--K 338
                IS T+   V  G+  P E+ R +  K  + +++  YG +E SPV   N P+   +
Sbjct: 372 FSSYDIS-TMRGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFANFPEDTVE 430

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTI-EGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDG 396
            K  S+G  +   E ++++     + E   PGE+ +RG+CVM GY   P+   + + +D 
Sbjct: 431 QKAESVGRIMPHTEARIMNMEAGMLAELNTPGELCIRGYCVMLGYWGEPQKTGEAVDQDK 490

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+RTGDIA  +E+GF  I+ RSKDMIIRGG N+YP E+E+   THP+V    VVGV  D 
Sbjct: 491 WYRTGDIATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDR 550

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GEEI A +   +G   T +E+ A+ K +++ +K PR + F T  P+T +GKI K +LR
Sbjct: 551 MGEEICACIRLKDGEETTAEEMKAFCKGKISHFKIPRYIVFVTNYPLTTSGKIQKFKLR 609


>CAIC_SALNS RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  236 bits (602), Expect = 3e-64
 Identities = 166/530 (31%), Positives = 261/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASINEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_PROMH RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 518

 Score =  236 bits (601), Expect = 4e-64
 Identities = 170/526 (32%), Positives = 261/526 (49%), Gaps = 28/526 (5%)

Query: 3   NLSVLLEDGARNRPERDAIVF----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           +L  + +D A    ++ A++F    G +R  +Y+ +N   N+ ANL  + GI+ GD VAL
Sbjct: 8   HLRQMWDDLAEVYDKKTALIFESAQGKVRQFSYSELNEEINRAANLFHACGIKKGDHVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GAV+VP+N      E  + +     +A F  T     P+   
Sbjct: 68  HLDNCPEFFFCWFGLAKIGAVMVPINARFMYEESAWIINH--CQAHFVVTSDNFSPI--- 122

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIP---GAETFWAALNGQPGEFES-VRTEGDDVA 173
               +Q +   + +  L      T + +P   G   F +     P           DD A
Sbjct: 123 ----YQPMLH-DKHSPLTQLFLITENCLPTEQGVVDFLSEKAKHPVTLNHHTPLSVDDTA 177

Query: 174 VIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
            I++TSGTT QPKG  +TH NL F    SS  +  A    D++LTV+P FHI  Q T   
Sbjct: 178 EILFTSGTTSQPKGVVITHYNLRFAGYYSS--WQNALREDDIYLTVMPAFHIDCQCTASL 235

Query: 234 AALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHT 293
            A     T VL+ ++        + K + T+   +P M   L+      D KQ       
Sbjct: 236 PAFSVGATFVLLEKYSARAFWKQILKYQATVTECIPMMMRTLMAQPVSPDEKQHKLR--- 292

Query: 294 AVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEM 353
            V    +L  E      E+F + +L  YG++ET   +  + P  K +  SIG P +  + 
Sbjct: 293 EVMFYLNLADEEKDAFIERFNVRLLTSYGMTETIVGLIGDRPGDKRRWPSIGRPGFCYQA 352

Query: 354 KLVDENFNTIEGEGPGEIAVRGH---CVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEE 409
           ++ D+    +     GEI V+G     + K Y+NRP+A  + +  DGW  TGD   +D+E
Sbjct: 353 QIRDKQNQQVPNGVVGEICVKGEPGKTLFKEYYNRPDATEKALEPDGWLHTGDYGYQDDE 412

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           GF++ +DRS +MI RGG NV   EIE ++ +HP++   AV+GVP D   E IKAFV+  +
Sbjct: 413 GFFYFVDRSCNMIKRGGENVSCIEIENIIASHPKIQDVAVIGVPDDIRDEAIKAFVVLVD 472

Query: 470 GATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           G TL+E+   A+ ++ +A +K P  VEF+  LP   +GK++K+ L+
Sbjct: 473 GETLSEEAFFAFCEQNMAKFKVPSAVEFKQGLPRNCSGKVIKKHLQ 518


>ACSF2_PONAB RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 615

 Score =  235 bits (600), Expect = 6e-64
 Identities = 172/539 (31%), Positives = 270/539 (50%), Gaps = 41/539 (7%)

Query: 8   LEDGARNRPERDAIVF--GDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           L+  A+  PER+A+V    D+RL +  +    ++ A+ L+S G+  GD++ +  PN   +
Sbjct: 78  LDTTAQRVPEREALVVLHEDVRLTFGQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAW 137

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
             +     +AG ++V +N      E+EY L+  G KAL         P   +  Q +  +
Sbjct: 138 VLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALV-------FPKQFKTQQYYNIL 190

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF--------ESVRTEGD------- 170
            +    +D     G  +  +P   T  +     PG           S R   D       
Sbjct: 191 KQICPEVDNAQPGGLKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQ 250

Query: 171 -----DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA---LFDQAPDSHDVFLTVLPL 222
                D   I +TSGTTG PKGA L+H N++ N+        L ++ P+   + L   PL
Sbjct: 251 FLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNMLGERLKLHEKTPEQLRMILPS-PL 309

Query: 223 FHIFGQTTMMNAALYRHGTMVLM-PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD 281
           +H  G        L    T++L  P F+G +AL  + +E+ +   G PTM+  +LN Q D
Sbjct: 310 YHCLGSVGGTMMCLMYGATLILASPVFNGKKALEAISRERGSFLYGTPTMFVDILN-QPD 368

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPKR--K 338
                IS T+   V  G+  P E+ R +  K  + +++  YG  E SPV   + P+   +
Sbjct: 369 FSSYDIS-TMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTPENSPVTFAHFPEDTVE 427

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTI-EGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDG 396
            K  S+G  +   E ++++    T+ E   PGE+ +RG+CVM GY   P+   + + +D 
Sbjct: 428 QKAESVGRIMPHTEARIMNMEAGTLAELNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDK 487

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+RTGD+A  +E+GF  I+ RSKDMIIRGG N+YP E+E+   THP+V    VVGV  D 
Sbjct: 488 WYRTGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDR 547

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GEEI A +   +G   T +E+ A+ K +++ +K PR + F T  P+T +GKI K +LR
Sbjct: 548 MGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPRYIVFVTNYPLTISGKIQKFKLR 606


>4CL1_TOBAC RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 547

 Score =  234 bits (598), Expect = 1e-63
 Identities = 167/503 (33%), Positives = 255/503 (50%), Gaps = 31/503 (6%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D    YA V +   +VA  L   GI+  D + +  PN P F F + GA   GA+    N 
Sbjct: 55  DQIYTYAEVELTCRKVAVGLNKLGIQQKDTIMILLPNSPEFVFAFMGASYLGAISTMANP 114

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
           L TP E+    + S AK +     T    +G+    A +   +  + ID         SA
Sbjct: 115 LFTPAEVVKQAKASSAKIII----TQSCFVGKVKDYASENDVKV-ICID---------SA 160

Query: 145 IPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA 204
             G   F         E   V+ + DDV  + Y+SGTTG PKG  LTH  L+  +VA   
Sbjct: 161 PEGCLHFSELTQSDEHEIPEVKIQPDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQV 219

Query: 205 LFDQAP---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK 261
             + A     S DV + VLPLFHI+   +++   L     +++M +FD    L L++K K
Sbjct: 220 DGENANLYMHSEDVLMCVLPLFHIYSLNSILLCGLRVGAAILIMQKFDIAPFLELIQKYK 279

Query: 262 VTIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEIL 318
           V+I   VP +   +  +     +D+  +     T +SG A L  E+   V+ KF   ++ 
Sbjct: 280 VSIGPFVPPIVLAIAKSPIVDSYDLSSV----RTVMSGAAPLGKELEDAVRTKFPNAKLG 335

Query: 319 EGYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGEIAV 373
           +GYG++E  PV++    F       K G+ G  +   EMK+VD +   ++    PGEI +
Sbjct: 336 QGYGMTEAGPVLAMCLAFAKEPFDIKSGACGTVVRNAEMKIVDPDTGCSLPRNQPGEICI 395

Query: 374 RGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           RG  +MKGY N PEA  + + ++GW  TGDI   DE+   FI+DR K++I   G+ V P 
Sbjct: 396 RGDQIMKGYLNDPEATTRTIDKEGWLHTGDIGFIDEDDELFIVDRLKELIKYKGFQVAPA 455

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           EIE +L+ HP +S AAVV +  +  GE   AFV+ + G+ +TEDE+  +  +++  YK  
Sbjct: 456 EIEALLLNHPNISDAAVVPMKDEQAGEVPVAFVVRSNGSAITEDEVKDFISKQVIFYKRV 515

Query: 493 RIVEFRTELPMTATGKILKRELR 515
           + V F   +P + +GKIL+++LR
Sbjct: 516 KRVFFVETVPKSPSGKILRKDLR 538


>CAIC_SALSV RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  234 bits (597), Expect = 1e-63
 Identities = 165/530 (31%), Positives = 261/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  + GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYALGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALDC RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  234 bits (597), Expect = 1e-63
 Identities = 166/530 (31%), Positives = 261/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLL--VTSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGAT-TSAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTP------VLSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L        +L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YL--------NLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVR---GHCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++   G  + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SHIDS RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  234 bits (596), Expect = 2e-63
 Identities = 163/501 (32%), Positives = 250/501 (49%), Gaps = 32/501 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR GDKVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E  + L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESAWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    +V+LTV+P FHI  Q T          T VL+ ++        ++K + T
Sbjct: 207 --WQCALRDDEVYLTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQVQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P +   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMIIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  +    K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRLGDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVLG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   + ++ +A +K P  
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSY 496

Query: 495 VEFRTELPMTATGKILKRELR 515
           +E R  LP   +GKI+++ L+
Sbjct: 497 LEIRKVLPRNCSGKIIRKNLK 517


>CAIC_SALTI RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  233 bits (595), Expect = 2e-63
 Identities = 165/530 (31%), Positives = 260/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL    GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGMYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYYLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPATPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALPC RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  233 bits (595), Expect = 2e-63
 Identities = 165/530 (31%), Positives = 260/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IHQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + + + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRRYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A  +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAGALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALPB RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  233 bits (595), Expect = 2e-63
 Identities = 160/529 (30%), Positives = 259/529 (48%), Gaps = 35/529 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L             +
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVT---------SAQ 118

Query: 118 AWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVI 175
            +  ++E+ +     ++     G    A  G   F    + Q      +     DD A I
Sbjct: 119 FYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQRQSRQSTTLCYTPALSTDDTAEI 178

Query: 176 IYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           ++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    A
Sbjct: 179 LFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMPA 236

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQT 290
                T VL+ ++        + K + T+   +P M   L+          H ++++   
Sbjct: 237 FSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMFY 296

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   + 
Sbjct: 297 LN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS 348

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARR 406
            E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   +
Sbjct: 349 YEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGYQ 408

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF++
Sbjct: 409 DEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFIV 468

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 469 LNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALEP RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  233 bits (595), Expect = 2e-63
 Identities = 165/530 (31%), Positives = 260/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + K + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L  +      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALCH RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  233 bits (594), Expect = 3e-63
 Identities = 165/530 (31%), Positives = 260/530 (49%), Gaps = 37/530 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSVQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATT-SAIPGAETFWAALNGQPGEFESVRTEGDDVAV 174
             Q         C +   LPA  G +  S +   ++  A L   P          DD A 
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQS--ATLCYTPA------LSTDDTAE 177

Query: 175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           I++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    
Sbjct: 178 ILFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMP 235

Query: 235 ALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQ 289
           A     T VL+ ++        + + + T+   +P M   L+          H ++++  
Sbjct: 236 AFSAGSTFVLLEKYSARAFWDQVRRYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMF 295

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
            L+        L A+      E+FG+ +L  YG++ET   +  + P  K +  SIG   +
Sbjct: 296 YLN--------LSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGF 347

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIAR 405
             E ++ D+    +     GEI ++G     + K Y+ +PEA A  +  +GW  TGD   
Sbjct: 348 SYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAGALEPEGWLHTGDSGY 407

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           +DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF+
Sbjct: 408 QDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFI 467

Query: 466 IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 468 VLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALTY RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  231 bits (590), Expect = 8e-63
 Identities = 165/529 (31%), Positives = 257/529 (48%), Gaps = 35/529 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVI 175
             Q         C +   LPA  G +      A    A L   P          DD A I
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQS-ATLCYTPV------LSTDDTAEI 178

Query: 176 IYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           ++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    A
Sbjct: 179 LFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMPA 236

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQT 290
                T VL+ ++        + K + T+   +P M   L+          H ++++   
Sbjct: 237 FSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMFY 296

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L+        L  +      E+FG+ +L  YG++ET   +  + P  K +  SIG   + 
Sbjct: 297 LN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS 348

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARR 406
            E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   +
Sbjct: 349 YEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAKALEPEGWLHTGDSGYQ 408

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF++
Sbjct: 409 DEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFIV 468

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 469 LNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALHS RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  231 bits (590), Expect = 8e-63
 Identities = 165/529 (31%), Positives = 257/529 (48%), Gaps = 35/529 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L   T     P+   
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLV--TSAQFYPMYRE 125

Query: 118 AWQAFQEVAE--CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVI 175
             Q         C +   LPA  G +      A    A L   P          DD A I
Sbjct: 126 IRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQS-ATLCYTPV------LSTDDTAEI 178

Query: 176 IYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           ++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    A
Sbjct: 179 LFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMPA 236

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQT 290
                T VL+ ++        + K + T+   +P M   L+          H ++++   
Sbjct: 237 FSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMFY 296

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L+        L  +      E+FG+ +L  YG++ET   +  + P  K +  SIG   + 
Sbjct: 297 LN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS 348

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARR 406
            E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   +
Sbjct: 349 YEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAKALEPEGWLHTGDSGYQ 408

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF++
Sbjct: 409 DEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFIV 468

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 469 LNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>CAIC_SALA4 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 517

 Score =  231 bits (590), Expect = 8e-63
 Identities = 159/529 (30%), Positives = 258/529 (48%), Gaps = 35/529 (6%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDM-----RLNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           NL  + +D A    ++ A++F        + +YA +N   N+ ANL  S GIR GD+VAL
Sbjct: 8   NLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNEEINRTANLFYSLGIRKGDRVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GA++VP+N  L   E  + L++S    L             +
Sbjct: 68  HLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWILQNSQVSLLVT---------SAQ 118

Query: 118 AWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVI 175
            +  ++E+ +     ++     G    A  G   F    + Q      +     DD A I
Sbjct: 119 FYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQSRQSTTLCYTPALSTDDTAEI 178

Query: 176 IYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           ++TSGTT +PKG  +TH NL F    S+  +  A    DV++TV+P FHI  Q T    A
Sbjct: 179 LFTSGTTSRPKGVVITHYNLRFAGYYSA--WQIALRDDDVYMTVMPAFHIDCQCTAAMPA 236

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLL-----NAQGDHDIKQISQT 290
                T VL+ ++        + K + T+   +P M   L+          H ++++   
Sbjct: 237 FSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPAAPTDRQHHLREVMFY 296

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L+        L  +      E+FG+ +L  YG++ET   +  + P  K +  SIG   + 
Sbjct: 297 LN--------LSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWPSIGRVGFS 348

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRG---HCVMKGYHNRPEANAQVMR-DGWFRTGDIARR 406
            E ++ D+    +     GEI ++G     + K Y+ +PEA A+ +  +GW  TGD   +
Sbjct: 349 YEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGWLHTGDSGYQ 408

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DE+G+++ +DR  +MI RGG NV   E+E ++  HP++    VVG+      E IKAF++
Sbjct: 409 DEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAIRDEAIKAFIV 468

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EG TL+E E  ++ +  +A +K P  +E RT+LP   +GKI+K+ L+
Sbjct: 469 LNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK 517


>ACSF2_HUMAN RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 615

 Score =  231 bits (590), Expect = 8e-63
 Identities = 170/539 (31%), Positives = 269/539 (49%), Gaps = 41/539 (7%)

Query: 8   LEDGARNRPERDAIVF--GDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           LE  A+  PER+A+V    D+RL +A +    ++ A+ L+S G+  GD++ +  PN   +
Sbjct: 78  LETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAW 137

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
             +     +AG ++V +N      E+EY L+  G KAL         P   +  Q +  +
Sbjct: 138 VLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALV-------FPKQFKTQQYYNVL 190

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF--------ESVRTEGD------- 170
            +    ++        +  +P   T  +     PG           S R   D       
Sbjct: 191 KQICPEVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQ 250

Query: 171 -----DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA---LFDQAPDSHDVFLTVLPL 222
                D   I +TSGTTG PKGA L+H N++ N+        L ++ P+   + L   PL
Sbjct: 251 FLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQLRMILPN-PL 309

Query: 223 FHIFGQTTMMNAALYRHGTMVLM-PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD 281
           +H  G        L    T++L  P F+G +AL  + +E+ T   G PTM+  +LN Q D
Sbjct: 310 YHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERGTFLYGTPTMFVDILN-QPD 368

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPKR--K 338
                IS T+   V  G+  P E+ R +  K  + +++  YG +E SPV   + P+   +
Sbjct: 369 FSSYDIS-TMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAHFPEDTVE 427

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHNRPEANAQVM-RDG 396
            K  S+G  +   E ++++    T+     PGE+ +RG+CVM GY   P+   + + +D 
Sbjct: 428 QKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDK 487

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGD+A  +E+GF  I+ RSKDMIIRGG N+YP E+E+   THP+V    VVGV  D 
Sbjct: 488 WYWTGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDR 547

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GEEI A +   +G   T +E+ A+ K +++ +K P+ + F T  P+T +GKI K +LR
Sbjct: 548 MGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKIQKFKLR 606


>YDAB_BACSU RecName: Full=Putative acyl--CoA ligase ydaB;       
           EC=6.2.1.-;
          Length = 503

 Score =  230 bits (587), Expect = 2e-62
 Identities = 170/518 (32%), Positives = 245/518 (47%), Gaps = 24/518 (4%)

Query: 1   MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACP 60
           M  L  L+     N  E +A+  GD  L Y       NQ+AN ++ +GI+ GD+VAL C 
Sbjct: 1   METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAMLQKGIQKGDRVALLCK 60

Query: 61  NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
           N      V F AL+ GAVVVP++  L P E+   L+ S  KA+F          G    +
Sbjct: 61  NGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF---------YGAEFKE 111

Query: 121 AFQEVAE--CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYT 178
              EV      L + +       TSA      F A   G     E+     DD A++++T
Sbjct: 112 ILDEVLPELSSLCVTMETGTAYETSA-----EFEALFAGPDHLPETEMVSPDDTALLMFT 166

Query: 179 SGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
           SGTTG PK   +TH  +      S++   +       FL   P++H      +M    + 
Sbjct: 167 SGTTGNPKRCMITHGGIYRYVKKSNSSIARMKGLR--FLACHPIYHTSALICIM-LGTFA 223

Query: 239 HGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             T V     D    L ++E+EK+     +P  Y  LL A   H     S  +   ++GG
Sbjct: 224 ETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWEKHQTDLSSLVI--LMTGG 281

Query: 299 ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDE 358
             +P+ +  +  +  GI +  GYG +E   + ++                        D 
Sbjct: 282 TKVPSSLISRYLD-IGIPLAHGYGSTEAWGISTWTPDMGMDXXXXXXXXXXXXXXXXEDP 340

Query: 359 NFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDR 417
                  +G  GEI V    + KGY + PEA A+V+++GWFRTGD    DE+GF FI  R
Sbjct: 341 LTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFRTGDSGYVDEDGFIFITGR 400

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
            KD+II GG NVYP ++EEV+   P +   AVVG+P   +GE+ KAF++   G  +TE++
Sbjct: 401 YKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPKAFIVKNGGQRITEED 460

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +IA+ KERL+AYK P  VEF  ELP    GK+ K  LR
Sbjct: 461 VIAFCKERLSAYKIPE-VEFVNELPKNNLGKVKKDVLR 497


>CAIC_PROSL RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 518

 Score =  229 bits (585), Expect = 3e-62
 Identities = 167/526 (31%), Positives = 261/526 (49%), Gaps = 28/526 (5%)

Query: 3   NLSVLLEDGARNRPERDAIVF----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVAL 57
           +L  + +D A    ++ A++F    G +R  +Y+ +N   N+ ANL  + GI+ GD VAL
Sbjct: 8   HLRQMWDDLAEVYDKKTALIFESAQGKVRQFSYSELNEEINRAANLFHACGIKKGDHVAL 67

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGER 117
              N P F F +FG  K GAV+VP+N      E  + +     +A F  T     P+   
Sbjct: 68  HLDNCPEFFFCWFGLAKIGAVMVPINARFMYEESAWIINH--CQAHFVVTSDNFSPI--- 122

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIP---GAETFWAALNGQPGEFES-VRTEGDDVA 173
               +Q +   + +  L      T + +P   G   F +     P           DD A
Sbjct: 123 ----YQPMLH-DKHSPLTQLFLITENCLPTEQGVVDFLSEKAKHPVTLNHHTPLSVDDTA 177

Query: 174 VIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
            I++TSGTT QPKG  +TH NL      SS  +  A    D++LTV+P FHI  Q T   
Sbjct: 178 EILFTSGTTSQPKGVVITHYNLRIAGYYSS--WQNALREDDIYLTVMPAFHIDCQCTASL 235

Query: 234 AALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHT 293
            A     T+VL+ ++    +   + K + T+   +P M    +      D KQ    L  
Sbjct: 236 PAYSVGATIVLLEKYSARASWKQILKYQATVTECIPMMMRTSMAQPVSPDEKQ--HKLRE 293

Query: 294 AVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEM 353
            +S       E    + E+  + +L  +G++ET   +  + P  K +  SIG P +  + 
Sbjct: 294 VMSYLNLADKEKDASI-ERLNVRLLTSHGMTETIVGLIGDRPGDKRRWPSIGRPGFCYQA 352

Query: 354 KLVDENFNTIEGEGPGEIAVRGHC---VMKGYHNRPEANAQVMR-DGWFRTGDIARRDEE 409
           ++ D+    +     GEI V+G     + K Y+NRP+A  + +  DGW  TGD   RD+E
Sbjct: 353 QIRDKQNQQVPNGVVGEICVKGEAGKTLFKEYYNRPDATEKALEPDGWLHTGDYGYRDDE 412

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           GF++ +DRS +MI RGG NV   EIE ++ +HP++   AV+GVP D   E IKAFV+  +
Sbjct: 413 GFFYFVDRSCNMIKRGGENVSCIEIENIIASHPKIQDVAVIGVPDDIRDEAIKAFVVLVD 472

Query: 470 GATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           G TL+E+   A+ ++ +A +K P  VEF+  LP   +GK++K+ L+
Sbjct: 473 GETLSEEAFFAFCEQNMAKFKVPSAVEFKQGLPRNCSGKVIKKHLQ 518


>MENE_BACLD RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 478

 Score =  229 bits (583), Expect = 5e-62
 Identities = 165/508 (32%), Positives = 245/508 (48%), Gaps = 39/508 (7%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           L+  A   P+R A++ GD +L +  +   A + A  L S G++ GD  AL   N      
Sbjct: 9   LKQRAELTPDRMAVIQGDHKLTFIQLFHEAKKTAGRLKSFGLKNGDTAALLLTNRMEMVI 68

Query: 68  VYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAE 127
                   G  +V LN  L+  E  Y +  S AK L       E   G +  +A      
Sbjct: 69  AVHACFLLGVRIVLLNTKLSMAERSYQIEHSEAKLLLTEKPFIEEHRGGQPARA------ 122

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
               +D+     A    +               E ES+    DD A I+YTSGTTG+PKG
Sbjct: 123 ----VDIEDVQNAACPPVT--------------EIESIHL--DDAATIMYTSGTTGRPKG 162

Query: 188 AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR 247
              T  N  F+AV+S+   +     HD +L  LPLFHI G + +  + +Y   T+VL  R
Sbjct: 163 VMQTFANHYFSAVSSA--LNLGLQEHDRWLIALPLFHISGLSALFKSVIYGM-TVVLHQR 219

Query: 248 FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR 307
           FD +E L  ++ ++VTI + V TM    L A+ D     +                E  R
Sbjct: 220 FDAEEVLRSIKDQQVTIASVVQTML-SRLAAKVDRCPGSLRCXXXXXXXXXXXXXEECKR 278

Query: 308 KVKEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGE 366
           K      + +++ YG++ET   ++   P+    K GS G P++   +K+         GE
Sbjct: 279 K-----RLPVVQSYGMTETCSQIATLAPEYSIEKLGSAGKPLFASSIKIEKNGTECQPGE 333

Query: 367 GPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
             GEI V+G  VMKGY     AN     DGWF+TGDI   D++GF +++DR  D+II GG
Sbjct: 334 H-GEITVKGPTVMKGYLKNEAANKDSFNDGWFKTGDIGYFDDDGFLYVLDRRSDLIISGG 392

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERL 486
            N+YP E+E VL++HP V+ A V GV   T G+   A+++    + + E+EL  + KERL
Sbjct: 393 ENIYPAEVEAVLLSHPNVAEAGVKGVDDKTWGKVPHAYLV--ADSPVDEEELSEFCKERL 450

Query: 487 AAYKYPRIVEFRTELPMTATGKILKREL 514
           A+YK P+   F   LP  A+ K+++ +L
Sbjct: 451 ASYKVPKAFHFVDRLPRNASNKLMRHKL 478


>ACSF2_BOVIN RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 615

 Score =  228 bits (582), Expect = 7e-62
 Identities = 170/539 (31%), Positives = 262/539 (48%), Gaps = 41/539 (7%)

Query: 8   LEDGARNRPERDAIVFG--DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           L+  A+  P+++A+V    ++RL +A +    ++ A+ L+S G+R GD++ +  PN   +
Sbjct: 78  LDATAQRVPDQEALVVHHENIRLTFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAW 137

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
             +     +AG ++V +N      E+EY L+  G KAL         P   +  Q +  +
Sbjct: 138 VLMQLATAQAGIILVSVNPAYQAMELEYALKKVGCKALV-------FPKQFKTQQYYNIL 190

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF--ESVRTEGD------------- 170
            +    ++        +  +P   T  +     PG    + V   G              
Sbjct: 191 KQICPEVEKAQPGALKSQRLPDLTTVISVDAHLPGTLLLDEVVAAGSQEQNLTRLRHTQQ 250

Query: 171 -----DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA---LFDQAPDSHDVFLTVLPL 222
                D   I +TSGTTG PKGA L+H N++ NA        L  + P+   V L   PL
Sbjct: 251 FLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNANMIGQRLRLHQKTPEESRVVLPS-PL 309

Query: 223 FHIFGQTTMMNAALYRHGTMVLM-PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD 281
           +H  G       +L    T++L  P F+G + L  + +E+     G PTM+  +LN Q D
Sbjct: 310 YHCLGSVGGTMVSLMHGVTLILCSPVFEGKKTLEAISRERGCFLYGTPTMFVDVLN-QPD 368

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPV--VSFNNPKRK 338
                IS T+   V  G+  P E+ R +  K  + E++  YG +E SPV  ++F     +
Sbjct: 369 FSSYDIS-TMRGGVIAGSPAPPELIRAIINKLNMKELVVAYGTTENSPVTFMNFTEDTVE 427

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI-AVRGHCVMKGYHNRPEANAQVM-RDG 396
            K  S+G  +   E ++V                 +RG+CVM GY   P+   + + +D 
Sbjct: 428 QKAESVGRVMPHTEAQIVXXXXXXXXXXXXXXXXCIRGYCVMLGYWGEPQKTEEAIGQDK 487

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+RTGDIA  DE+GF  I+ RSKDMIIRGG N+YP E+E+   THPQV    VVGV  D 
Sbjct: 488 WYRTGDIAMMDEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPQVQEVQVVGVKDDR 547

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GEEI A +   EG   T +E+ A+ K +++ +K PR + F T  P+T +GKI K +LR
Sbjct: 548 MGEEICACIRLKEGEKTTAEEIKAFCKGKISHFKIPRYIVFVTNYPLTVSGKIQKFKLR 606


>4CLL6_ARATH RecName: Full=4-coumarate--CoA ligase-like 6;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           7;         Short=At4CL7;
          Length = 566

 Score =  228 bits (580), Expect = 1e-61
 Identities = 154/492 (31%), Positives = 256/492 (52%), Gaps = 28/492 (5%)

Query: 35  MIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYH 94
           M+ +  A +    G+R GD V+L  PN  YFP ++   +  GA+V  +N   +  EI+  
Sbjct: 81  MVQSMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSSSLGEIKKQ 140

Query: 95  LRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
           + +       AFT T  +   E+               D  +              F++ 
Sbjct: 141 VSECSVG--LAFTSTENV---EKLXXXXXXXXXXXXXYDFDSIRIENPK-------FYSI 188

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNA---VASSALFDQAPD 211
           +    G       + DDVA I+Y+SGTTG  KG  LTH NL+ +    V   A   + P 
Sbjct: 189 MKESFGFVPKPLIKQDDVAAIMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYEYPG 248

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTM 271
           S +V+L  LPL HI+G +  +   L    T+V+M RFD  + ++++E+ K+T F  VP M
Sbjct: 249 SSNVYLAALPLCHIYGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPM 308

Query: 272 YWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-----GIEILEGYGLSET 326
              L   +      ++ ++L    SG A L    +RK  E F      +++++GYG++E+
Sbjct: 309 LMALTK-KAKGVCGEVFKSLKQVSSGAAPL----SRKFIEDFLQTLPHVDLIQGYGMTES 363

Query: 327 SPVVSFN-NPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHN 384
           + V +   N ++ ++  S+GL    ++ K+VD +  +    G  GE+ ++G  VMKGY N
Sbjct: 364 TAVGTRGFNSEKLSRYSSVGLLAPNMQAKVVDWSSGSFLPPGNRGELWIQGPGVMKGYLN 423

Query: 385 RPEANAQ-VMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQ 443
            P+A    ++ D W RTGDIA  DE+G+ FI+DR K++I   G+ + P ++E VL++HP 
Sbjct: 424 NPKATQMSIVEDSWLRTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVSHPL 483

Query: 444 VSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPM 503
           +  AAV   P++  GE   AFV+  +  TL+E+++I++   ++A Y+  R V     +P 
Sbjct: 484 IIDAAVTAAPNEECGEIPVAFVVRRQETTLSEEDVISYVASQVAPYRKVRKVVMVNSIPK 543

Query: 504 TATGKILKRELR 515
           + TGKIL++EL+
Sbjct: 544 SPTGKILRKELK 555


>4CL2_TOBAC RecName: Full=4-coumarate--CoA ligase 2;       
           Short=4CL 2;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 2;
          Length = 542

 Score =  227 bits (578), Expect = 2e-61
 Identities = 161/499 (32%), Positives = 254/499 (50%), Gaps = 33/499 (6%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           YA V + + +VA  L  +GI+P D + +  PN P F F + GA   GA+    N L TP 
Sbjct: 55  YADVELNSRKVAAGLHKQGIQPKDTIMILLPNSPEFVFAFIGASYLGAISTMANPLFTPA 114

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE 149
           E+    + S AK +     T    + +    AF+   +  + ID         SA  G  
Sbjct: 115 EVVKQAKASSAKIIV----TQACHVNKVKDYAFENDVKI-ICID---------SAPEGCL 160

Query: 150 TFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQA 209
            F         +   V  + DDV  + Y+SGTTG PKG  LTH  L+ +   +  +  + 
Sbjct: 161 HFSVLTQANEHDIPEVEIQPDDVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQQVDGEN 218

Query: 210 PD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIF 265
           P+    S DV L VLPLFHI+   +++   L     +++M +FD    L L+++ KVTI 
Sbjct: 219 PNLYIHSEDVMLCVLPLFHIYSLNSVLLCGLRVGAAILIMQKFDIVSFLELIQRYKVTIG 278

Query: 266 AGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYG 322
             VP +   +  +    D+D+  +     T +SG A L  E+   V+ KF   ++ +GYG
Sbjct: 279 PFVPPIVLAIAKSPMVDDYDLSSV----RTVMSGAAPLGKELEDTVRAKFPNAKLGQGYG 334

Query: 323 LSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHC 377
           ++E  PV++    F     + K G+ G  +   EMK+VD +  N++     GEI +RG  
Sbjct: 335 MTEAGPVLAMCLAFAKEPFEIKSGACGTVVRNAEMKIVDPKTGNSLPRNQSGEICIRGDQ 394

Query: 378 VMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEE 436
           +MKGY N PEA A+ + ++GW               FI+DR K++I   G+ V P E+E 
Sbjct: 395 IMKGYLNDPEATARTIDKEGWLXXXXXXXXXXXXELFIVDRLKELIKYKGFQVAPAELEA 454

Query: 437 VLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVE 496
           +L+ HP +S AAVV +  +  GE   AFV+ + G+T+TEDE+  +  +++  YK  + V 
Sbjct: 455 LLLNHPNISDAAVVPMKDEQAGEVPVAFVVRSNGSTITEDEVKDFISKQVIFYKRIKRVF 514

Query: 497 FRTELPMTATGKILKRELR 515
           F   +P + +GKIL+++LR
Sbjct: 515 FVDAIPKSPSGKILRKDLR 533


>MENE_BACP2 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 486

 Score =  226 bits (576), Expect = 3e-61
 Identities = 166/505 (32%), Positives = 241/505 (47%), Gaps = 48/505 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           PER A+++ D +  +  +    N+++N L    ++ G+ V L   N P    +       
Sbjct: 16  PERVALIYQDKKWTFRDLADEVNELSNRLAQTSLKKGEAVGLLMNNHPQMVMLVHACFSL 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           G  +V LN  LT  E  + L D  A ALF                A     E  +Y    
Sbjct: 76  GFKIVLLNNKLTKAERRFQLEDVKAAALFT-----------EPVYASDHKGELPVY---- 120

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD----DVAVIIYTSGTTGQPKGAQLT 191
                T   +P A           G+    + E D      A I+YTSGTTG+PKG + T
Sbjct: 121 -----TMETLPEA-----------GQENVKKIENDFDLNQTATIMYTSGTTGRPKGVEQT 164

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGD 251
             N   +AV+S+       D  D +L  LPLFHI G + +  + +Y   T+VL  +FD D
Sbjct: 165 FGNHFHSAVSSALNMGLRED--DRWLIALPLFHISGLSALFKSVIYGM-TVVLHQKFDVD 221

Query: 252 EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
           E +  +E+ +VT+ + V TM   LL+      +++   +L             + ++ KE
Sbjct: 222 EVIGSIEQHRVTMISVVQTMLSRLLSR-----LEECPSSLRCXXXXXXXXXXXMLQESKE 276

Query: 312 KFGIEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
           K G  + + YG++ET S +V+        K GS G P++G E+K+ D        E  GE
Sbjct: 277 K-GFPVFQSYGMTETCSQIVTLAPEFSVEKLGSAGKPLFGCELKIQDGTRICRPFEH-GE 334

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           I V+G  VMKGY  R E+ A     GW +TGDI   DEEGF F++DR  D+II GG N+Y
Sbjct: 335 IMVKGANVMKGYLYREESTAAAFDQGWLKTGDIGYVDEEGFLFVLDRRSDLIISGGENIY 394

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P EIE VL+TH  V  A V G+  D  GE   AF++      + E+EL A  +  LA YK
Sbjct: 395 PAEIEAVLLTHSHVKEAGVTGIDDDRWGEVPAAFLVTDH--KIPENELYALCESHLAKYK 452

Query: 491 YPRIVEFRTELPMTATGKILKRELR 515
           +P    F  ELP  A+ K+ +  L+
Sbjct: 453 WPASFHFVDELPRNASNKLQRHRLK 477


>MENE_GEOSW RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  226 bits (575), Expect = 4e-61
 Identities = 159/501 (31%), Positives = 253/501 (50%), Gaps = 37/501 (7%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           PER A+  G  +  +  ++    + A  L + G+R GD VA+   N              
Sbjct: 17  PERIAVYDGQGKKTFMELHESVMKRARQLANTGVRKGDIVAIFMKNSVAMIECIHALHYI 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GA+V+  N  LT  E+ + L+DSGA  + A     +  L +R     + +   EL     
Sbjct: 77  GAIVLLQNTRLTSHELAWQLKDSGAVYVIA-----DDELADRIEGNIRVITMSEL----- 126

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195
                  SA+P              EF+      DD+A I+YTSGTTG+PKG   T+ N 
Sbjct: 127 -------SALPEENV----------EFQQYY-HFDDIATIMYTSGTTGKPKGVLQTYENH 168

Query: 196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS 255
            ++A+ S+   +   + +D +L  +P FHI G + MM + +Y   +M +M  FD  +A  
Sbjct: 169 WWSAIGSA--LNLGLNENDCWLAAVPFFHISGLSIMMRSVIYGM-SMYVMRAFDAKKANE 225

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
           L+   KVTI + V  M   ++   G+    +  + +            EV +      GI
Sbjct: 226 LIIGGKVTIMSVVSAMLQKMIADLGERRYPETFRCMXXXXXXXXXXXXEVCKAK----GI 281

Query: 316 EILEGYGLSETSPVVSFNNPKRK-AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR 374
            + + YG++ET+  ++   P+    K GS G P++  +++ ++++        PGEI V+
Sbjct: 282 PVYQTYGMTETASQIATLAPEYSLTKLGSAGKPLFPSQLR-IEKDGQVARPYEPGEIVVK 340

Query: 375 GHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
           G  V KGY +RP+A A+ +R GWF TGDI   DE+GF +++DR  D+II GG NVYP EI
Sbjct: 341 GPNVTKGYLHRPDATAKAIRGGWFYTGDIGYIDEDGFLYVLDRRSDLIISGGENVYPAEI 400

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E VL++H  V  A V G+  +T G+   AFV    G ++T ++L  + +  LA YK P+ 
Sbjct: 401 EAVLLSHEAVEEAGVTGIDDETWGQVPCAFVKRKRGYSVTVEQLKQFCQAHLAKYKIPKQ 460

Query: 495 VEFRTELPMTATGKILKRELR 515
           + F  ELP  A+ K+L+ +L+
Sbjct: 461 IYFVDELPRNASQKLLRHQLK 481


>4CLL5_ARATH RecName: Full=4-coumarate--CoA ligase-like 5;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           9;         Short=At4CL9;
          Length = 546

 Score =  226 bits (575), Expect = 4e-61
 Identities = 149/480 (31%), Positives = 244/480 (50%), Gaps = 18/480 (3%)

Query: 40  VANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSG 99
           VA+ L   GIR G  V L  PN   FP V    +  GA++   N L T  EI   ++DS 
Sbjct: 70  VADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNEIAKQIKDSN 129

Query: 100 AKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQP 159
              + AFT +  LP    A +    V   E  +D          ++         +  +P
Sbjct: 130 P--VLAFTTSQLLPKISAAAKKLPIVLMDEERVD----------SVGDVRRLVEMMKKEP 177

Query: 160 -GEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLT 218
            G     R + DD A ++Y+SGTTG  KG   +H NL+         F  + D    F+ 
Sbjct: 178 SGNRVKERVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFG-SDDGEQRFIC 236

Query: 219 VLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNA 278
            +P+FHI+G        L    T++++ +F+  E +S + K + T    VP +   ++N 
Sbjct: 237 TVPMFHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNG 296

Query: 279 QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG-IEILEGYGLSETSPV-VSFNNPK 336
                 K    ++HT + GGA L  EV     EK+  ++IL+GYGL+E++ +  S +  +
Sbjct: 297 ADQIKAKYDLSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVE 356

Query: 337 RKAKPGSIGLPIWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHNRPEANAQVM-R 394
              + G+ G     +E ++VD     I G +  GE+ ++G  +MKGY +  EA +  +  
Sbjct: 357 ESRRYGTAGKLSASMEGRIVDPVTGQILGPKQTGELWLKGPSIMKGYFSNEEATSSTLDS 416

Query: 395 DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPH 454
           +GW RTGD+   DE+GF F++DR K++I   GY V P E+E +L+THP+++ AAV+  P 
Sbjct: 417 EGWLRTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDAAVIPFPD 476

Query: 455 DTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              G+   A+V+   G++L+E  ++ +  +++A YK  R V F + +P   +GKIL+++L
Sbjct: 477 KEVGQFPMAYVVRKTGSSLSEKTIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGKILRKDL 536


>4CL_VANPL RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
                   EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA
           synthase;
          Length = 553

 Score =  224 bits (571), Expect = 1e-60
 Identities = 157/503 (31%), Positives = 251/503 (49%), Gaps = 30/503 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D    YA V +I+ +V + L   GI+ GD + +  PN P F F + GA   G++    N 
Sbjct: 54  DEIFTYADVELISRRVGSGLSKLGIKQGDTIMILLPNSPEFVFAFLGASFIGSISTMANP 113

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
             T  E+    + S AK +            +  +    +   CE  + + +        
Sbjct: 114 FFTSTEVIKQAKASNAKLIIT----------QGCYVDKVKDYACENGVKIISIXXXXXXX 163

Query: 145 IPGAETFWAALNG-QPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                  ++ L G    E   V    D V  + Y+SGTTG PKG  LTH  L+ +   + 
Sbjct: 164 XXXNILHFSELTGADENEMPKVEISPDGVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQ 221

Query: 204 ALFDQAPD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEK 259
            +  + P+    S DV L VLPLFHI+   +++   L     +++M +F+    L L++K
Sbjct: 222 QVDGENPNLYMHSDDVLLCVLPLFHIYSLNSVLLCGLRAGSGILIMQKFEIVPFLELIQK 281

Query: 260 EKVTIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIE 316
            KVTI   VP +   +  +    ++D+  +     T +SG A L  E+   V+ KF   +
Sbjct: 282 YKVTIGPFVPPIVLAIAKSTVVDNYDLSSV----RTVMSGAAPLGKELEDAVRAKFPNAK 337

Query: 317 ILEGYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEI 371
           + +GYG++E  PV++    F       K G+ G  +   EMK+VD E  +++    PGEI
Sbjct: 338 LGQGYGMTEAGPVLAMCLAFAKEPFDIKSGACGTVVRNAEMKIVDPETGSSLPRNHPGEI 397

Query: 372 AVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
            +RG  +MKGY N PEA A+ + ++GW  TGDI   D++   FI+DR K++I   G+ V 
Sbjct: 398 CIRGDQIMKGYLNDPEATARTIDKEGWLHTGDIGYIDDDDELFIVDRLKELIKYKGFQVA 457

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P E+E +L+THP +S AAVV +  +  GE   AFV+ + G  +TEDE+  +  +++  YK
Sbjct: 458 PAELEALLLTHPCISDAAVVPMKDEAAGEVPVAFVVKSNGHNITEDEIKQFISKQVIFYK 517

Query: 491 YPRIVEFRTELPMTATGKILKRE 513
               V F   +P   +GKIL+++
Sbjct: 518 RINRVFFVEAIPKAPSGKILRKD 540


>FADK_ECOLI RecName: Full=Short-chain-fatty-acid--CoA ligase;       
            EC=6.2.1.-;AltName: Full=Acyl-CoA synthetase;
          Length = 548

 Score =  224 bits (570), Expect = 2e-60
 Identities = 161/510 (31%), Positives = 258/510 (50%), Gaps = 17/510 (3%)

Query: 12  ARNRPERDAIVFGD-MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           AR  P++ A+V        Y+ ++  A+ +AN ++++GI  GD++A   P    F  +Y 
Sbjct: 34  ARAMPDKIAVVDNHGASYTYSALDHAASCLANWMLAKGIESGDRIAFQLPGWCEFTVIYL 93

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECEL 130
             LK GAV VPL       E+ + L    AK  FA T   +    +              
Sbjct: 94  ACLKIGAVSVPLLPSWREAELVWVLNKCQAKMFFAPTLFKQTRPVDXXXXXXXXXXXXXX 153

Query: 131 YIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQL 190
            + +   A AT+S      +    +        ++ T GD++A +++TSGT G PKG  L
Sbjct: 154 XVGVDKLAPATSSL-----SLSQIIADNTSLTTAITTHGDELAAVLFTSGTEGLPKGVML 208

Query: 191 THTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDG 250
           TH N+L +  A  A  +      DVF+   PL H  G    + A        VL+  F  
Sbjct: 209 THNNILASERAYCARLNLT--WQDVFMMPAPLGHATGFLHGVTAPFLIGARSVLLDIFTP 266

Query: 251 DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVK 310
           D  L+L+E+++ T   G     + LLN             L   + GG ++P +VAR+ +
Sbjct: 267 DACLALLEQQRCTCMLGATPFVYDLLNVLEKQPADL--SALRFFLCGGTTIPKKVARECQ 324

Query: 311 EKFGIEILEGYGLSETSP--VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGP 368
           ++ GI++L  YG +E+SP  VV+ ++P  +      G    GVE+K+VD+   T+     
Sbjct: 325 QR-GIKLLSVYGSTESSPHAVVNLDDPLSRFMHTD-GYAAAGVEIKVVDDARKTLPPGCE 382

Query: 369 GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGY 427
           GE A RG  V  GY + PE  A+ +  +GW+ +GD+ R DE G+  I  R KD+I+RGG 
Sbjct: 383 GEEASRGPNVFMGYFDEPELTARALDEEGWYYSGDLCRMDEAGYIKITGRKKDIIVRGGE 442

Query: 428 NVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI-PAEGATLTEDELIA-WAKER 485
           N+  RE+E++L+ HP++  A VV +  +  GE   A+V+  A   +L+ +E++A ++++R
Sbjct: 443 NISSREVEDILLQHPKIHDACVVAMSDERLGERSCAYVVLKAPHHSLSLEEVVAFFSRKR 502

Query: 486 LAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +A YKYP  +    +LP T +GKI K  LR
Sbjct: 503 VAKYKYPEHIVVIEKLPRTTSGKIQKFLLR 532


>4CL2_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 544

 Score =  224 bits (570), Expect = 2e-60
 Identities = 161/500 (32%), Positives = 245/500 (49%), Gaps = 35/500 (7%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           Y+ V +++ +VA+ L   GI+ GD + L  PN P + F + GA   GA+    N   T  
Sbjct: 56  YSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSPEYFFAFLGASYRGAISTMANPFFTSA 115

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE 149
           E+   L+ S AK +                    +    +   D  A        I  A 
Sbjct: 116 EVIKQLKASLAKLIIT------------------QACYVDKVKDYAAEKNIQIICIDDAP 157

Query: 150 T----FWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSAL 205
                F   +     E   V  + DDV  + Y+SGTTG PKG  LTH  L+  +VA    
Sbjct: 158 QDCLHFSKLMEADESEMPEVVIDSDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVD 216

Query: 206 FDQAP---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKV 262
            D       S DV + +LPLFHI+    ++   L    T+++M +FD    L L++K KV
Sbjct: 217 GDNPNLYMHSEDVMICILPLFHIYSLNAVLCCGLRAGVTILIMQKFDIVPFLELIQKYKV 276

Query: 263 TIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGY 321
           TI   VP +   +  A+     K    ++ T +SG A L  E+   V+ KF   ++ +GY
Sbjct: 277 TIGPFVPPIVLAI--AKSPVVDKYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGY 334

Query: 322 GLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGEIAVRGH 376
           G++E  PV++    F     + K G+ G  +   EMK+VD   N ++     GEI +RG 
Sbjct: 335 GMTEAGPVLAMCLAFAKEPYEIKSGACGTVVRNAEMKIVDPETNASLPRNQRGEICIRGD 394

Query: 377 CVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIE 435
            +MKGY N PE+    +  +GW  TGDI   D++   FI+DR K++I   G+ V P E+E
Sbjct: 395 QIMKGYLNDPESTRTTIDEEGWLHTGDIGFIDDDDELFIVDRLKEIIKYKGFQVAPAELE 454

Query: 436 EVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIV 495
            +L+THP +S AAVV +  +  GE   AFV+   G T TE+E+  +  +++  YK    V
Sbjct: 455 ALLLTHPTISDAAVVPMIDEKAGEVPVAFVVRTNGFTTTEEEIKQFVSKQVVFYKRIFRV 514

Query: 496 EFRTELPMTATGKILKRELR 515
            F   +P + +GKIL+++LR
Sbjct: 515 FFVDAIPKSPSGKILRKDLR 534


>4CL1_PETCR RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 544

 Score =  224 bits (570), Expect = 2e-60
 Identities = 161/500 (32%), Positives = 244/500 (48%), Gaps = 35/500 (7%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           Y+ V +++ +VA+ L   GI+ GD + L  PN P + F + GA   GA+    N   T  
Sbjct: 56  YSQVELLSRKVASGLNKLGIQQGDTIMLLLPNSPEYFFAFLGASYRGAISTMANPFFTSA 115

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE 149
           E+   L+ S AK +                    +    +   D  A        I  A 
Sbjct: 116 EVIKQLKASQAKLIIT------------------QACYVDKVKDYAAEKNIQIICIDDAP 157

Query: 150 T----FWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSAL 205
                F   +     E   V    DDV  + Y+SGTTG PKG  LTH  L+  +VA    
Sbjct: 158 QDCLHFSKLMEADESEMPEVVINSDDVVALPYSSGTTGLPKGVMLTHKGLV-TSVAQQVD 216

Query: 206 FDQAP---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKV 262
            D       S DV + +LPLFHI+    ++   L    T+++M +FD    L L++K KV
Sbjct: 217 GDNPNLYMHSEDVMICILPLFHIYSLNAVLCCGLRAGVTILIMQKFDIVPFLELIQKYKV 276

Query: 263 TIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGY 321
           TI   VP +   +  A+     K    ++ T +SG A L  E+   V+ KF   ++ +GY
Sbjct: 277 TIGPFVPPIVLAI--AKSPVVDKYDLSSVRTVMSGAAPLGKELEDAVRAKFPNAKLGQGY 334

Query: 322 GLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGEIAVRGH 376
           G++E  PV++    F     + K G+ G  +   EMK+VD   N ++     GEI +RG 
Sbjct: 335 GMTEAGPVLAMCLAFAKEPYEIKSGACGTVVRNAEMKIVDPETNASLPRNQRGEICIRGD 394

Query: 377 CVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIE 435
            +MKGY N PE+    +  +GW  TGDI   D++   FI+DR K++I   G+ V P E+E
Sbjct: 395 QIMKGYLNDPESTRTTIDEEGWLHTGDIGFIDDDDELFIVDRLKEIIKYKGFQVAPAELE 454

Query: 436 EVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIV 495
            +L+THP +S AAVV +  +  GE   AFV+   G T TE+E+  +  +++  YK    V
Sbjct: 455 ALLLTHPTISDAAVVPMIDEKAGEVPVAFVVRTNGFTTTEEEIKQFVSKQVVFYKRIFRV 514

Query: 496 EFRTELPMTATGKILKRELR 515
            F   +P + +GKIL+++LR
Sbjct: 515 FFVDAIPKSPSGKILRKDLR 534


>4CLL1_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 1;       
           EC=6.2.1.-;
          Length = 552

 Score =  223 bits (567), Expect = 4e-60
 Identities = 149/475 (31%), Positives = 239/475 (50%), Gaps = 21/475 (4%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G+RPGD V L  PN   +P  +F     GAV   +N   TPREI   + D+ AK +   +
Sbjct: 82  GVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDYTPREIAKQVSDARAKLVITIS 141

Query: 108 GTPELPLGERAWQAFQEVAECELYIDLPAAAGAT--TSAIPGAETFWAALNGQPGEFESV 165
                  G R                       T  T+ + G +           ++   
Sbjct: 142 ALVPKIAGLRLPVIXXXXXXXXXXXXXXXXXTVTLYTNLVAGVKE---------ADYRRP 192

Query: 166 RTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHI 225
             +  D A ++Y+SGTTG  KG  LTH N +  A   ++  D+  +  +VFL  LP+FHI
Sbjct: 193 PIKQSDTAALLYSSGTTGDSKGVILTHRNFIAAARMVTSDQDERREGPNVFLCFLPMFHI 252

Query: 226 FGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLN--AQGDHD 283
           FG + +  A L+R   ++ M RFD +  +  +++ +VT    VP +   L      G +D
Sbjct: 253 FGLSVITYAQLHRGNAIIAMSRFDINSLMEAVQRHRVTHLFCVPPVIIALAKHGKAGKYD 312

Query: 284 IKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNNPKR--KAK 340
           +     +L    SG A L  +V   V +KF   EI++GYG++ET  ++S   P++    +
Sbjct: 313 LS----SLKFIGSGAAPLGKDVMEVVAKKFPDSEIVQGYGMTETCGIISLEYPEKGQARE 368

Query: 341 PGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFR 399
            GS G  + GVE K+VD +    +     GEI VRG  VM+GY N  +A    ++ GW  
Sbjct: 369 FGSTGTLVSGVEAKIVDIKTLKHLPPNQVGEICVRGPNVMQGYFNNVQATEFTIKQGWLH 428

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGD+   D  G  F++DR K++I   G+ + P E+E +L++HP++  A V+  P    GE
Sbjct: 429 TGDLGYFDGGGQLFVVDRLKELIKYKGFQIAPAELEGLLLSHPEILDAVVIPFPDAKAGE 488

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              A+V+ +  ++LTE ++  + ++++A YK  + V F   +P +A+GKIL+R+L
Sbjct: 489 VPIAYVVRSPDSSLTEVDVQKFIEKQVAYYKRLKRVTFVGSVPKSASGKILRRQL 543


>ACSF2_DANRE RecName: Full=Acyl-CoA synthetase family member 2,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 606

 Score =  218 bits (555), Expect = 9e-59
 Identities = 160/483 (33%), Positives = 235/483 (48%), Gaps = 38/483 (7%)

Query: 60  PNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAW 119
           PN+  +  + F   KAG ++V +N     +E+E+ LR     A+   T        +   
Sbjct: 126 PNIYEWVLMQFATAKAGIILVAVNPAYQLQEVEFALRKVQCNAVVCPTKFKSQHYCDMLK 185

Query: 120 QAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF--ESVRTEG-------- 169
           Q   E+       +  +  G  +S +P   T     + QPG F  + +   G        
Sbjct: 186 QLCPEM-------ETASPGGIKSSRLPDLHTVIVTDSQQPGSFLLKDLMQAGSSQHYQQL 238

Query: 170 ---------DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVL 220
                    DD   I +TSGTTG+PKGA L+H N++ NA  +          +      +
Sbjct: 239 QDLQKKLVCDDPINIQFTSGTTGKPKGATLSHHNIVNNAYFTGMRIGYNWRKNVRICLPV 298

Query: 221 PLFHIFGQTTMMNAALYRHGTMVLMPR--FDGDEALSLMEKEKVTIFAGVPTMYWGLLNA 278
           PL+H FG        +  +GT V+ P   +DG   L  +EKEK T   G PTMY  +L  
Sbjct: 299 PLYHCFGSVGG-GVIMALYGTTVIFPSTGYDGRANLRAIEKEKCTFVYGTPTMYIDML-- 355

Query: 279 QGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSFNNPK 336
            G  D+ +    ++   ++ G+  P EV RK+    GI E++ GYG +E SPV     P 
Sbjct: 356 -GQPDLAKFDLSSVRGGIAAGSPCPPEVMRKILNVMGIKEMVIGYGTTENSPVTFCGFPV 414

Query: 337 RKA--KPGSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQ-V 392
             A  K  ++G      E K+VD     I   G  GE+ +RG+CVM  Y    E   + +
Sbjct: 415 DSAERKIVTVGCISPHTEAKVVDPTTGEIVPLGAQGELMIRGYCVMLEYWQDEEKTRECI 474

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
            +D W++TGDIA  D+  +  I  R KD+IIRGG N+YP EIE+ L THP++  A VVGV
Sbjct: 475 TKDRWYKTGDIASLDQFAYCKIEGRIKDLIIRGGENIYPAEIEQFLHTHPKILEAQVVGV 534

Query: 453 PHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKR 512
             +  GEE+ A +   EG   T +E+ A+ K ++A YK PR + F  + P+T TGKI K 
Sbjct: 535 KDERMGEEVCACIRLKEGQECTVEEIKAYCKGKIAHYKVPRYILFVQDYPLTITGKIQKH 594

Query: 513 ELR 515
           +LR
Sbjct: 595 KLR 597


>MENE_GEOKA RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 490

 Score =  217 bits (553), Expect = 2e-58
 Identities = 168/503 (33%), Positives = 236/503 (46%), Gaps = 41/503 (8%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           PER A+  G     +A +              G++ GD VAL   N      +       
Sbjct: 16  PERIAVSDGRRTKTFAELYEXXXXXXXXXXXXGVKEGDIVALLMKNRIEMIEIIHALFFL 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GA V+  NV LT  E+ + L DSGA+   A                  E     L  D  
Sbjct: 76  GARVLLQNVRLTSYELGWQLDDSGARLAIA-----------------DEELAGSLDGDGR 118

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
                  +A+P  +              S++   D  +VA I+YTSGTTG PKG   T+ 
Sbjct: 119 VLTVGAVAALPEVDV-------------SLKETCDLEEVATIMYTSGTTGTPKGVLQTYG 165

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N  ++AV S+   +      D +L  +PLFHI G +  M + +Y    M L   FD  EA
Sbjct: 166 NHWWSAVGSA--LNLGLHERDCWLAAVPLFHISGLSIAMRSVIYGM-PMRLQTSFDPKEA 222

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              + +  VTI + V  M   ++   G+    +   T                   KEK 
Sbjct: 223 NEWIMRGDVTIMSVVAAMLQRMVAELGE---ARYPDTFRCMXXXXXXXXXXXXEACKEK- 278

Query: 314 GIEILEGYGLSETSPVVSFNNPKRK-AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ET+  ++   P+    K GS G P++  E+ ++ +       E  GEI 
Sbjct: 279 GIPVYQTYGMTETASQIATLAPEYSLTKLGSAGKPLFPAELCILKDGKPAAPHEA-GEIV 337

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V KGY  RPEA AQ +R GWF TGDI   DE+GF +++DR  D+II GG NVYP 
Sbjct: 338 VKGPNVTKGYWQRPEATAQAIRGGWFFTGDIGYLDEDGFLYVLDRRSDLIISGGENVYPA 397

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           E+E VL++HP V  A V GV ++T G+   AFV    GA+  E  L A+ +ERLA YK P
Sbjct: 398 EVEAVLLSHPDVEEAGVTGVENETWGQVPYAFVRLKRGASPDEAALRAFCRERLAKYKVP 457

Query: 493 RIVEFRTELPMTATGKILKRELR 515
             + F  ELP  A  K+L+REL+
Sbjct: 458 ARIYFVDELPRNAAQKLLRRELK 480


>CAIC_SHIF8 RecName: Full=Probable crotonobetaine/carnitine-CoA
           ligase;         EC=6.2.1.-;
          Length = 510

 Score =  217 bits (552), Expect = 2e-58
 Identities = 160/494 (32%), Positives = 238/494 (48%), Gaps = 32/494 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           R +Y  +N   N+ ANL  + GIR G+KVAL   N P F F +FG  K GA++VP+N  L
Sbjct: 37  RYSYLELNQEINRTANLFYTLGIRKGNKVALHLDNCPEFIFCWFGLAKIGAIMVPINARL 96

Query: 87  TPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYIDLPAAAGATTSA 144
              E E+ L++S  +A    T     P+ ++  Q  A Q    C   + LPA  G ++  
Sbjct: 97  LREESEWILQNS--QACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSS-- 152

Query: 145 IPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
                 F    N QP     +     DD A I++TSGTT +PKG  +TH NL F    S+
Sbjct: 153 ------FTQLKNQQPATLCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSA 206

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
             +  A    DV++TV+P FHI  Q T          T VL+ ++         +K + T
Sbjct: 207 --WQCALRDDDVYMTVMPAFHIDCQCTXXXXXXXXXXTFVLVEKYSARAFWGQAQKYRAT 264

Query: 264 IFAGVPTMYWGLLNA-----QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
           I   +P M   L+          H ++++   L+        L  +      E+FG+ +L
Sbjct: 265 ITECIPMMIRTLMVQPPSANDRQHRLREVMFYLN--------LSEQEKDAFCERFGVRLL 316

Query: 319 EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG--- 375
             YG++ET   +  + P  K +  SIG   +  E ++ D++   +     GEI ++G   
Sbjct: 317 TSYGMTETIVGIIGDRPSDKRRWPSIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPG 376

Query: 376 HCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
             + K Y   P+A A+V+  DGW  TGD   RDEEGF++ +DR  +MI RGG NV   E+
Sbjct: 377 KTIFKEYFLNPKATAKVLEADGWLHTGDTGYRDEEGFFYFVDRRCNMIKRGGENVSCVEL 436

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E ++ THP++    VVG+      E IKAFV+  EG TL+E+E   +  +     K P I
Sbjct: 437 ENIIATHPKIQDIVVVGIKDSIRDEAIKAFVVLNEGETLSEEEFFRFCDKIWRNLKCPLI 496

Query: 495 VEFRTELPMTATGK 508
                   + A GK
Sbjct: 497 WRSEKICHVIARGK 510


>4CLL2_ARATH RecName: Full=4-coumarate--CoA ligase-like 2;       
           EC=6.2.1.-;
          Length = 565

 Score =  216 bits (550), Expect = 4e-58
 Identities = 154/510 (30%), Positives = 249/510 (48%), Gaps = 18/510 (3%)

Query: 14  NRPERDAIVFGDM----RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVY 69
           ++P R   VF D     RL++  + +   +VA  L + G+R G+ V +  PN   FP V 
Sbjct: 57  SQPHRGKTVFVDAVTGRRLSFPELWLGVERVAGCLYALGVRKGNVVIILSPNSILFPIVS 116

Query: 70  FGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECE 129
              +  GA++   N + T  EI   + DS  + + AFT    +     A      V   +
Sbjct: 117 LSVMSLGAIITTANPINTSDEISKQIGDS--RPVLAFTTCKLVSKLAAASNFNLPVVLMD 174

Query: 130 LYIDLPAAAGATTSAIPGAETFWAALNGQPGEFE-SVRTEGDDVAVIIYTSGTTGQPKGA 188
            Y     + G     +   ET    +  +P E     R   DD A ++Y+SGTTG  KG 
Sbjct: 175 DYHVPSQSYGDRVKLVGRLETM---IETEPSESRVKQRVNQDDTAALLYSSGTTGTSKGV 231

Query: 189 QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF 248
            L+H NL+    A  A F     +    +  +P+ HIFG        +    T+V++P+F
Sbjct: 232 MLSHRNLIALVQAYRARFGLEQRT----ICTIPMCHIFGFGGFATGLIALGWTIVVLPKF 287

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARK 308
           D  + LS +E  + +  + VP +   ++N   + + K    +LHT V+GGA L  EV  K
Sbjct: 288 DMAKLLSAVETHRSSYLSLVPPIVVAMVNGANEINSKYDLSSLHTVVAGGAPLSREVTEK 347

Query: 309 VKEKFG-IEILEGYGLSETSPVV-SFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGE 366
             E +  ++IL+GYGL+E++ +  S  N +   + G+ GL    VE K+VD +   + G 
Sbjct: 348 FVENYPKVKILQGYGLTESTAIAASMFNKEETKRYGASGLLAPNVEGKIVDPDTGRVLGV 407

Query: 367 GP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIR 424
              GE+ +R   VMKGY    EA A  +  +GW +TGD+   D +GF F++DR K++I  
Sbjct: 408 NQTGELWIRSPTVMKGYFKNKEATASTIDSEGWLKTGDLCYIDGDGFVFVVDRLKELIKC 467

Query: 425 GGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKE 484
            GY V              ++ AAV+ +P    G+   A+++   G+ L+E E++ +  +
Sbjct: 468 NGYQVXXXXXXXXXXXXXXIADAAVIPIPDMKAGQYPMAYIVRKVGSNLSESEIMGFVAK 527

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKREL 514
           +++ YK  R V F   +P   +GKIL+REL
Sbjct: 528 QVSPYKKIRKVTFLASIPKNPSGKILRREL 557


>4CLL3_ARATH RecName: Full=4-coumarate--CoA ligase-like 3;       
           EC=6.2.1.-;
          Length = 552

 Score =  216 bits (549), Expect = 5e-58
 Identities = 156/512 (30%), Positives = 246/512 (48%), Gaps = 24/512 (4%)

Query: 14  NRPERDAIVFGDM----RLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFV 68
           ++P+R    F D     RL ++ +  + ++VA+ L    GIR GD V +  PN  Y P V
Sbjct: 46  SQPQRGTTAFIDASTGHRLTFSDLWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVV 105

Query: 69  YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAEC 128
               +  GAVV   N L T  EI   +  S    +F  T +   P    A        E 
Sbjct: 106 CLSVMSLGAVVTTANTLNTSGEISKQIAQSNPTLVF--TTSQLAPKLAAAISVVLTDEED 163

Query: 129 ELYIDLPAAAGAT--TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
           E  ++L +        S +   ET         G+    R   DD A+++Y+SGTTG  K
Sbjct: 164 EKRVELTSGVRVVGILSEMMKKET--------SGQRVRDRVNQDDTAMMLYSSGTTGTSK 215

Query: 187 GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
           G   +H NL       +   D      ++F+  +P+FH FG       ++    T+V++ 
Sbjct: 216 GVISSHRNL---TAYVAKYIDDKWKRDEIFVCTVPMFHSFGLLAFAMGSVASGSTVVILR 272

Query: 247 RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVA 306
           RF  D+ +  +EK K TI +  P +   ++N       K    +L     GGA L  EV 
Sbjct: 273 RFGLDDMMQAVEKYKATILSLAPPVLVAMINGADQLKAKYDLTSLRKVRCGGAPLSKEVM 332

Query: 307 RKVKEKFG-IEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
               EK+  + I +GY L+E+     S  + +   K G++GL   G+E ++VD +   + 
Sbjct: 333 DSFLEKYPTVNIFQGYALTESHGSGASTESVEESLKYGAVGLLSSGIEARIVDPDTGRVM 392

Query: 365 GEG-PGEIAVRGHCVMKGYHNRPEA-NAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMI 422
           G   PGE+ ++G  + KGY    EA N  +  +GW + GD+   DE+GF F++DR K++I
Sbjct: 393 GVNQPGELWLKGPSISKGYFGNEEATNETINLEGWLKLGDLCYIDEDGFLFVVDRLKELI 452

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWA 482
              GY V P E+E +L+ HP +  AAV+  P    G+   A+V     + L+E E+I + 
Sbjct: 453 KYKGYQVPPAELEALLIAHPHILDAAVIPFPDREAGQYPMAYVARKPESNLSEKEVIDFI 512

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             ++A YK  R V F + +P TA+GK L+++L
Sbjct: 513 SNQVAPYKKIRKVAFISSIPKTASGKTLRKDL 544


>4CL2_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 2;       
            Short=4CL 2;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 2;
          Length = 551

 Score =  215 bits (548), Expect = 6e-58
 Identities = 160/514 (31%), Positives = 266/514 (51%), Gaps = 14/514 (2%)

Query: 13  RNRPERDAIVFGDMRLNYA--LVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           R++P++  +V G     Y+   V     +VA  L    I+ GD + +  PN+P +  ++ 
Sbjct: 34  RSKPDQVLLVDGLTFKEYSSHFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH 93

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGE--RAWQAFQEVAEC 128
           G L  G +   +N   T  E+ + L     + L       E    +  R + + ++V   
Sbjct: 94  GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAVTLAVYEKIKNDLKRVFPSVEKVILV 153

Query: 129 ELYIDLPAAAGATTSAIPG-AETFWAALNGQPGEFESVRTE-GDDVAVIIYTSGTTGQPK 186
           ++        G  T +  G   +F   +N    ++  VR +   D A+I ++SGTTG  K
Sbjct: 154 DIAGQTLKEIGQLTLSSDGIVMSFNQLINNNGKDYPIVRIDLKKDTAIIPFSSGTTGLFK 213

Query: 187 GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
           G  L+H NL+ N   +  +       +D  +  LP FHI+G  T +   + +   +V++P
Sbjct: 214 GVCLSHHNLVSNTHQTQTVETTNYKKNDTVMGQLPFFHIYGLMTYLILMVKQGHCVVILP 273

Query: 247 RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVA 306
           +F+    L L++K KV I   VP +   ++ A+     K    +L T  SG A L  EV 
Sbjct: 274 KFEFVRFLDLIQKYKVAISFIVPPI--AIMFAKSPIVDKFDLSSLRTLFSGAAPLSREVE 331

Query: 307 RKVKEKFGIEIL--EGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
             +KE+F  +++  +GYG +E SP   F  P    K GS G+ +    +K++        
Sbjct: 332 DLIKERFKGKLIIKQGYGATELSPAC-FVIPSGLIKSGSAGILLPNQLVKIISPETGENL 390

Query: 365 GEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMI 422
           G G  GEI ++G  VM GY+N  +A  +V+ +DG+F+TGDI   DE+G+YFI+DRSK++I
Sbjct: 391 GMGEKGEICIKGPNVMLGYYNNEKATNEVIDKDGFFKTGDIGYVDEDGYYFIVDRSKELI 450

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWA 482
              G+ V P E+E +L++HP+V+ A VVG+     GE  + FV+  +  +LTE EL+ WA
Sbjct: 451 KCKGFQVPPAELEALLLSHPKVADACVVGLSKGDMGEVPRGFVVIKQNESLTEKELLDWA 510

Query: 483 KERLAAYKYPR-IVEFRTELPMTATGKILKRELR 515
             ++A YK+ R  + F   +P +ATGK+L++ L+
Sbjct: 511 HPKIANYKHFRGGIFFIPAIPKSATGKLLRKNLK 544


>4CLL8_ARATH RecName: Full=4-coumarate--CoA ligase-like 8;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           11;         Short=At4CL11;
          Length = 550

 Score =  214 bits (546), Expect = 1e-57
 Identities = 154/496 (31%), Positives = 242/496 (48%), Gaps = 21/496 (4%)

Query: 25  DMRLNYALVNMIANQVAN-LLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           D R++++ + M  ++VA+ LL   GIR GD V +  PN    P V    +  GAV+   N
Sbjct: 62  DHRISFSDLWMAVDRVADCLLHDVGIRRGDVVLVLSPNTISIPIVCLSVMSLGAVLTTAN 121

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELP--LGERAWQAFQEVAECELYIDLPAAAGAT 141
            L T  EI   + DS  K  F    TPEL   +         E  E  L +         
Sbjct: 122 PLNTASEILRQIADSNPKLAFT---TPELAPKIASSGISIVLERVEDTLRVPRGLKVVGN 178

Query: 142 TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA 201
            + +   E    A+  Q           DD A+++Y+SGTTG+ KG   +H NL+ +   
Sbjct: 179 LTEMMKKEPSGQAVRNQ--------VHKDDTAMLLYSSGTTGRSKGVNSSHGNLIAHVAR 230

Query: 202 SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK 261
             A   + P     F+  +PLFH FG    + A L    T+V++PRFD  E ++ +EK +
Sbjct: 231 YIAEPFEQPQQ--TFICTVPLFHTFGLLNFVLATLALGTTVVILPRFDLGEMMAAVEKYR 288

Query: 262 VTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG-IEILEG 320
            T    VP +   ++N       K     L T   GGA L  EV +   +K+  +++ +G
Sbjct: 289 ATTLILVPPVLVTMINKADQIMKKYDVSFLRTVRCGGAPLSKEVTQGFMKKYPTVDVYQG 348

Query: 321 YGLSETSPV-VSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEG-EGPGEIAVRGHCV 378
           Y L+E++    S  + +   + G++GL   GVE ++VD N   + G    GE+ ++G  +
Sbjct: 349 YALTESNGAGASIESVEESRRYGAVGLLSCGVEARIVDPNTGQVMGLNQTGELWLKGPSI 408

Query: 379 MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVL 438
            KGY    E    +  +GW +TGD+   D +GF FI+DR K++I   GY V P E+E +L
Sbjct: 409 AKGYFRNEEEI--ITSEGWLKTGDLCYIDNDGFLFIVDRLKELIKYKGYQVPPAELEALL 466

Query: 439 MTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFR 498
           + HP +  AAV+  P    G+   A+V     + L E ++I +  +++A YK  R V F 
Sbjct: 467 LNHPDILDAAVIPFPDKEAGQFPMAYVARKPESNLCEKKVIDFISKQVAPYKKIRKVAFI 526

Query: 499 TELPMTATGKILKREL 514
             +P T +GK L+++L
Sbjct: 527 DSIPKTPSGKTLRKDL 542


>4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           6;         Short=At4CL6;
          Length = 544

 Score =  214 bits (544), Expect = 2e-57
 Identities = 152/512 (29%), Positives = 249/512 (48%), Gaps = 29/512 (5%)

Query: 16  PERDAIVFGDM--RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           P + AI   D    L ++ +     ++A+     GIR  D V +  PN   FP  +    
Sbjct: 41  PSKLAIADSDTGDSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSYQFPLCFLAVT 100

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYID 133
             G V    N L T  E+   ++DS  K + +              Q F ++   +L + 
Sbjct: 101 AIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVN------------QLFDKIKGFDLPVV 148

Query: 134 LPAAAGATTSAIPGAETFWAA------LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
           L  +   T    PG+ +   +      L+    E+  V  +  D A ++Y+SGTTG  KG
Sbjct: 149 LLGSKD-TVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSGTTGTSKG 207

Query: 188 AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR 247
            +LTH N +  ++  +   D   + H VFL  LP+FH+FG   +  + L R   +V M R
Sbjct: 208 VELTHGNFIAASLMVTMDQDLMGEYHGVFLCFLPMFHVFGLAVITYSQLQRGNALVSMAR 267

Query: 248 FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEV 305
           F+ +  L  +EK +VT    VP ++  L         D+  +      A   G  L  E 
Sbjct: 268 FELELVLKNIEKFRVTHLWVVPPVFLALSKQSIVKKFDLSSLKYIGSGAAPLGKDLMEEC 327

Query: 306 ARKVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVD-ENFNTI 363
            R +     + +++GYG++ET  +VS  +P+  K   GS G+   GVE ++V  E   + 
Sbjct: 328 GRNIPN---VLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQ 384

Query: 364 EGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMI 422
                GEI VRG  +MKGY N P+A  + + +  W  TGD+   +E+G  +++DR K++I
Sbjct: 385 PPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKELI 444

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWA 482
              G+ V P E+E +L++HP +  A V+  P +  GE   AFV+ +  +++TE ++  + 
Sbjct: 445 KYKGFQVAPAELEGLLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKFI 504

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +++A YK  R V F + +P +A GKIL+REL
Sbjct: 505 AKQVAPYKRLRRVSFISLVPKSAAGKILRREL 536


>4CL1_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 1;       
            Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 551

 Score =  213 bits (543), Expect = 2e-57
 Identities = 160/519 (30%), Positives = 262/519 (50%), Gaps = 24/519 (4%)

Query: 13  RNRPERDAIVFGDMRLNYA--LVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           R++P++  +V G     Y+   V     +VA  L    I+ GD + +  PN+P +  ++ 
Sbjct: 34  RSKPDQVLLVDGLTFKEYSSHFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH 93

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECEL 130
           G L  G +   +N   T  E+ + L     + L        L + E+     + V     
Sbjct: 94  GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAV-----TLAVYEKIKNDLKRVFPSVE 148

Query: 131 YIDLPAAAGATTSAIPGAE--------TFWAALNGQPGEFESVRTEGD-DVAVIIYTSGT 181
            + L   AG T   I            +F   +N    ++  VR +   D A+I ++SGT
Sbjct: 149 KVILVDIAGQTLKEIDQLTLSSDGIVMSFNQLINNNGKDYPIVRIDPKKDTAIIPFSSGT 208

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
           TG  KG  L+H N++ N   +  +       +D  + +LP FHI+G    +   + +   
Sbjct: 209 TGLFKGVCLSHHNIVSNTYQTQTIETSTYKKNDTVMGILPFFHIYGLMLFLMLMVKQGHR 268

Query: 242 MVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
           +V++P+F+    L L++K KV I   VP +   ++ A+     K    +L T  SG A L
Sbjct: 269 VVVLPKFEPVRFLELIQKYKVAISFIVPPV--AIMFAKSPIVDKFDLSSLRTLFSGAAPL 326

Query: 302 PAEVARKVKEKFG--IEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDEN 359
            +EV   +KE+F   + I +GYG +E SP   F  P    K GS G+ +     K++   
Sbjct: 327 SSEVEDLIKERFKGRLVIKQGYGATELSPAC-FVIPSGLVKSGSAGILLPNQLAKIISPE 385

Query: 360 FNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDR 417
                G G  GEI ++G  VM GY+N  +A  +V+ +DG+ +TGDI   DE+G+YFI+DR
Sbjct: 386 TGENLGMGEKGEICIKGPNVMLGYYNNEKATNEVIDKDGFLKTGDIGYVDEDGYYFIVDR 445

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
           SK++I   G+ V P E+E +L++HP+V+ A VVG+     GE  + FV+  +  +LTE E
Sbjct: 446 SKELIKCKGFQVPPAELEALLLSHPKVADACVVGLSKGDMGEVPRGFVVIKQNESLTEKE 505

Query: 478 LIAWAKERLAAYKYPR-IVEFRTELPMTATGKILKRELR 515
           L+ WA  ++A YK+ R  + F   +P +ATGK+L++ L+
Sbjct: 506 LLDWAHPKIANYKHFRGGIFFIPAIPKSATGKLLRKNLK 544


>MENE_BACC7 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  213 bits (541), Expect = 4e-57
 Identities = 156/496 (31%), Positives = 244/496 (49%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 16  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYV 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F          D+P
Sbjct: 76  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFDAK-------DIP 115

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEG--DDVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E   ++   IIYTSGTTG+PKG  LT+ 
Sbjct: 116 VYS------------FAEVMNG-PKEEASIQEEFSLEEAMTIIYTSGTTGKPKGVILTYG 162

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 163 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 219

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G    +    +L   + GG   P  +     EK 
Sbjct: 220 HKALQTRGVTIISVVSKMLTDLLERLG---AETYPSSLRCMLLGGGPAPKPILETCVEK- 275

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++   ++ ++++   +     GEI 
Sbjct: 276 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCRLR-IEKDGVVVPAFTEGEIV 334

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 335 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 394

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E+I + +E+LA YK P
Sbjct: 395 QIEEVLLSHPAVAEAGVVGMTDDKWGQVPAAFVV--KSGEVTEEEIIHFCEEKLAKYKVP 452

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 453 KKACFLEELPRNASKK 468


>4CLL4_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 4;       
           EC=6.2.1.-;
          Length = 552

 Score =  212 bits (540), Expect = 5e-57
 Identities = 148/471 (31%), Positives = 239/471 (50%), Gaps = 17/471 (3%)

Query: 49  IRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTG 108
           +R G    +  PN  +FP     A+  GAV+   N L TP EI   + D  A+ + AFT 
Sbjct: 86  LRKGHVALILSPNSVHFPVAALAAMSLGAVLTTANPLNTPAEIAKQVAD--ARPVLAFTT 143

Query: 109 TPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTE 168
              LP   RA      + E      LP    ++   I       +A    P   +  R  
Sbjct: 144 RELLPKLPRAHDLRVVLLES---ARLP--GDSSDPRIVATIEEISATTPDPARRKD-RVT 197

Query: 169 GDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFD-QAPDSHDVFLTVLPLFHIFG 227
            DD A ++Y+SGTTG  KG   TH +L+         F  +  D  + FL  +P+FH++G
Sbjct: 198 QDDPATLLYSSGTTGPSKGVVATHRSLISMVQIIMTRFRLEGSDKTETFLCTVPMFHVYG 257

Query: 228 QTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQI 287
                   L    T+V++ +++  E L  +    VT    VP +   ++       + Q+
Sbjct: 258 LVAFATGLLGCGATVVVLSKYELPEMLRSINAYGVTYLPLVPPILVAMVAHPKPLPLGQM 317

Query: 288 SQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETSPV-VSFNNPKRKAKPGSIG 345
            + L    SGGA L  E+    +EK+  +EIL+GYGL+E++ +  S ++ +   + G+ G
Sbjct: 318 RKVL----SGGAPLGKELIEGFREKYPQVEILQGYGLTESTAIGASTDSAEESRRYGTAG 373

Query: 346 LPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMR-DGWFRTGDI 403
           L     E K+VD ++   +     GE+ +RG  VMKGY    EA    +  DGW +TGD+
Sbjct: 374 LLSPNTEAKIVDPDSGEALPVNRTGELWIRGPYVMKGYFKNAEATQSTLTPDGWLKTGDL 433

Query: 404 ARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKA 463
              DE+G+ F++DR K++I   GY V P E+E +L+THP+V+  AV+  P    G+   A
Sbjct: 434 CYIDEDGYLFVVDRLKELIKYKGYQVPPAELEALLLTHPEVTDVAVIPFPDREVGQFPMA 493

Query: 464 FVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           +++  +G+ L+E E++ +  +++A YK  R V F T++P  A+GKIL+++L
Sbjct: 494 YIVRKKGSNLSEREVMEFVAKQVAPYKKVRKVAFVTDIPKNASGKILRKDL 544


>4CLL4_ARATH RecName: Full=4-coumarate--CoA ligase-like 4;       
           EC=6.2.1.-;
          Length = 550

 Score =  212 bits (540), Expect = 5e-57
 Identities = 157/523 (30%), Positives = 251/523 (47%), Gaps = 26/523 (4%)

Query: 3   NLSVLLEDGARNRPERDAIVFGDMR----LNYALVNMIANQVANLLVSR-GIRPGDKVAL 57
           NLS  +     ++P R    F D      L ++ +    ++VA+ L    GIR GD V +
Sbjct: 35  NLSRDVTTFISSQPHRGKTAFIDAATGQCLTFSDLWRAVDRVADCLYHEVGIRRGDVVLI 94

Query: 58  ACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTG-TPELPLGE 116
             PN  + P V    +  GAV    N L T  EI   + DS    +F      P+LP+  
Sbjct: 95  LSPNSIFIPVVCLSVMSLGAVFTTANTLNTSGEISKQIADSNPTLVFTTRQLAPKLPVAI 154

Query: 117 RAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQP-GEFESVRTEGDDVAVI 175
                   + + E+Y +L       TSAI         +  +P G+    R   DD A++
Sbjct: 155 SV-----VLTDDEVYQEL-------TSAIRVVGILSEMVKKEPSGQRVRDRVNQDDTAMM 202

Query: 176 IYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           +Y+SGTTG  KG   +H NL  +    +          D+F+  +P+FH +G  T     
Sbjct: 203 LYSSGTTGPSKGVISSHRNLTAHV---ARFISDNLKRDDIFICTVPMFHTYGLLTFAMGT 259

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
           +    T+V++ RF   + +  +EK + T           ++N       K    +L T  
Sbjct: 260 VALGSTVVILRRFQLHDMMDAVEKHRATXXXXXXXXXXXMINDADLIKAKYDLSSLKTVR 319

Query: 296 SGGASLPAEVARKVKEKFG-IEILEGYGLSETSPVVSFNNPKRKAKP-GSIGLPIWGVEM 353
            GGA L  EV     EK+  ++IL+GY L+E++   +F N   +++  G+ G     VE 
Sbjct: 320 CGGAPLSKEVTEGFLEKYPTVDILQGYALTESNGGGAFTNSAEESRRYGTAGTLTSDVEA 379

Query: 354 KLVDENFNTIEG-EGPGEIAVRGHCVMKGYHNRPEA-NAQVMRDGWFRTGDIARRDEEGF 411
           ++VD N     G    GE+ ++G  + KGY    EA N  +  +GW +TGD+   DE+GF
Sbjct: 380 RIVDPNTGRFMGINQTGELWLKGPSISKGYFKNQEATNETINLEGWLKTGDLCYIDEDGF 439

Query: 412 YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA 471
            F++DR K++I   GY V P E+E +L+THP +  AAV+  P    G+   A+V+    +
Sbjct: 440 LFVVDRLKELIKYKGYQVPPAELEALLITHPDILDAAVIPFPDKEAGQYPMAYVVRKHES 499

Query: 472 TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            L+E ++I +  +++A YK  R V F   +P TA+GK L+++L
Sbjct: 500 NLSEKQVIDFISKQVAPYKKIRKVSFINSIPKTASGKTLRKDL 542


>FAT2_SCHPO RecName: Full=Putative peroxisomal-coenzyme A
           synthetase;         EC=6.-.-.-;
          Length = 512

 Score =  212 bits (539), Expect = 7e-57
 Identities = 152/495 (30%), Positives = 237/495 (47%), Gaps = 34/495 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L+++ + +    +   + S GI+ GD V +A PN   F   ++      A+  PLN    
Sbjct: 28  LSFSELRIAIMDLQRQIASLGIKVGDPVNIAIPNGLEFVVAFYAVSWQRAICGPLNSNYK 87

Query: 88  PREIEYHLRDSGAKALFAFTG-----TPELPLGERAWQAFQEVAECELYIDLPAAAGATT 142
             E E+++ D  +K +    G     TP +   ++   A  E+A C      P +     
Sbjct: 88  QSEFEFYIDDLKSKLVIVPEGSVAANTPAVRAAKKLSVAVAELAWC------PKSRLVRI 141

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL---LFNA 199
               GA+       G P        + DDV ++++TSGTTG+PK   LTH NL   + N 
Sbjct: 142 VHFEGAKINAPQPLGLP--------QPDDVMLVLHTSGTTGRPKVVPLTHKNLCRSIHNI 193

Query: 200 VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEK 259
             S  L     D  D    V+PLFH+ G    + + L   G  V+ P+F          +
Sbjct: 194 TTSYRL-----DPRDTSYVVMPLFHVHGLLCGLLSTLASGGCAVVPPKFSAHSFWKEFIQ 248

Query: 260 EKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILE 319
              T +  VPT++                       S  + L   V  K++  F   +LE
Sbjct: 249 YGATWYTAVPTIH----QXXXXXXXXXXXXXXXXXXSCSSPLAPPVLSKLEATFRAPVLE 304

Query: 320 GYGLSETSPVVSFNN-PKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV 378
            Y ++E S  ++ N  P    KP S+G P +GVE+K++D+  N +     GEI VRG  V
Sbjct: 305 AYAMTEASHQMTTNPLPPLVHKPHSVGKP-FGVELKILDQKGNEMPQGKEGEICVRGINV 363

Query: 379 MKGYHNRPEAN-AQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEV 437
            KGY N P AN +   +D +FRTGD  + D++G+ FI  R K+++ RGG  + P EI+ V
Sbjct: 364 TKGYLNNPAANKSSFTKDRFFRTGDEGKLDKDGYVFITGRIKELVNRGGEKISPAEIDAV 423

Query: 438 LMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEF 497
           LM HP VS A    VP + +G++I+A + P  G T+T  +L  + ++++AA+K P+   F
Sbjct: 424 LMQHPDVSEAVCFAVPDEKYGQDIQAAINPVAGKTVTPKQLHDYLEQKVAAFKIPKKFYF 483

Query: 498 RTELPMTATGKILKR 512
              +P TATGK+ +R
Sbjct: 484 TDRIPKTATGKVQRR 498


>3HBCL_THAAR RecName:
           Full=3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA
           ligase;         EC=6.2.1.n1;       
           EC=6.2.1.27;AltName: Full=3-hydroxybenzoyl-CoA
           synthetase;
          Length = 523

 Score =  207 bits (527), Expect = 2e-55
 Identities = 153/509 (30%), Positives = 235/509 (46%), Gaps = 20/509 (3%)

Query: 12  ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
           A+   E+ A++  +  + Y  ++   N+  N L + G+  GD+V     + P     Y G
Sbjct: 23  AQGLGEQTAMLCAERSITYRELDAATNRHGNALRAHGVGKGDRVLFLMDDSPELVAAYLG 82

Query: 72  ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
            L+ GAV V LNV L PR++ Y ++DS  + L+         +       +Q++A  EL 
Sbjct: 83  TLRIGAVAVALNVRLAPRDVLYVIQDSACRLLY---------IDAEFLHLYQQIAG-ELE 132

Query: 132 IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
                      +  P    F   L+GQ    ESV+   DDVA  +Y+SGTTG+PK     
Sbjct: 133 QPPQVVVRGDEAPAPAIIAFKHFLDGQAATLESVQVAPDDVAYWLYSSGTTGRPKAVMHA 192

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF-DG 250
           H ++L         F   P   D   T   +F  +     +   L    T+++ P + D 
Sbjct: 193 HRSVLIADRLEREYFGIKPG--DRVFTTSKMFFGWSLGHSLMGGLQCGATVIVAPGWPDA 250

Query: 251 DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVK 310
           +  ++   + + TI    P MY  LL  +G  +   +    H  VS G  LP  + ++  
Sbjct: 251 ERVMATAARHRPTILFSTPVMYRNLLR-EGAGESAAMRDIRHF-VSAGEKLPENIGQQWL 308

Query: 311 EKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEG-EGPG 369
           + FGI I EG G SET  +     P    + GS G  +   E++L+DE  N I   + PG
Sbjct: 309 DTFGIPITEGIGASETVFLFLCARPDAY-RIGSCGKRVPWAEVRLLDELGNEITTPDTPG 367

Query: 370 EIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNV 429
            IA+R      GY   PE   + +RDGW+  GD+   D +GF++   R+ DM+   G  V
Sbjct: 368 LIAIRMASQFVGYWKLPETTEKALRDGWYYPGDMFSFDADGFWYHNGRADDMLKISGQWV 427

Query: 430 YPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAW---AKERL 486
            P EIE      P ++ A VV VP+D     +  F++P + +   +    AW    +  L
Sbjct: 428 SPGEIESCASAVPGIAEAVVVAVPNDDGLTRLTLFIVPEDPSASQQKLSEAWMTTLRGTL 487

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           + YK PR ++F  ELP TATGK+ K  LR
Sbjct: 488 SIYKCPRTIQFLEELPRTATGKVQKYRLR 516


>4CL2_ARATH RecName: Full=4-coumarate--CoA ligase 2;       
           Short=4CL 2;         EC=6.2.1.12;AltName:
           Full=4-coumarate--CoA ligase isoform 2;
          Length = 556

 Score =  206 bits (525), Expect = 3e-55
 Identities = 146/500 (29%), Positives = 248/500 (49%), Gaps = 32/500 (6%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           YA V++ + ++A  L + G++  D V +  PN P     +  A   GA+    N   TP 
Sbjct: 66  YADVHVTSRKLAAGLHNLGVKQHDVVMILLPNSPEVVLTFLAASFIGAITTSANPFFTPA 125

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIP-GA 148
           EI    + S AK +                Q+        L  D        + AIP   
Sbjct: 126 EISKQAKASAAKLIVT--------------QSRYVDKIKNLQNDGVLIVTTDSDAIPENC 171

Query: 149 ETFWAALNGQPGEFESV--RTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALF 206
             F      +    +S+  +   +DV  + ++SGTTG PKG  LTH  L+ +   +  + 
Sbjct: 172 LRFSELTQSEEPRVDSIPEKISPEDVVALPFSSGTTGLPKGVMLTHKGLVTSV--AQQVD 229

Query: 207 DQAPDSH----DVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKV 262
            + P+ +    DV L VLP+FHI+   ++M  +L    T+++MP+F+    L  +++ KV
Sbjct: 230 GENPNLYFNRDDVILCVLPMFHIYALNSIMLCSLRVGATILIMPKFEITLLLEQIQRCKV 289

Query: 263 TIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGY 321
           T+   VP +   +  A+     K    ++    SG A L  E+   +  KF   ++ +GY
Sbjct: 290 TVAMVVPPIVLAI--AKSPETEKYDLSSVRMVKSGAAPLGKELEDAISAKFPNAKLGQGY 347

Query: 322 GLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGH 376
           G++E  PV++    F       K G+ G  +   EMK++D +  +++    PGEI +RG+
Sbjct: 348 GMTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKILDPDTGDSLPRNKPGEICIRGN 407

Query: 377 CVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIE 435
            +MKGY N P A A  + +DGW  TGD+   D++   FI+DR K++I   G+ V P E+E
Sbjct: 408 QIMKGYLNDPLATASTIDKDGWLHTGDVGFIDDDDELFIVDRLKELIKYKGFQVAPAELE 467

Query: 436 EVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIV 495
            +L+ HP+++  AVV +  +  GE   AFV+ ++ + ++EDE+  +  +++  YK    V
Sbjct: 468 SLLIGHPEINDVAVVAMKEEDAGEVPVAFVVRSKDSNISEDEIKQFVSKQVVFYKRINKV 527

Query: 496 EFRTELPMTATGKILKRELR 515
            F   +P   +GKIL+++LR
Sbjct: 528 FFTDSIPKAPSGKILRKDLR 547


>MENE_BACSU RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 486

 Score =  206 bits (523), Expect = 5e-55
 Identities = 144/505 (28%), Positives = 238/505 (47%), Gaps = 40/505 (7%)

Query: 12  ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
           A+  PER A+++ D  + +A +   + ++A  L +  +R GD  A+   N     +    
Sbjct: 13  AQLTPERIALIYEDQTVTFAELFAASKRMAEQLAAHSVRKGDTAAILLQNRAEMVYAVHA 72

Query: 72  ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
               G   V LN  L+  E  + L DSG+  L       +    ++ ++   +  + +  
Sbjct: 73  CFLLGVKAVLLNTKLSTHERLFQLEDSGSGFLLT-----DSSFEKKEYEHIVQTIDVDEL 127

Query: 132 IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
           +            +                      + D  A ++YTSGTTG+PKG Q T
Sbjct: 128 MKXXXXXXXXXXYM----------------------QMDATATLMYTSGTTGKPKGVQQT 165

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGD 251
             N  F+AV+S+   +      D +L  LPLFHI G + +  + +Y   T+VL  RF   
Sbjct: 166 FGNHYFSAVSSA--LNLGITEQDRWLIALPLFHISGLSALFKSVIYGM-TVVLHQRFSVS 222

Query: 252 EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
           + L  + + +VT+ + V TM   LL      +  +  +++                + +E
Sbjct: 223 DVLHSINRHEVTMISAVQTMLASLLE-----ETNRCPESIRCIXXXXXXXXXXXXEECRE 277

Query: 312 KFGIEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
           K G  + + YG++ET S +V+ +      K GS G P++  E+K ++ +    E    GE
Sbjct: 278 K-GFPVFQSYGMTETCSQIVTLSPEFSMEKLGSAGKPLFSCEIK-IERDGQVCEPYEHGE 335

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           I V+G  VMK Y NR  AN    ++GW +TGD+   D EGF +++DR  D+II GG N+Y
Sbjct: 336 IMVKGPNVMKSYFNRESANEASFQNGWLKTGDLGYLDNEGFLYVLDRRSDLIISGGENIY 395

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P E+E VL++HP V+ A V G      G+   A+++  +   ++  EL  + KERLA YK
Sbjct: 396 PAEVESVLLSHPAVAEAGVSGAEDKKWGKVPHAYLVLHK--PVSAGELTDYCKERLAKYK 453

Query: 491 YPRIVEFRTELPMTATGKILKRELR 515
            P        LP  A+ K+L+ +L+
Sbjct: 454 IPAKFFVLDRLPRNASNKLLRNQLK 478


>ALKK_PSEOL RecName: Full=Medium-chain-fatty-acid--CoA ligase;      
             EC=6.2.1.-;AltName: Full=Medium-chain acyl-CoA
           synthetase;
          Length = 546

 Score =  204 bits (519), Expect = 1e-54
 Identities = 147/497 (29%), Positives = 241/497 (48%), Gaps = 25/497 (5%)

Query: 33  VNMIANQVANLLVSRGIRPGDKVA-LACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREI 91
           V + A ++A+ L   G+ P D+ A +A  N+ +   VY+    AG V   +N  L   +I
Sbjct: 45  VELRARKLASALGKMGLTPSDRCATIAWNNIRHLE-VYYAVSGAGMVCHTINPRLFIEQI 103

Query: 92  EYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETF 151
            Y +  +  K +        LP+      +  +V    L     + A A    +PG   +
Sbjct: 104 TYVINHAEDKVVLL--DDTFLPIIAEIHGSLPKVKAFVLMAHNNSNASAQ---MPGLIAY 158

Query: 152 WAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPD 211
              +      +     + ++ + + YTSGTTG PKG   +H + + +++ ++        
Sbjct: 159 EDLIGQGDDNYIWPDVDENEASSLCYTSGTTGNPKGVLYSHRSTVLHSMTTAMPDTLNLS 218

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTM 271
           + D  L V+P+FH+    T  +AA+     ++  P  DG     L+  E V+I  GVP +
Sbjct: 219 ARDTILPVVPMFHVNAWGTPYSAAMVGAKLVLPGPALDGASLSKLIASEGVSIALGVPVV 278

Query: 272 YWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS 331
           + GLL AQ  +  K  SQ+L   V GG++ PA + R+  + +G+E++  +G++E SP  +
Sbjct: 279 WQGLLAAQAGNGSK--SQSLTRVVVGGSACPASMIREFNDIYGVEVIHAWGMTELSPFGT 336

Query: 332 FNNP----------KRKAKPGSIGLPIWGVEMKLV-DENFNTIE-GEGPGEIAVRGHCVM 379
            N P          ++ +   S G P +GVE+K+V DE     E G   G +  RGH V+
Sbjct: 337 ANTPLAHHVDLSPDEKLSLRKSQGRPPYGVELKIVNDEGIRLPEDGRSKGNLMARGHWVI 396

Query: 380 KGY-HNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVL 438
           K Y H+ P      + DGWF TGD+A  D +GF  I DR+KD+I  GG  +   E+E + 
Sbjct: 397 KDYFHSDP---GSTLSDGWFSTGDVATIDSDGFMTICDRAKDIIKSGGEWISTVELESIA 453

Query: 439 MTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFR 498
           + HP +  AAV+   H+   E      + +  + LT  E+  +  +++A ++ P    F 
Sbjct: 454 IAHPHIVDAAVIAARHEKWDERPLLIAVKSPNSELTSGEVCNYFADKVARWQIPDAAIFV 513

Query: 499 TELPMTATGKILKRELR 515
            ELP   TGKILK  LR
Sbjct: 514 EELPRNGTGKILKNRLR 530


>MENE_BACC0 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  203 bits (517), Expect = 2e-54
 Identities = 151/496 (30%), Positives = 240/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V      A
Sbjct: 17  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGIEMITVIHALSYA 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMXXXXXXXXXXXXETCVDK---- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>4CL3_DICDI RecName: Full=Probable 4-coumarate--CoA ligase 3;       
            Short=4CL 3;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 3;
          Length = 551

 Score =  203 bits (517), Expect = 2e-54
 Identities = 159/519 (30%), Positives = 257/519 (49%), Gaps = 24/519 (4%)

Query: 13  RNRPERDAIVFGDMRLNYA--LVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           R +P++  +V G     Y+   V     +VA  L    I+ GD + +  PN+P +  ++ 
Sbjct: 34  RYKPDQVLLVDGLTFKEYSSHFVADTIEKVACGLNKLNIKKGDVLGVILPNLPEYVPIFH 93

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECEL 130
           G L  G +   +N   T  E+ + L     + L        L + E+     + V     
Sbjct: 94  GTLLMGGITSLVNPDYTIEELSHTLATVSPRYLAV-----TLAVYEKIKNDLKRVFPSVE 148

Query: 131 YIDLPAAAGATTSAIPGAE--------TFWAALNGQPGEFESVRTE-GDDVAVIIYTSGT 181
            + L   AG T   I            +F    N    ++  VR +   D A+I ++SGT
Sbjct: 149 KVILVDIAGQTLKEIDQLTLSSDGIVMSFNQLTNNNGKDYPIVRIDLTKDTAIIPFSSGT 208

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
           TG  KG  L+H NL+ N   +  +       +D  + VLP FH FG    +   + +   
Sbjct: 209 TGLFKGVCLSHYNLVSNTYQTQTIETSTYKKNDSVIGVLPFFHSFGLMLHIMLMVKQGYR 268

Query: 242 MVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
           +V +P+F+    L L++K KV +   VP +   ++ A+     K    +L T   G A L
Sbjct: 269 IVTLPKFEPVRFLELIKKYKVAMSFIVPPI--AIMFAKSPIVDKFDLSSLRTLFCGAAPL 326

Query: 302 PAEVARKVKEKFG--IEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDEN 359
            +E+   +KE+F   + I +GYG +E SP   F  P    K GS G  +  +  K++   
Sbjct: 327 GSEIEDLIKERFKGRLVIKQGYGATELSPCC-FVTPNGLVKSGSSGTLLPNLLAKIISSE 385

Query: 360 FNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDR 417
                G G  GEI ++G  VM GY+N  +A  +V+ +DG+ +TGDI   DE+G++FIIDR
Sbjct: 386 TGENLGMGEKGEICIKGPNVMLGYYNNEKATNEVIDKDGFLKTGDIGYVDEDGYFFIIDR 445

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
           SK++I   G+ V P E+E +L++HP+V+ A VVG+     GE  + FV+  +  +LTE E
Sbjct: 446 SKELIKCKGFQVPPAELEALLLSHPKVADACVVGLSKGDMGEVPRGFVVIKQNESLTEKE 505

Query: 478 LIAWAKERLAAYKYPR-IVEFRTELPMTATGKILKRELR 515
           L+ WA  ++A YK+ R  + F   +P +ATGK+L++ L+
Sbjct: 506 LLDWAHPKIANYKHFRGGIFFIPAIPKSATGKLLRKNLK 544


>4CL2_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 2;       
            Short=4CL 2;         Short=Os4CL2;       
           EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA synthase 2;
          Length = 569

 Score =  203 bits (516), Expect = 3e-54
 Identities = 155/485 (31%), Positives = 228/485 (47%), Gaps = 27/485 (5%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G+  GD+V +   N              GAV    N   TP+EI    + SG K +    
Sbjct: 89  GVGHGDRVMVLLQNCVEXXXXXXXXXXLGAVTTAANPFCTPQEIHKQFKASGVKLIL--- 145

Query: 108 GTPELPLGE-RAWQAFQEVAECELYIDLPAAAGATT-SAIP-GAETFWAAL-NGQPGEFE 163
            T  + + + R  +AF  +  C                A P G   FW  + +   G   
Sbjct: 146 -TQSVYVDKLRQHEAFPRIDACXXXXXXXXXXXXXXXEATPEGCLPFWDLIADADEGSVP 204

Query: 164 SVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSH----DVFLTV 219
            V    DD   + ++SGTTG PKG  LTH +++     +  +  + P+ H    DV L V
Sbjct: 205 EVAISPDDPVALPFSSGTTGLPKGVVLTHRSVVSGV--AQQVDGENPNLHMGAGDVALCV 262

Query: 220 LPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQ 279
           LPLFHIF   +++  A+     + LMPRF+    L  +E+ +VT                
Sbjct: 263 LPLFHIFSLNSVLLCAVRAGAAVALMPRFEMGAMLGAIERWRVTXXXXXXXXXXXXXKNP 322

Query: 280 --GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYGLSETSPVVS----F 332
               HD+  I   L    SG A L  E+   ++ +    I  +GYG++E  PV+S    F
Sbjct: 323 FVERHDLSSIRIVL----SGAAPLGKELEDALRARLPQAIFGQGYGMTEAGPVLSMCPAF 378

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQ 391
                 AK GS G  +   E+K+VD +     G   PGEI +RG  +MKGY N PEA A 
Sbjct: 379 AKEPTPAKSGSCGTVVRNAELKVVDPDTGFSLGRNLPGEICIRGPQIMKGYLNDPEATAA 438

Query: 392 VMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV 450
            +  +GW  TGDI   D++   FI+DR K++I   G+ V P E+E +L+ HP ++ AAVV
Sbjct: 439 TIDVEGWLHTGDIGYVDDDDEVFIVDRVKELIKFKGFQVPPAELESLLIAHPSIADAAVV 498

Query: 451 GVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
               D  GE   AFV+ A  + +TE+ +  +  +++  YK    V F   +P +A+GKIL
Sbjct: 499 PQKDDVAGEVPVAFVVRAADSDITEESIKEFISKQVVFYKRLHKVHFIHAIPKSASGKIL 558

Query: 511 KRELR 515
           +RELR
Sbjct: 559 RRELR 563


>MENE_BACCZ RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  202 bits (515), Expect = 4e-54
 Identities = 149/496 (30%), Positives = 241/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 17  PDRTAIEMEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLKEAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS  F+      D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSS--FNLGLRDDDCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E   + +   
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEETYPPSLRCMXXXXXXXXXXXXEACVEKR--- 277

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
            I + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 278 -IPVYQTYGMTETSSQICTLSADYMLMKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKAWFLEELPRNASKK 469


>MENE_BACHK RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  202 bits (513), Expect = 7e-54
 Identities = 150/496 (30%), Positives = 239/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 17  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMXXXXXXXXXXXXETCVDK---- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEVTEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>MENE_BACAN RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  201 bits (512), Expect = 9e-54
 Identities = 150/496 (30%), Positives = 238/496 (47%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G+  G KVA+   N      V       
Sbjct: 16  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIHALSYV 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 76  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 115

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 116 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 162

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 163 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 219

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 220 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSFRCMXXXXXXXXXXXXETCVDK---- 275

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 276 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 334

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 335 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 394

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 395 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 452

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 453 KKACFLEELPRNASKK 468


>MENE_BACAH RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  201 bits (512), Expect = 9e-54
 Identities = 150/496 (30%), Positives = 239/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 17  PDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMXXXXXXXXXXXXETCVDK---- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFVEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>MENE_BACAC RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  201 bits (512), Expect = 9e-54
 Identities = 150/496 (30%), Positives = 238/496 (47%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G+  G KVA+   N      V       
Sbjct: 17  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSFRCMXXXXXXXXXXXXETCVDK---- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>MENE_BACAA RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  201 bits (512), Expect = 9e-54
 Identities = 150/496 (30%), Positives = 238/496 (47%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G+  G KVA+   N      V       
Sbjct: 17  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHVGVNRGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E    +   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYS------------FAEVMNG-PKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G+       + +            E         
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSFRCMXXXXXXXXXXXXETCVDK---- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPFAEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVV--KSGEITEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>MENE_BACCQ RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  201 bits (511), Expect = 1e-53
 Identities = 151/494 (30%), Positives = 237/494 (47%), Gaps = 42/494 (8%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 16  PDRTAIEIEEEKVTFMQLHEKVVSVCGNLTHVGVKRGQKVAVLMKNGMEMITVIHALSYV 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F+         D+P
Sbjct: 76  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFEAK-------DIP 115

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195
             + A     P  E F         EF       ++   IIYTSGTTG+PKG  LT+ N 
Sbjct: 116 VYSFAEVMNGPKEEAFIQE------EFSL-----EEAMTIIYTSGTTGKPKGVILTYGNH 164

Query: 196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS 255
             +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D    
Sbjct: 165 WASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFIHK 221

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
            ++   VTI + V  M   LL   G        + +            E      EK GI
Sbjct: 222 ALQTRGVTIISVVSKMLTDLLERLGAETYPSSLRCMXXXXXXXXXXXXETC---VEK-GI 277

Query: 316 EILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR 374
            + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI V+
Sbjct: 278 PVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPAFTEGEIVVK 336

Query: 375 GHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
           G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP +I
Sbjct: 337 GPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPAQI 396

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           EEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P+ 
Sbjct: 397 EEVLLSHPAVAEAGVVGMTDDKWGQVPAAFVV--KSGEVTEEEILHFCEEKLAKYKVPKK 454

Query: 495 VEFRTELPMTATGK 508
             F  ELP  A+ K
Sbjct: 455 ACFLEELPRNASKK 468


>MENE_BACC1 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  201 bits (510), Expect = 2e-53
 Identities = 153/496 (30%), Positives = 239/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++ G KVA+   N      V       
Sbjct: 16  PDRTAIEIEEEKVTFMQLHEKVVSVCEHLTHIGVKRGQKVAVLMKNGMEMITVIHALSYV 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F          D+P
Sbjct: 76  GAVAVLLNTRLSREELLWQMDDAEVICLVTD-------------QDFDAK-------DIP 115

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEG--DDVAVIIYTSGTTGQPKGAQLTHT 193
             +            F   +NG P E  S++ E   ++   IIYTSGTTG+PKG  LT+ 
Sbjct: 116 VYS------------FAEVMNG-PKEEASIQEEFSLEEAMTIIYTSGTTGKPKGVILTYG 162

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 163 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 219

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G        + +            E      EK 
Sbjct: 220 HKALQTRGVTIISVVSKMLTDLLERLGAETYPSSLRCMXXXXXXXXXXXXETC---VEK- 275

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 276 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPAFTEGEIV 334

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGDI   DEEGF +++DR  D+II GG N+YP 
Sbjct: 335 VKGPNVTGGYFNREDATRETIQNGWLHTGDIGYLDEEGFLYVLDRRSDLIISGGENIYPA 394

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E+I + + +LA YK P
Sbjct: 395 QIEEVLLSHPAVAEAGVVGMTDDKWGQVPVAFVV--KSGEVTEEEIIHFCEAKLAKYKVP 452

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 453 KKACFLEELPRNASKK 468


>ACSM2_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM2,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 2;
          Length = 575

 Score =  200 bits (509), Expect = 2e-53
 Identities = 152/510 (29%), Positives = 244/510 (47%), Gaps = 41/510 (8%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           +++ ++  ++  + Q AN+L    G+  GD+VA+  P +P +  +  G ++ G V +P  
Sbjct: 78  EIKWSFRELSEASKQTANVLSGACGLHRGDRVAVVLPRIPEWWLMILGCMRTGLVFMPGT 137

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGATT 142
           + +   +I Y L+ S A+A+ A         G+   Q    VA +C     L      + 
Sbjct: 138 IQMRSSDILYRLQASKARAIVA---------GDEVAQEVDAVAPDCSF---LKIKLLVSE 185

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
           ++  G   F A L       + V TE  + A I +TSGT+G PK A+ +H +L   A   
Sbjct: 186 NSREGWLNFKALLKEASTIHQCVETESRESAAIYFTSGTSGPPKMAEHSHCSLGIKAKMD 245

Query: 203 SALFDQAPDSHDVFLTV------LPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSL 256
           +A +     S D+  T+      + +   F +  ++ A ++ H    L+P+FD    L +
Sbjct: 246 AASWTGLSTS-DIIWTISDTAWIMNILGAFLEPWVLGACIFVH----LLPKFDSQTVLKV 300

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +    +    G P +Y  LL      D+       LH+  SGG +L  E     K K G+
Sbjct: 301 LSSYPINTLVGAPIIYRMLLQ----QDLSSYKFPHLHSCFSGGETLLPETLENWKAKTGL 356

Query: 316 EILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG 375
           EI E YG +ET  +   +    K KPG +G      +++++DE  N +     G+IA+R 
Sbjct: 357 EIREIYGQTETGLICRVSRTM-KVKPGYLGTAFAHYDVQVIDEQGNVLPPGKEGDIAIRV 415

Query: 376 HCV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
             +       GY + P+     +R  ++  GD   +D EG++  I RS D+I   GY + 
Sbjct: 416 KPIWPIGMFSGYVDNPKKTQDNIRGDFWLMGDRGIKDPEGYFHFIGRSDDIINSSGYRIG 475

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA-EGATLTEDELIAWAKERL--- 486
           P E+E  LM HP VS  AV+  P  + GE +KAFV+ A E  +   D+L    +E +   
Sbjct: 476 PSEVENALMEHPAVSETAVISSPDPSRGEVVKAFVVLAPEFLSHDRDQLTKVLQEHVKSV 535

Query: 487 -AAYKYPRIVEFRTELPMTATGKILKRELR 515
            A YKYPR VEF  +LP T TGKI + +LR
Sbjct: 536 TAPYKYPRKVEFVLDLPKTVTGKIERAKLR 565


>4CL1_ARATH RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumarate--CoA ligase isoform 1;
          Length = 561

 Score =  200 bits (508), Expect = 3e-53
 Identities = 144/497 (28%), Positives = 235/497 (47%), Gaps = 21/497 (4%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           Y+ V++I+ Q+A      G+   D V L  PN P F   +  A   G             
Sbjct: 68  YSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFVLSFLAASFRGXXXXXXXXXXXXX 127

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE 149
           EI    + S  K +       E    ++      +     + ID   +       +   E
Sbjct: 128 EIAKQAKASNTKLIIT-----EARYVDKIKPLQNDDGVVIVCIDDNESVPIPEGCLRFTE 182

Query: 150 TFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQA 209
              +         +SV    DDV  + Y+SGTTG PKG  LTH  L+ +   +  +  + 
Sbjct: 183 LTQSTTEASE-VIDSVEISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSV--AQQVDGEN 239

Query: 210 PD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIF 265
           P+    S DV L VLP+FHI+   ++M   L     +++MP+F+ +  L L+++ KVT+ 
Sbjct: 240 PNLYFHSDDVILCVLPMFHIYALNSIMLCGLRVGAAILIMPKFEINLLLELIQRCKVTVA 299

Query: 266 AGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLS 324
             VP +   +  A+     K    ++    SG A L  E+   V  KF   ++ +GYG++
Sbjct: 300 PMVPPIVLAI--AKSSETEKYDLSSIRVVKSGAAPLGKELEDAVNAKFPNAKLGQGYGMT 357

Query: 325 ETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVM 379
           E  PV++    F       K G+ G  +   EMK+VD +  +++    PGEI +RGH +M
Sbjct: 358 EAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKIVDPDTGDSLSRNQPGEICIRGHQIM 417

Query: 380 KGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVL 438
           KGY N P A A+ + +DGW  T            FI+DR K++I   G+ V P E+E +L
Sbjct: 418 KGYLNNPAATAETIDKDGWLHTXXXXXXXXXXXXFIVDRLKELIKYKGFQVAPAELEALL 477

Query: 439 MTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFR 498
           + HP ++  AVV +  +  GE   AFV+ ++ + L+ED++  +  +++  YK    V F 
Sbjct: 478 IGHPDITDVAVVAMKEEAAGEVPVAFVVKSKDSELSEDDVKQFVSKQVVFYKRINKVFFT 537

Query: 499 TELPMTATGKILKRELR 515
             +P   +GKIL+++LR
Sbjct: 538 ESIPKAPSGKILRKDLR 554


>MENE_BACWK RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  199 bits (507), Expect = 3e-53
 Identities = 149/492 (30%), Positives = 236/492 (47%), Gaps = 42/492 (8%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G++   KVA+   N      V       
Sbjct: 16  PDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRAQKVAVLMKNGMEMITVIHALSYI 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                    +  E E   ++P
Sbjct: 76  GAVAVLLNTRLSREELLWQMDDAEVVCLVT-----------------DQEFETE---NVP 115

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195
             + A     P AE F         EF       ++   IIYTSGTTG+PKG  LT+ N 
Sbjct: 116 VCSFAEVMQGPKAEAFIQE------EFSL-----EEAMTIIYTSGTTGKPKGVILTYGNH 164

Query: 196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS 255
             +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D +    
Sbjct: 165 WASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDANFIHK 221

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
            ++   VTI + V  M   LL   G+       + +            E      EK GI
Sbjct: 222 ALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMXXXXXXXXXXXXETC---VEK-GI 277

Query: 316 EILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR 374
            + + YG++ETS  + +        K GS G P++  +++ ++++   +     GEI V+
Sbjct: 278 PVYQTYGMTETSSQICTLTADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPRAEGEIVVK 336

Query: 375 GHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
           G  V  GY NR +A  + +R+GW  TGD+   DEEGF +++DR  D+II GG N+YP +I
Sbjct: 337 GPNVTGGYFNREDATHEAIRNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPAQI 396

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           EEVL++HP V  A VVG+  ++ G+   AFV+  +   +TE+E+I + +E+LA YK P+ 
Sbjct: 397 EEVLLSHPAVVEAGVVGMADESWGQVPAAFVV--KSGDVTEEEIIRFCEEKLAKYKVPKK 454

Query: 495 VEFRTELPMTAT 506
             F  ELP  A+
Sbjct: 455 ACFLEELPRNAS 466


>4CLL9_ARATH RecName: Full=4-coumarate--CoA ligase-like 9;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           4;         Short=At4CL4;
          Length = 562

 Score =  199 bits (507), Expect = 3e-53
 Identities = 130/355 (36%), Positives = 200/355 (56%), Gaps = 8/355 (2%)

Query: 165 VRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD-VFLTVLPLF 223
           V+    D A I+++SGTTG+ KG  LTH NL+ +   S     Q P ++D V L  LPLF
Sbjct: 199 VQVNQSDPAAILFSSGTTGRVKGVLLTHRNLIASTAVSHQRTLQDPVNYDRVGLFSLPLF 258

Query: 224 HIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHD 283
           H+FG   MM  A+    T+VL+ RF+ +     +EK KVT     P +   L+ ++    
Sbjct: 259 HVFG-FMMMIRAISLGETLVLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVKSELTK- 316

Query: 284 IKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETS-PVVSFNNPKRKAKP 341
            K   ++L +   GGA L  ++A + K+KF  ++I++GYGL+E+S P  S   P+   K 
Sbjct: 317 -KYDLRSLRSLGCGGAPLGKDIAERFKQKFPDVDIVQGYGLTESSGPAASTFGPEEMVKY 375

Query: 342 GSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFR 399
           GS+G     +E K+VD +       G  GE+ +RG  +MKGY    +A+A+ + ++GW +
Sbjct: 376 GSVGRISENMEAKIVDPSTGESLPPGKTGELWLRGPVIMKGYVGNEKASAETVDKEGWLK 435

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGD+   D E F +I+DR K++I    Y V P E+E++L ++P V  AAVV  P +  GE
Sbjct: 436 TGDLCYFDSEDFLYIVDRLKELIKYKAYQVPPVELEQILHSNPDVIDAAVVPFPDEDAGE 495

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              AF++   G+ L E ++I +  +++  YK  R V F   +P    GKIL+REL
Sbjct: 496 IPMAFIVRKPGSNLNEAQIIDFVAKQVTPYKKVRRVAFINAIPKNPAGKILRREL 550


>MENE_BACCR RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 482

 Score =  199 bits (505), Expect = 6e-53
 Identities = 152/496 (30%), Positives = 239/496 (48%), Gaps = 46/496 (9%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L   G+  G KVA+   N      V       
Sbjct: 17  PDRTAIEIEEEKVTFMELHEKVVSVCEHLTHVGVERGQKVAVLMKNGMEMITVIHALSYV 76

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GAV V LN  L+  E+ + + D+    L                Q F          D+P
Sbjct: 77  GAVAVLLNTRLSREELLWQMDDAEVVCLVTD-------------QDFDAK-------DVP 116

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEG--DDVAVIIYTSGTTGQPKGAQLTHT 193
             + A              +NG P E  S++ E   ++   IIYTSGTTG+PKG  LT+ 
Sbjct: 117 VYSLAEV------------MNG-PKEEASIQEEFSLEEAMTIIYTSGTTGKPKGVILTYG 163

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
           N   +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D  
Sbjct: 164 NHWASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RILLVPKYDADFI 220

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              ++   VTI + V  M   LL   G        + +            E      EK 
Sbjct: 221 HKALQTRGVTIISVVSKMLTDLLERLGAETYPSSLRCMXXXXXXXXXXXXEAC---VEK- 276

Query: 314 GIEILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
           GI + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI 
Sbjct: 277 GIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLR-IEKDGVVVPPLVEGEIV 335

Query: 373 VRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V+G  V  GY NR +A  + +++GW  TGD+   DEEGF +++DR  D+II GG N+YP 
Sbjct: 336 VKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPA 395

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYP 492
           +IEEVL++HP V+ A VVG+  D  G+   AFV+  +   +TE+E++ + +E+LA YK P
Sbjct: 396 QIEEVLLSHPAVAEAGVVGMSDDKWGQVPAAFVV--KSGAVTEEEILHFCEEKLAKYKVP 453

Query: 493 RIVEFRTELPMTATGK 508
           +   F  ELP  A+ K
Sbjct: 454 KKACFLEELPRNASKK 469


>MENE_LISMO RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 467

 Score =  198 bits (504), Expect = 8e-53
 Identities = 158/509 (31%), Positives = 243/509 (47%), Gaps = 52/509 (10%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           L+   R  P+  A+VF      +  ++    ++A  L + GIR  + +AL   N      
Sbjct: 5   LQKRVRLSPKETALVFEGKEETFEEISEAVERLAGKLFALGIRKDEMIALLGKNDRMTFL 64

Query: 68  VYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAE 127
           +     + GAV + LN  LT +EI Y L ++  K +     T E  +G  A  ++ E+AE
Sbjct: 65  LIHALQQLGAVTLFLNNRLTKKEIAYQLANAEVKQVIV-ADTFEDKVG--AGISYSELAE 121

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
                        T    P     W          +  RT     A I+YTSGTTG+PKG
Sbjct: 122 -------------TDYKEPELLETW----------DLSRT-----ASIMYTSGTTGKPKG 153

Query: 188 AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR 247
              T+ N  ++AVAS  + +      D +L  +P+FHI G + MM + +Y    + L   
Sbjct: 154 VIQTYENHWWSAVAS--VLNLGLTEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEH 210

Query: 248 FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR 307
           FD ++   L+E  KV+  + V +M   LL   G          + T + GG      V  
Sbjct: 211 FDEEKITQLLESGKVSTISVVTSMLERLLKIHGG----SYHPNVRTILLGGGPASKTVLE 266

Query: 308 KVKEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGE 366
             K++  I +++ +G++ET+  +    PK    K GS G  ++  E+K+ D+        
Sbjct: 267 ICKQR-DIPLVQSFGMTETASQIVTLPPKDALNKIGSSGKALFPAEVKIADD-------- 317

Query: 367 GPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
             GEI ++G  +  GY +  +A      DGWF+TGDI   DEEGF F+++R  D+II GG
Sbjct: 318 --GEILLKGPSITPGYLHNKKATEASFVDGWFKTGDIGYLDEEGFLFVVERRSDLIISGG 375

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERL 486
            N+YP EIE V+  +  V   AV+G P D  G    AF++  E  T  EDEL    +  L
Sbjct: 376 ENIYPTEIEHVIGEYVAVKEVAVIGQPDDKWGSVPVAFIVAEE--TFDEDELQLICQTNL 433

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A+YK P+ +    +LP TA+GKI + +L+
Sbjct: 434 ASYKIPKQIIIVEKLPKTASGKIQRNKLK 462


>4CL3_ARATH RecName: Full=4-coumarate--CoA ligase 3;       
           Short=4CL 3;         EC=6.2.1.12;AltName:
           Full=4-coumarate--CoA ligase isoform 3;
          Length = 561

 Score =  198 bits (504), Expect = 8e-53
 Identities = 153/498 (30%), Positives = 235/498 (47%), Gaps = 30/498 (6%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           Y   ++I  +VA+ L   GIR GD + +   N   F F + GA   GAV    N   T +
Sbjct: 78  YGETHLICRRVASGLYKLGIRKGDVIMILLQNSAEFVFSFMGASMIGAVSTTANPFYTSQ 137

Query: 90  EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE 149
           E+   L+ SGAK +   +            Q   ++      + L      T        
Sbjct: 138 ELYKQLKSSGAKLIITHS------------QYVDKLKNLGENLTLITTDEPTPENCLPFS 185

Query: 150 TFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQA 209
           T        P + E+V   GDD A + ++SGTTG PKG  LTH +L+  +VA     D  
Sbjct: 186 TLITDDETNPFQ-ETVDIGGDDAAALPFSSGTTGLPKGVVLTHKSLI-TSVAQQVDGDNP 243

Query: 210 P---DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFA 266
                S+DV L VLPLFHI+              T++LM +F+    L L+++ +VT   
Sbjct: 244 NLYLKSNDVILCVLPLFHIYXXXXXXXXXXXXGATVLLMHKFEIGALLDLIQRHRVTXXX 303

Query: 267 GVPTMYWGLLN--AQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYGL 323
                            +D+  +   L    SG A L  E+   ++ +    IL +GYG+
Sbjct: 304 XXXXXXXXXXKNPTVNSYDLSSVRFVL----SGAAPLGKELQDSLRRRLPQAILGQGYGM 359

Query: 324 SETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCV 378
           +E  PV+S    F       K GS G  +   E+K+V  E   ++    PGEI +RG  +
Sbjct: 360 TEAGPVLSMSLGFAKEPIPTKSGSCGTVVRNAELKVVHLETRLSLGYNQPGEICIRGQQI 419

Query: 379 MKGYHNRPEA-NAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEV 437
           MK Y N PEA +A +  +GW  TGDI   DE+   FI+DR K++I   G+ V P E+E +
Sbjct: 420 MKEYLNDPEATSATIDEEGWLHTGDIGYVDEDDEIFIVDRLKEVIKFKGFQVPPAELESL 479

Query: 438 LMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEF 497
           L+ H  ++ AAVV    +  GE   AFV+ + G  +TE+++  +  +++  YK    V F
Sbjct: 480 LINHHSIADAAVVPQNDEVAGEVPVAFVVRSNGNDITEEDVKEYVAKQVVFYKRLHKVFF 539

Query: 498 RTELPMTATGKILKRELR 515
              +P + +GKIL+++L+
Sbjct: 540 VASIPKSPSGKILRKDLK 557


>ACSM3_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM3,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 3;
          Length = 580

 Score =  196 bits (499), Expect = 3e-52
 Identities = 144/508 (28%), Positives = 240/508 (47%), Gaps = 37/508 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           ++R ++  + +++ + AN+L     ++ GD+V +  P +P +       L+ G V++P  
Sbjct: 86  ELRWSFEELGLLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGT 145

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
             LT ++I Y L+ S AK +   T     P  +         A+CE   +L +    +  
Sbjct: 146 TQLTQKDILYRLQSSKAKCII--TDDTLAPAVDAV------AAKCE---NLHSKLIVSQH 194

Query: 144 AIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
           +  G       +         V T+ D++  I +TSGTTG PK    TH++       + 
Sbjct: 195 SREGWGNLKEMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNG 254

Query: 204 ALF------DQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLM 257
             +      D   ++ D          +F   T   A ++ H     +PRF+    L  +
Sbjct: 255 RFWLDLIASDVMWNTSDTGWAKSAWSSVFSPWTQ-GACVFAH----YLPRFESTSILQTL 309

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
            K  +T+F   PT Y  L+  Q D    + +   H  VS G  +  EV  + ++K G++I
Sbjct: 310 SKFPITVFCSAPTAYRMLV--QNDMSSYKFNSLKH-CVSAGEPINPEVMEQWRKKTGLDI 366

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAV---- 373
            EGYG +ET  ++  N    K KPGS+G P    ++K++DEN  T+     G+IA+    
Sbjct: 367 YEGYGQTETV-LICGNFKGMKIKPGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLP 425

Query: 374 -RGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
            R   +   Y + P   A  +R  ++ TGD    DE+G+++ + RS D+I+  GY + P 
Sbjct: 426 ERPFGLFTHYVDNPSKTASTLRGSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPF 485

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI-----PAEGATLTEDELIAWAKERLA 487
           E+E  L+ HP ++ +AVV  P    GE +KAF++      +      + E+    K+  A
Sbjct: 486 EVESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTA 545

Query: 488 AYKYPRIVEFRTELPMTATGKILKRELR 515
            YKYPR VEF  ELP T +GK+ + ELR
Sbjct: 546 PYKYPRKVEFIEELPKTVSGKVKRNELR 573


>BCLA_THAAR RecName: Full=Benzoate--CoA ligase;       
           EC=6.2.1.25;AltName: Full=Benzoyl-CoA synthetase;
          Length = 527

 Score =  195 bits (495), Expect = 8e-52
 Identities = 156/478 (32%), Positives = 227/478 (47%), Gaps = 23/478 (4%)

Query: 43  LLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKA 102
           L  + G++P D+V +   +   FP  + GA+K G V + +N LLT  + EY L DS A+ 
Sbjct: 66  LRTTLGLQPKDRVLVCVLDGIDFPTTFLGAIKGGVVPIAINTLLTESDYEYMLTDSAARV 125

Query: 103 LFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF 162
             A      LPL          + +      L  A GA      G ++  A L     +F
Sbjct: 126 --AVVSQELLPLFAPM------LGKVPTLEHLVVAGGA------GEDSLAALLATGSEQF 171

Query: 163 ESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL 222
           E+  T  DD    +Y+SG+TG PKG    H++L+  A   +       +  DV  +   L
Sbjct: 172 EAAPTRPDDHCFWLYSSGSTGAPKGTVHIHSDLIHTAELYARPILGIREG-DVVFSAAKL 230

Query: 223 FHIFGQTTMMNAALYRHGTMVLMPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGD 281
           F  +G    +   L    T VLM       A+   + + +  IF GVPT+Y  +L A  D
Sbjct: 231 FFAYGLGNGLIFPLAVGATAVLMAERPTPAAVFERLRRHQPDIFYGVPTLYASML-ANPD 289

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKP 341
              K+    L    S G +LP +V R+ + +FG++IL+G G +E   +   +N       
Sbjct: 290 CP-KEGELRLRACTSAGEALPEDVGRRWQARFGVDILDGIGSTEMLHIF-LSNRAGDVHY 347

Query: 342 GSIGLPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRT 400
           G+ G P+ G  ++L+DE+   I   G  GE+ + G      Y N PE  A      W R+
Sbjct: 348 GTSGKPVPGYRLRLIDEDGAEITTAGVAGELQISGPSSAVMYWNNPEKTAATFMGEWTRS 407

Query: 401 GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE 460
           GD    ++EG+Y    RS DM+   G  V P E+E  L+ H  V  AAVVG   + H  +
Sbjct: 408 GDKYLVNDEGYYVYAGRSDDMLKVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIK 467

Query: 461 IKAFVI--PAEGA-TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            KAF++  P  GA      +L A  K  LA YKYPR +EF  +LP TATGKI + +LR
Sbjct: 468 PKAFIVLKPGYGAGEALRTDLKAHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLR 525


>MENE_OCEIH RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 480

 Score =  194 bits (494), Expect = 1e-51
 Identities = 145/503 (28%), Positives = 235/503 (46%), Gaps = 45/503 (8%)

Query: 16  PERDAIVFGD-MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALK 74
           P++ AI F D   + Y  +   +   A  L   G R GD +A+   N      + +    
Sbjct: 17  PDKKAIEFEDGSSITYLELFHRSQSYARKLGKLGFRQGDHIAILSTNCAEMIQIIYACSY 76

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDL 134
            GAV V LN  LT  E+   L DS AK +              +++A + V +   Y +L
Sbjct: 77  LGAVAVLLNTKLTINELNQQLLDSDAKVIIT----------SESFKASEFVLQRMDYNEL 126

Query: 135 PAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN 194
            +    T+     +E ++                 DD+  ++YTSGTTG PK  Q T  N
Sbjct: 127 ESVTEDTSIITLKSEIYF-----------------DDIFTMMYTSGTTGFPKAVQQTFGN 169

Query: 195 LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEAL 254
             ++A +S+   +     +D +L  LPLFH+ G +TM+ + +Y     VL  +F+ ++  
Sbjct: 170 HWWSATSSA--LNLGLHDNDKWLIPLPLFHVSGLSTMLKSVIYGMPIYVL-EKFEVEKVH 226

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
           + +   K             L+   G+H            + GG   P  +  + K K  
Sbjct: 227 NAIMDRKXXXXXXXXXXXQRLIKRLGNH---HYPNDFRCMLLGGGPAPKSLLEQAKLK-N 282

Query: 315 IEILEGYGLSETSPVVSFNNPKRKAKP-GSIGLPIWGVEMKLV--DENFNTIEGEGPGEI 371
           I + + YG++ETS  +    P+   K  GS G P++  ++K+   + N N I     GEI
Sbjct: 283 IPVFQSYGMTETSSQIVTLTPEDALKKIGSAGKPLFPAQLKIAHNENNPNQI-----GEI 337

Query: 372 AVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
            V+G  V KGY+ R E N +V  + W  TGD+   DE+G+ +++DR  D+II GG N+YP
Sbjct: 338 LVKGPMVTKGYYKRAETNKEVFENNWLHTGDMGYLDEQGYLYVVDRRNDLIISGGENIYP 397

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKY 491
            EIE VL+    +  A V G P++  G    AF++ +    ++E+E+ A  ++ LA YK 
Sbjct: 398 SEIENVLVQIEGIEEAGVKGSPNEEWGMVPIAFIVCSR--PISENEIAAHLEKYLAKYKR 455

Query: 492 PRIVEFRTELPMTATGKILKREL 514
           P+ +    ELP  A  K+++  L
Sbjct: 456 PKEIHVVNELPRNAANKLVRHNL 478


>MENE_BACCN RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 481

 Score =  194 bits (494), Expect = 1e-51
 Identities = 147/492 (29%), Positives = 232/492 (47%), Gaps = 42/492 (8%)

Query: 16  PERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKA 75
           P+R AI   + ++ +  ++     V   L    I+ G KVA+   N      V       
Sbjct: 16  PDRIAIETKEEKITFFALHEKVVSVCENLAYLQIKKGQKVAVLMKNGMEMIAVIHALSYI 75

Query: 76  GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
           GA+ V LN  L+  E+ + + D+    L                Q F E  +  +Y    
Sbjct: 76  GAIAVLLNTRLSREELLWQMEDAEVICLLTD-------------QIF-EPEQVPVYTFEE 121

Query: 136 AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195
              G   S +   E   A                 +   IIYTSGTTG+PKG  LT+ N 
Sbjct: 122 VENGPKQSVVIQEEFSLA-----------------EAMTIIYTSGTTGKPKGVILTYGNH 164

Query: 196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS 255
             +AV SS       D  D +L  +P+FH+ G + +M   +Y    ++L+P++D D    
Sbjct: 165 WASAVGSSLNLGLRDD--DCWLACMPMFHVGGLSLLMKNIMYGM-RVLLVPKYDPDFIHQ 221

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
            ++ + VTI + V  M   LL   G+       + +            E   +     GI
Sbjct: 222 AIQTKGVTIISVVAKMLTDLLERLGNETYPSSLRCMXXXXXXXXXXXXEACVQK----GI 277

Query: 316 EILEGYGLSETSP-VVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR 374
            + + YG++ETS  + + +      K GS G P++  +++ ++++   +     GEI V+
Sbjct: 278 PVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFPCQLR-IEKDGKVMPANVEGEIVVK 336

Query: 375 GHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
           G  V +GY  R +A  + + DGW  TGD+   D+EGF +++DR  D+II GG N+YP +I
Sbjct: 337 GPNVTRGYFKREDATRETIVDGWLHTGDLGYVDDEGFLYVLDRRSDLIISGGENIYPAQI 396

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           EEVL++HP V  A VVG   +T G+   AFV+ A    +TE+E+I + +E+LA YK P+ 
Sbjct: 397 EEVLLSHPLVLEAGVVGKSDETWGQVPVAFVVKA--GQVTEEEMIHFCEEKLAKYKVPKA 454

Query: 495 VEFRTELPMTAT 506
           V F  ELP  A+
Sbjct: 455 VYFLHELPRNAS 466


>MENE_LISMF RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 467

 Score =  194 bits (493), Expect = 1e-51
 Identities = 153/509 (30%), Positives = 240/509 (47%), Gaps = 52/509 (10%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           L+   R  P+  A+VF      +  ++    Q+A  L + GIR  + VAL   N      
Sbjct: 5   LQKRVRLSPKETALVFEGKEETFEEISEAVKQLAGKLFALGIRKDEMVALLGKNDRMTFL 64

Query: 68  VYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAE 127
           +     + GAV + LN  LT +EI + L ++  K                       V  
Sbjct: 65  LIHALQQLGAVTLFLNNRLTKKEISFQLANAEVK----------------------HVIV 102

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
            +  +D   A G + + +  AET + A    P   E+   +    A ++YTSGTTG+PKG
Sbjct: 103 ADSLVD-KVATGISYATL--AETDYEA----PALLET--WDLSRAASVMYTSGTTGKPKG 153

Query: 188 AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR 247
              T+ N  ++AVAS  + +      D +L  +P+FHI G + MM + +Y    + L   
Sbjct: 154 VVQTYENHWWSAVAS--VLNLGLTEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEH 210

Query: 248 FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR 307
           FD ++   L+E  K++  + V +M   LL              + T + GG      V  
Sbjct: 211 FDEEKITQLLESGKISTISVVTSMLERLLKIHSG----SYHPNVRTVLLGGGPASKAVLE 266

Query: 308 KVKEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGE 366
             K++  I +++ +G++ET+  +    PK    K GS G  ++  E+K+ D+        
Sbjct: 267 ICKQR-DIPLVQSFGMTETASQIVTLPPKDALNKIGSSGKALFPAEVKIADD-------- 317

Query: 367 GPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
             GEI ++G  +  GY +  +A      DGWF+TGDI   DEEGF F+++R  D+II GG
Sbjct: 318 --GEILLKGPSITPGYLHNKKATEASFVDGWFKTGDIGYLDEEGFLFVLERRSDLIISGG 375

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERL 486
            N+YP EIE V+  +  V   AV+G P D  G    AF++  E  T  E EL    +  L
Sbjct: 376 ENIYPTEIEHVISEYEGVKEVAVIGKPDDKWGSVPVAFIVAEE--TFDEAELRLICETNL 433

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YK P+ +    +LP TA+GKI + +L+
Sbjct: 434 AGYKIPKQITIVEKLPKTASGKIQRNKLK 462


>ACSM3_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM3,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 3;
          Length = 580

 Score =  191 bits (486), Expect = 9e-51
 Identities = 143/509 (28%), Positives = 238/509 (46%), Gaps = 39/509 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           ++R ++  +  ++ + AN+L     ++ GD+V +  P +P +       L+ G V++P  
Sbjct: 86  EVRWSFEELGSLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGT 145

Query: 84  VLLTPREIEYHLRDSGAKALFAF-TGTPELPLGERAWQAFQEVAECELYIDLPAAAGATT 142
             LT ++I Y L+ S +K +    T  P + +           A+CE   +L +    + 
Sbjct: 146 TQLTQKDILYRLQSSKSKCIITDDTLAPAVDI---------VAAKCE---NLHSKLIVSQ 193

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
            +  G       +         V T+ +++  I +TSGTTG PK    TH++       +
Sbjct: 194 HSREGWGNLKEMMKYASDSHTCVDTKHNELMAIYFTSGTTGPPKMIGHTHSSFGLGLSVN 253

Query: 203 SALF------DQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSL 256
              +      D   ++ D          +F   T   A ++ H     +PRFD    L  
Sbjct: 254 GRFWLDLIASDVMWNTSDTGWAKSAWSSVFSPWTQ-GACVFAH----YLPRFDSTSILQT 308

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE 316
           + K  +T+F   PT Y  L+  Q D    + +   H  VS G  +  EV  + K+K G++
Sbjct: 309 LSKFPITVFCSAPTAYRMLI--QNDITSYKFNSLKH-CVSAGEPINPEVMEQWKKKTGLD 365

Query: 317 ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAV--- 373
           I EGYG +ET  ++  N    K KPGS+G P     ++++DEN   +     G+IAV   
Sbjct: 366 IYEGYGQTETV-LICGNFKGMKIKPGSMGKPSPAFNVEILDENGTILPPGQEGDIAVQVL 424

Query: 374 --RGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
             R   +   Y + P   A  +R  ++ TGD    DE+G+++ + RS D+I+  GY + P
Sbjct: 425 PDRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDEDGYFWFVARSDDVILSSGYRIGP 484

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELI-----AWAKERL 486
            E+E  L+ HP ++ +AVV  P    GE +KAF++      L + E +        K+  
Sbjct: 485 FEVESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKLHDQEQLKKEIQEHVKKTT 544

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YKYPR +EF  ELP T +GK+ + ELR
Sbjct: 545 APYKYPRKIEFIEELPKTVSGKVKRNELR 573


>LUCI_LUCMI RecName: Full=Luciferin 4-monooxygenase;       
           Short=Luciferase;         EC=1.13.12.7;
          Length = 548

 Score =  190 bits (482), Expect = 3e-50
 Identities = 148/490 (30%), Positives = 236/490 (48%), Gaps = 21/490 (4%)

Query: 36  IANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95
           I  ++A  + + G++P + +AL   N   F       L  G  V P N + T RE+ + L
Sbjct: 60  ITCRLAEAMKNFGMKPEEHIALCSENCEEFFIPVLAGLYIGVAVAPTNEIYTLRELNHSL 119

Query: 96  RDSGAKALFAFT-GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
             +    +F+   G P++   ++     +++   +  ++        T      E     
Sbjct: 120 GIAQPTIVFSSRKGLPKVLEVQKTVTCIKKIVILDSKVNFGGHDCMETFIKKHVE----- 174

Query: 155 LNGQPGEFE--SVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN-AVASSALFDQAPD 211
           L  QP  F    V+     VA+++ +SG+TG PKG ++TH   +   + A   ++     
Sbjct: 175 LGFQPSSFVPIDVKNRKQHVALLMNSSGSTGLPKGVRITHEGAVTRFSHAKDPIYGNQVS 234

Query: 212 SHDVFLTVLPLFHIFGQTTMMN--AALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVP 269
                LTV+P  H FG  T +   A  YR   +V++ +FD +  L  ++  K T    VP
Sbjct: 235 PGTAILTVVPFHHGFGMFTTLGYFACGYR---VVMLTKFDEELFLRTLQDYKCTSVILVP 291

Query: 270 TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE-ILEGYGLSETSP 328
           T++  +LN     D   +S     A SGGA L  EV   V  +F +  + +GYGL+ET+ 
Sbjct: 292 TLF-AILNKSELIDKFDLSNLTEIA-SGGAPLAKEVGEAVARRFNLPGVRQGYGLTETTS 349

Query: 329 VVSFNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPE 387
                 P+   KPG+ G  +   ++K++D +   T+     GEI V+G  +M GY N PE
Sbjct: 350 AFIIT-PEGDDKPGASGKVVPLFKVKVIDLDTKKTLGVNRRGEICVKGPSLMLGYSNNPE 408

Query: 388 ANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSL 446
           A  + +  +GW  TGDI   DE+  +FI+DR K +I   GY V P E+E VL+ HP +  
Sbjct: 409 ATRETIDEEGWLHTGDIGYYDEDEHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPNIFD 468

Query: 447 AAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR-IVEFRTELPMTA 505
           A V GVP    GE   A V+  +G T+TE E++ +   ++  +K  R  V F  E+P   
Sbjct: 469 AGVAGVPDPDAGELPGAVVVMEKGKTMTEKEIVDYVNSQVVNHKRLRGGVRFVDEVPKGL 528

Query: 506 TGKILKRELR 515
           TGKI  + +R
Sbjct: 529 TGKIDAKVIR 538


>ACSM2_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM2,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 2;
          Length = 572

 Score =  190 bits (482), Expect = 3e-50
 Identities = 148/509 (29%), Positives = 236/509 (46%), Gaps = 40/509 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           +++ N+  ++ I+ Q AN+L    G++ GD+VA+  P VP +  V  G +++G V +P  
Sbjct: 78  ELKWNFRELSEISKQTANVLTGACGLQRGDRVAVVLPRVPEWWLVTLGCMRSGLVFMPGT 137

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
             +   +I Y L+ S A+A+ A         G+   Q    VA    ++ +         
Sbjct: 138 TQMKSTDILYRLQSSKARAIVA---------GDEVVQEVDAVAPDCSFLKIKLLVSEKNR 188

Query: 144 AIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
              G   F A L       + V T   + A I +TSGT+G PK A+ +H +L   A   +
Sbjct: 189 E--GWLNFKALLKDASPIHQCVETVSQESAAIYFTSGTSGPPKMAEHSHCSLGLKAKMDA 246

Query: 204 ALFDQAPDSHDVFLTV------LPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLM 257
                 P   D   T+      L +   F +  ++   ++ H    L+P+FD    L ++
Sbjct: 247 GWTGLGPS--DTMWTISDTGWILNILGSFLEPWVLGTCIFVH----LLPKFDPQTVLKVL 300

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIE 316
               +    G P +Y  LL      D+       LH+  SGG +L  E     K K G+E
Sbjct: 301 SSYPINTLLGAPLIYRMLLQ----QDLSSYKFPHLHSCFSGGETLLPETLESWKAKTGLE 356

Query: 317 ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH 376
           I E YG +ET      +    K KPG +G  I   +++++DE  N +     G++A+R  
Sbjct: 357 IREIYGQTETGITCRVSRTM-KVKPGYLGTAIVPYDVQVIDEQGNVLPPGKEGDMALRVK 415

Query: 377 CV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
            +       GY + P+     +R  ++  GD   +D EG++  + R+ D+I   GY + P
Sbjct: 416 PIRPIGMFSGYVDNPKKTQANIRGDFWLLGDRGIKDTEGYFHFMGRTDDIINSSGYRIGP 475

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA-EGATLTEDELIAWAKERL---- 486
            E+E  LM HP V   AV+  P     E +KAFV+ A E  +  +D+L    +E +    
Sbjct: 476 SEVENALMEHPAVVETAVISSPDPIRREVVKAFVVLAPEFLSHDQDQLTKVLQEHVKSVT 535

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YKYPR VEF  +LP T TGKI + +LR
Sbjct: 536 APYKYPRKVEFVLDLPKTITGKIERAKLR 564


>4CLL6_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 6;       
           EC=6.2.1.-;
          Length = 598

 Score =  188 bits (477), Expect = 1e-49
 Identities = 149/510 (29%), Positives = 230/510 (45%), Gaps = 53/510 (10%)

Query: 31  ALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPRE 90
           A V  +      L  S G+RPGD   +  P+      +YF  +  G VV P N   T  E
Sbjct: 105 AFVARVRFLAGGLWCSLGLRPGDVALVVSPSCLDVAVLYFALMSIGVVVSPANPASTADE 164

Query: 91  IEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAET 150
             + +R S     F     PE+             A    ++         +  + G+E 
Sbjct: 165 YAHQVRLSRPAIAFV---APEV------------AARLPRHV---------SRVVIGSEV 200

Query: 151 F----WAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLL-----FNAVA 201
           F                    +    A ++Y+SGTTG+ K   +TH NL+     +NA+ 
Sbjct: 201 FDRLXXXXXXXXXXXXXXXXMKQPSTAALLYSSGTTGRVKAVAITHRNLIAQISAYNAIR 260

Query: 202 SSALFDQAPDSHD-------------VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF 248
            +   + A D+               V L  LPLFH+ G   ++   +    T V+M   
Sbjct: 261 ETVAREAATDAGKGKXXXXXXXXXAAVTLFPLPLFHVMG-FGLLTRTISSGETAVVMXXX 319

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARK 308
                        VT  +  P +   L   + D   ++   +L   V GGA L  EV+++
Sbjct: 320 XXXXXXXXXXXXXVTKLSAAPPVVVAL--TKSDEARRRDLSSLVAIVVGGAPLGREVSQR 377

Query: 309 VKEKF-GIEILEGYGLSE-TSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGE 366
               F  ++I++ YGL+E T PV +   P+  A  GS+G     V+ K+VD     + G 
Sbjct: 378 FATVFPSVQIVQSYGLTESTGPVATMAGPEESAAYGSVGRLAPRVQAKIVDTATGEVLGP 437

Query: 367 GP-GEIAVRGHCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIR 424
           G  GE+ +RG  VMKGY   PEA A  +  DGW +TGD+   +E+G+ +++DR K++I  
Sbjct: 438 GRRGELWIRGPVVMKGYVGDPEATAATITPDGWLKTGDLCYFNEDGYLYVVDRLKELIKY 497

Query: 425 GGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKE 484
            GY V P E+E +L + P+++ AAVV  P +  G+   AFV+   GA LTE +++    +
Sbjct: 498 KGYQVPPAELEHILQSRPEIADAAVVPYPDEEAGQLPMAFVVRQPGAYLTEQQVMNCVAK 557

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +A YK  R V F   +P +  GKIL+REL
Sbjct: 558 HVAPYKKVRRVAFVNAIPKSPAGKILRREL 587


>ACSM5_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM5,
           mitochondrial;         EC=6.2.1.2;Flags: Precursor;
          Length = 578

 Score =  187 bits (476), Expect = 1e-49
 Identities = 146/482 (30%), Positives = 230/482 (47%), Gaps = 33/482 (6%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G++PGD++ L  P +P +  +    ++ G V++P    LT ++++Y L+ + AK++    
Sbjct: 110 GLQPGDRMMLVLPRLPDWWLISVACMRTGVVMIPGVSQLTAKDLKYRLQAARAKSIVTSD 169

Query: 108 GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRT 167
                     A Q     A+C     L      + ++ PG   F   L     E   VRT
Sbjct: 170 AL--------APQVDAISADCP---SLQTKLLVSDTSRPGWINFRELLRAASPEHNCVRT 218

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFG 227
              D   I +TSGTTG PK  + + ++     VAS   +    +S D+F        +  
Sbjct: 219 RSGDSVAIYFTSGTTGAPKMVEHSQSSYGLGFVASGRRWMALTES-DIFWNTTDTGWVKA 277

Query: 228 QTTMMNAALYRHGTMVL---MPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDI 284
             T+ +A  + +G  +    +PR D    L+ + +  +T    VPT++  L+      D+
Sbjct: 278 AWTLFSA--WSNGACIFVHELPRVDAKTILNTLCRFPITTLCCVPTLFRLLVQ----EDL 331

Query: 285 KQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGS 343
            +   Q L   ++GG +L  +V  K K + G+E+ EGYG SET  V+  N+     K GS
Sbjct: 332 TRYKFQCLRHCLTGGEALNPDVRDKWKSQTGLELHEGYGQSETV-VICGNSRNSTIKSGS 390

Query: 344 IGLPIWGVEMKLVDENFNTIEGEGPGEIAVR-----GHCVMKGYHNRPEANAQVMRDGWF 398
           +G      ++++VDE  N +     G IAVR       C    Y + PE  A   +  ++
Sbjct: 391 MGKASPPYDVQIVDEEGNVLPPGKEGNIAVRIKPTRPFCFFNCYLDNPEKTAASEQGDFY 450

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGD A  DE+G+++ + R+ D+I    Y + P E+E  L  HP V  +AVV  P    G
Sbjct: 451 ITGDRAHMDEDGYFWFLGRNDDVINSSSYRIGPVEVESALAEHPAVLESAVVSSPDPIRG 510

Query: 459 EEIKAFVI--PAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRE 513
           E +KAF++  PA  +   E    EL    K   A YKYPR V F +ELP T +GKIL+ +
Sbjct: 511 EVVKAFIVLSPAYASHDPEALTRELQEHVKTVTAPYKYPRKVAFISELPKTVSGKILRSK 570

Query: 514 LR 515
           LR
Sbjct: 571 LR 572


>4CLL9_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 9;       
           EC=6.2.1.-;
          Length = 555

 Score =  186 bits (473), Expect = 3e-49
 Identities = 151/527 (28%), Positives = 237/527 (44%), Gaps = 44/527 (8%)

Query: 10  DGARNRPERDAIV---FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           DGA    +R A+V    G     Y  V     + A  L S           A PN+  +P
Sbjct: 41  DGAEAYADRVALVEAAAGGRSYTYGEVARDTARFARALRSXXXXXXXXXXXALPNLAVYP 100

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAF---------TGTPELPLGER 117
            V  G + AGAV   +N      EI+  + DS AK + A           G P + +G+R
Sbjct: 101 VVSLGIMSAGAVFSGVNPRALAAEIKKQVEDSEAKLVVANEVAFDKVKDAGVPVIGVGDR 160

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIY 177
                + +     +  L AAA  T + +   +                  +  D+  + Y
Sbjct: 161 -----ERMPGAISWDGLLAAADRTGAGVVPVDA----------------AQQSDLCALPY 199

Query: 178 TSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD--VFLTVLPLFHIFGQTTMMNAA 235
           +SGTTG  KG  L+H NL+ N  +S  +F  AP++    V L ++P FHI+G T +  A 
Sbjct: 200 SSGTTGVSKGVMLSHRNLVSNLCSS--MFAVAPETAGQVVTLGLMPFFHIYGITGICCAT 257

Query: 236 LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
           L   GT+V+M RFD    L  +   +V     VP +   ++ +    +       L + +
Sbjct: 258 LRHKGTVVVMDRFDLRTFLRALVDHRVMFAPLVPPVMLAMVKSPVADEFDLSDLALKSVM 317

Query: 296 SGGASLPAEVARKVKEKF-GIEILEGYGLSETSPVV----SFNNPKRKAKPGSIGLPIWG 350
           +             + KF G+++ E YGL+E S +     + +     AK  S+G  +  
Sbjct: 318 TXXXXXXXXXXXXFQRKFPGVQVEEAYGLTEHSCITLTHAAGDGHGHVAKKSSVGFILPN 377

Query: 351 VEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRD-GWFRTGDIARRDE 408
           +E+K VD +   ++    PGE+ VR   VM+GY+ R E   + +   GW  T        
Sbjct: 378 LEVKFVDPDTGRSLPANTPGELCVRSQSVMQGYYKRKEETERTVDGKGWLHTXXXXXXXX 437

Query: 409 EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
                     K++I   G+ V P E+E VL++HP V  AAV GVP +  GE   A V+  
Sbjct: 438 XXXXXXXXXXKELIKYKGFQVAPAELEAVLLSHPSVEDAAVFGVPDEEAGEVPVACVVRR 497

Query: 469 EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            GA   E+E++A+  ER+A+YK  R++     +P + +GKIL+R+LR
Sbjct: 498 HGAEEGEEEIVAYVAERVASYKRVRVLHIVDAIPKSVSGKILRRQLR 544


>FAT2_YEAST RecName: Full=Peroxisomal-coenzyme A synthetase;        
           EC=6.-.-.-;
          Length = 543

 Score =  185 bits (469), Expect = 9e-49
 Identities = 132/476 (27%), Positives = 224/476 (47%), Gaps = 27/476 (5%)

Query: 53  DKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPEL 112
           D VA++  N   F   + GA     +  PLN     +E  ++L D  +KA+    GT +L
Sbjct: 63  DTVAISMRNGLEFIVAFLGATMDAKIGAPLNPNYKEKEFNFYLNDLKSKAICVPKGTTKL 122

Query: 113 P--------------LGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQ 158
                          + E A+ A +   E ++Y            ++  A+     +N  
Sbjct: 123 QSSEILKSASTFGCFIVELAFDATRFRVEYDIYSPEDNYKRVIYRSLNNAKF----VNTN 178

Query: 159 PGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLT 218
           P +F        DVA+I++TSGTT  PK   L H N++ + +  +  +   P   D    
Sbjct: 179 PVKFPGF-ARSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTP--LDRSYV 235

Query: 219 VLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNA 278
           V+PLFH+ G   ++ +     G++V+   F          K     F+ VPT+   +LN 
Sbjct: 236 VMPLFHVHGLIGVLLSTFRTQGSVVVPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNM 295

Query: 279 QGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRK 338
              +    I        S  ++L      K++++F   +LE Y ++E S  ++ NN    
Sbjct: 296 PKPNPFPHI----RFIRSCSSALAPATFHKLEKEFNAPVLEAYAMTEASHQMTSNNLPPG 351

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ--VMRDG 396
            +              ++D+N N +     GE+++RG  V  GY N P+AN +    R+ 
Sbjct: 352 KRKXXXXXXXXXXXXXILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKREN 411

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           +FRTGD    D EGF  +  R K++I RGG  + P E++ ++++HP++  A   GVP D 
Sbjct: 412 YFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDM 471

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKR 512
           +G+ ++A ++  +G  +T +EL+ + K+ LA++K P  V F  +LP TATGKI +R
Sbjct: 472 YGQVVQAAIVLKKGEKMTYEELVNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRR 527


>ACSF3_MOUSE RecName: Full=Acyl-CoA synthetase family member 3,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 583

 Score =  185 bits (469), Expect = 9e-49
 Identities = 156/516 (30%), Positives = 229/516 (44%), Gaps = 63/516 (12%)

Query: 36  IANQVANLLVSRGIRPGD----KVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREI 91
           +A ++  L   +G + GD    +V+  C N   +    + +  +G V VPL       ++
Sbjct: 78  LAQEICRL---QGCKVGDLQEERVSFLCSNDVSYVVAQWASWMSGGVAVPLYWKHPEAQL 134

Query: 92  EYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETF 151
           EY ++DS  ++     G   L   ER     Q +    L +      GAT          
Sbjct: 135 EYFIQDS--RSSLVVVGQEYL---ERLSPLAQRLGVPLLPLTPAVYHGATEKPTE----- 184

Query: 152 WAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPD 211
                 QP E    R  G   A+I YTSGTTG+PKGA  TH NL   AV +  +   A  
Sbjct: 185 ------QPVEESGWRDRG---AMIFYTSGTTGRPKGALSTHRNLA--AVVTGLVHSWAWT 233

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGD---EALSLMEKEKVTIFAGV 268
            +DV                +   L+   T V++P F      E     E  ++T+F  V
Sbjct: 234 KNDVIXXXXXXXXXXXXXNKLLCPLWVGATCVMLPEFSAQQVWEKFLSSEAPQITVFMAV 293

Query: 269 PTMYWGLLNAQGDHDIKQ---------ISQTLHTAVSGGASLPAEVARKVKEKFGIEILE 319
           PT+Y  LL+    H  +            + +   VSG A+LP  +  K +   G  +LE
Sbjct: 294 PTVYSKLLDYYDKHFTQPHVQDFVRAVCKERIRLMVSGSAALPVPLLEKWRSATGHTLLE 353

Query: 320 GYGLSETSPVVSFNNPKRKAK-PGSIGLPIWGVEMKLVDENFNT-----IEGEG------ 367
            YG++E    +S  NP  +A+ PGS+G P+ GVE++++ EN        I  EG      
Sbjct: 354 RYGMTEIGMALS--NPLTEARVPGSVGTPLPGVEVRIISENPQKGSPYIIHAEGNERGTK 411

Query: 368 --------PGEIAVRGHCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRS 418
                    GE+ VRG  V + Y ++PE        DGWFRTGD A   +  ++     S
Sbjct: 412 VTPGFEEKEGELLVRGPSVFREYWDKPEETKSAFTSDGWFRTGDTAVFKDARYWIRGRTS 471

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDEL 478
            D+I  GGY V   EIE  L+ HP ++  AV+GVP  T G+ + A V   EG +L+  +L
Sbjct: 472 VDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDMTWGQRVTAVVALQEGHSLSHGDL 531

Query: 479 IAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             WA+  LA Y  P  +    E+P    GK+ K+EL
Sbjct: 532 KEWARGVLAPYAVPSELLLVEEIPRNQMGKVNKKEL 567


>LUCI_PHOPY RecName: Full=Luciferin 4-monooxygenase;       
           Short=Luciferase;         EC=1.13.12.7;
          Length = 550

 Score =  184 bits (468), Expect = 1e-48
 Identities = 151/503 (30%), Positives = 236/503 (46%), Gaps = 26/503 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           ++ + YA    ++ ++A  +   G+    ++ +   N   F     GAL  G  V P N 
Sbjct: 48  EVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPAND 107

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
           +   RE+   +  S    +F         + ++  Q    V              + T  
Sbjct: 108 IYNERELLNSMNISQPTVVF---------VSKKGLQKILNVXXXXXXXXXXXXMDSKTD- 157

Query: 145 IPGAETFWAALNGQ--PG--EFESVRTEGD---DVAVIIYTSGTTGQPKGAQLTH-TNLL 196
             G ++ +  +     PG  E++ V    D    +A+I+ +SG+TG PKG  L H T  +
Sbjct: 158 YQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACV 217

Query: 197 FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSL 256
             + A   +F          L+V+P  H FG  T +   +     +VLM RF+ +  L  
Sbjct: 218 RFSHARDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGF-RVVLMYRFEEELFLRS 276

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE 316
           ++  K+     VPT++     A+     K     LH   SGGA L  EV   V ++F + 
Sbjct: 277 LQDYKIQSALLVPTLF--SFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLP 334

Query: 317 -ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVR 374
            I +GYGL+ET+  +    P+   KPG++G  +   E K+VD +   T+     GE+ VR
Sbjct: 335 GIRQGYGLTETTSAILIT-PEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVR 393

Query: 375 GHCVMKGYHNRPEA-NAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
           G  +M GY N PEA NA + +DGW  +GDIA  DE+  +FI+DR K +I   GY V P E
Sbjct: 394 GPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAE 453

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAW-AKERLAAYKYP 492
           +E +L+ HP +  A V G+P D  GE   A V+   G T+TE E++ + A +   A K  
Sbjct: 454 LESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLR 513

Query: 493 RIVEFRTELPMTATGKILKRELR 515
             V F  E+P   TGK+  R++R
Sbjct: 514 GGVVFVDEVPKGLTGKLDARKIR 536


>4CL1_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 1;       
            Short=4CL 1;         Short=Os4CL1;       
           EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA synthase 1;
          Length = 564

 Score =  184 bits (468), Expect = 1e-48
 Identities = 145/481 (30%), Positives = 216/481 (44%), Gaps = 52/481 (10%)

Query: 61  NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
           N P F   +F A + GA V   N + TP EIE  L  +GA  +                 
Sbjct: 100 NSPEFVLSFFAASRVGAAVTTANPMSTPHEIESQLAAAGATVV----------------- 142

Query: 121 AFQEVAECELYIDLPAAA-GATTSAI-----PGAETFWAALNGQP-------GEFESVRT 167
               + E      LP+ + GA T  +      G   FW  L  +                
Sbjct: 143 ----ITESMAADKLPSHSHGALTVVLIDERRDGCLHFWDDLMSEDEASPLAGXXXXXXXX 198

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPD----SHDVFLTVLPLF 223
                  + Y+SGTTG PKG  LTH +L  +   +  +  + P+    + DV L  LP+F
Sbjct: 199 XXXXXXALPYSSGTTGLPKGVMLTHRSL--STSVAQQVDGENPNIGLHAGDVILCALPMF 256

Query: 224 HIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD-- 281
           HI+   T+M   L     +V+M RFD    + L+E+ +                      
Sbjct: 257 HIYSLNTIMMCGLRVGAAIVVMRRFDLAAMMDLVERHRXXXXXXXXXXXXXXXXXXXXXX 316

Query: 282 HDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS----FNNPKR 337
            D+  +   L  A   G  +      K+    G  + +GYG++E  PV+S    F     
Sbjct: 317 RDLSSVRMVLSGAAPMGKDIEDAFMAKLP---GAVLGQGYGMTEAGPVLSMCLAFAKEPF 373

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVM-RD 395
           K K G+ G  +   E+K++D +     G   PGEI +RG  +MKGY N PEA    +  +
Sbjct: 374 KVKSGACGTVVRNAELKIIDPDTGKSLGRNLPGEICIRGQQIMKGYLNNPEATKNTIDAE 433

Query: 396 GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHD 455
           GW  TGDI   D++   FI+DR K++I   G+ V P E+E +L+THP ++ AAVVG   +
Sbjct: 434 GWLHTGDIGYVDDDDEIFIVDRLKEIIKYRGFQVAPAELEALLITHPSIADAAVVGKQIE 493

Query: 456 TH-GEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              GE   AFV   EG+ L+ED++  +  + +  YK  R V F  ++P   +GKIL++EL
Sbjct: 494 PEIGEIPVAFVAKTEGSELSEDDVKQFVAKEVIYYKKIREVFFVDKIPKAPSGKILRKEL 553

Query: 515 R 515
           R
Sbjct: 554 R 554


>ACSM4_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM4,
           mitochondrial;         EC=6.2.1.2;AltName:
           Full=Olfactory specific medium-chain acyl CoA
           synthetase;
          Length = 580

 Score =  184 bits (467), Expect = 1e-48
 Identities = 147/535 (27%), Positives = 244/535 (45%), Gaps = 52/535 (9%)

Query: 8   LEDGARNRPERDAIVF-----GDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPN 61
           L++ +  RP   A+ +      +++ ++  +  ++ + AN+L    G++ GD+VA+  P 
Sbjct: 64  LKEKSGERPANPALWWVNGKGDEVKWSFQELGSLSRKAANVLTKPCGLQRGDRVAVILPR 123

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
           +P +  +    ++ G V +P  + LT ++I Y L+ S AK + A          E    A
Sbjct: 124 IPEWWLINVACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVA---------SEEVAPA 174

Query: 122 FQEVA-ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
              +A EC    +L      +     G  +F   L     E   V+T   +   I +TSG
Sbjct: 175 VDSIASECP---NLKTKLLVSPHRWDGWLSFQELLQSASEEHNCVQTGSQEPMAIYFTSG 231

Query: 181 TTGQPKGAQLTHTNL---------LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
           TTG PK AQ + ++L          +  + SS +     D+  +   +  +F     T +
Sbjct: 232 TTGSPKMAQHSQSSLGIGYALCGRYWLDLTSSDIMWNMSDTGWIKAAIGSVF----STWL 287

Query: 232 MNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QT 290
             A ++ H     M +F+ D  L  +    +T     PT+Y  L+      D+K+   + 
Sbjct: 288 RGACVFVHR----MAQFNTDTFLDTLTSYPITTLCSAPTVYRMLVQ----QDLKRYQFKR 339

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   ++GG  L  EV  + K + G+E+ EGYG +E   ++  N    + KPGS+G  +  
Sbjct: 340 LRHCLTGGEPLNPEVLEQWKAQTGLELYEGYGQTEVG-IICANRKGEEIKPGSMGKGVVP 398

Query: 351 VEMKLVDENFNTIEGEGPGEIAVR-----GHCVMKGYHNRPEANAQVMRDGWFRTGDIAR 405
            +++++DE+ N +     GEIA+R       C    Y + PE     +R  ++ TGD   
Sbjct: 399 YDVQIIDEHGNILPSGKEGEIALRLGSDRPFCFFSEYVDNPEKTDATIRRNFYITGDRGV 458

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
            D++G+ + + R+ D+II  GY + P E+E  L+ HP          P    GE +KAF+
Sbjct: 459 MDDDGYLWFVGRADDVIISSGYRIGPFEVESALIEHPXXXXXXXXXXPDPIRGEVVKAFI 518

Query: 466 IPA-----EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + A             EL    K   A YKYPR VEF  ELP T TGKI +  LR
Sbjct: 519 VLAAPFKSSNREKLTAELQDHVKNSTAPYKYPRKVEFVQELPKTITGKIKRNVLR 573


>4CL2_SOYBN RecName: Full=4-coumarate--CoA ligase 2;       
           Short=4CL 2;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 2;
          Length = 562

 Score =  183 bits (465), Expect = 3e-48
 Identities = 148/502 (29%), Positives = 233/502 (46%), Gaps = 36/502 (7%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           YA  ++I++++A  L + GI  GD V +   N   F F +      GAV    N   T  
Sbjct: 70  YADTHLISSKIAAGLSNLGILKGDVVMILLQNSADFVFSFLAISMIGAVATTANPFYTAP 129

Query: 90  EIEYHLRDSGAKALFA---FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIP 146
           EI      S AK +     +        G +  + F+ V      +D P       S + 
Sbjct: 130 EIFKQFTVSKAKLIITQAMYVDKLRNHDGAKLGEDFKVVT-----VDDPPENCLHFSVLS 184

Query: 147 GAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALF 206
            A            +   V    DD   + ++SGTTG PKG  LTH +L  +   +  + 
Sbjct: 185 EANE---------SDVPEVEIHPDDAVAMPFSSGTTGLPKGVILTHKSLTTSV--AQQVD 233

Query: 207 DQAPD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKV 262
            + P+    + DV L VLPLFHIF   +++  AL     ++LM +F+    L L+++ + 
Sbjct: 234 GENPNLYLTTEDVLLCVLPLFHIFSLNSVLLCALRAGSAVLLMQKFEIGTLLELIQRHRX 293

Query: 263 TIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-E 319
                               D D+  I   L    SG A L  E+   ++ +    +L +
Sbjct: 294 XXXXXXXXXXXXXXKNPMVADFDLSSIRLVL----SGAAPLGKELEEALRNRMPQAVLGQ 349

Query: 320 GYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVR 374
           GYG++E  PV+S    F     + K GS G  +   E+K+VD E   ++    PGEI +R
Sbjct: 350 GYGMTEAGPVLSMCLGFAKQPFQTKSGSCGTVVRNAELKVVDPETGRSLGYNQPGEICIR 409

Query: 375 GHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
           G  +MKGY N   A A  +  +GW  TGD+   D++   FI+DR K++I   G+ V P E
Sbjct: 410 GQQIMKGYLNDEAATASTIDSEGWLHTGDVGYVDDDDEIFIVDRVKELIKYKGFQVPPAE 469

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR 493
           +E +L++HP ++ AAVV       GE   AFV+ + G  LTE+ +  +  +++  YK   
Sbjct: 470 LEGLLVSHPSIADAAVVPQKDVAAGEVPVAFVVRSNGFDLTEEAVKEFIAKQVVFYKRLH 529

Query: 494 IVEFRTELPMTATGKILKRELR 515
            V F   +P + +GKIL+++LR
Sbjct: 530 KVYFVHAIPKSPSGKILRKDLR 551


>ACSF3_BOVIN RecName: Full=Acyl-CoA synthetase family member 3,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 586

 Score =  182 bits (462), Expect = 6e-48
 Identities = 154/500 (30%), Positives = 223/500 (44%), Gaps = 65/500 (13%)

Query: 53  DKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPEL 112
           ++V+L C N   F    + A  +G V VPL       ++EY ++DS +  + A    PE 
Sbjct: 97  ERVSLLCSNDVSFVVAQWAAWMSGGVAVPLYRKHPRAQLEYFIQDSRSSVVLA---GPE- 152

Query: 113 PLGERAWQAFQEVAECELYIDL--PAAAGATTSAIPGAETFWAALNGQPGE-FESVRTEG 169
                             +++L  P A            T +  +   P E     R   
Sbjct: 153 ------------------HVELLSPVAQKLGVXXXXXXXTVYHGVAEDPEEGLVLERNWR 194

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           D  A+IIYTSGTTG+PKG   TH N+   AV +  +   A    DV              
Sbjct: 195 DRGAMIIYTSGTTGRPKGVLSTHDNI--RAVVTGLVHKWAWTKDDVIXXXXXXXXXXXXX 252

Query: 230 TMMNAALYRHGTMVLMPRFDGD---EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQ 286
             +   L+   T V++P F      E     E  ++ +F  VPT+Y  L++    H  + 
Sbjct: 253 NKLLCPLWVGATCVMLPEFSAQLVWEKFLSSEAPQINVFMAVPTIYSKLMDYYDKHFTQP 312

Query: 287 ---------ISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKR 337
                      + +   VSG A+LP  V  K K   G  +LE YG++E    +S  NP  
Sbjct: 313 HVQDFVRAVCEEKIRLMVSGSAALPLPVLEKWKGITGHTLLERYGMTEIGMALS--NPLT 370

Query: 338 KAK-PGSIGLPIWGVEMKLVDENFNT------IEGEGP--------------GEIAVRGH 376
            A+ PGS+G P+ GVE+++V EN         I  EG               GE+ VRG 
Sbjct: 371 AARLPGSVGTPLPGVEVRIVSENPQKDSSPYLIHAEGSEENTKVTPGFEEKEGELLVRGP 430

Query: 377 CVMKGYHNRPE-ANAQVMRDGWFRTGDIARRDEEGFYFIIDR-SKDMIIRGGYNVYPREI 434
            V + Y ++PE   A    DGWF+TGD     ++G Y+I  R S D+I  GGY V   E+
Sbjct: 431 SVFREYWDKPEETKAAFTSDGWFKTGDTVVF-KDGCYWIRGRTSVDIIKSGGYKVSALEV 489

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRI 494
           E +L+ HP ++  AV+GVP  T G+ + A V   EG +L+  EL  WA+  LA Y  P  
Sbjct: 490 ERLLLAHPSITDVAVIGVPDMTWGQRVTAVVTLQEGHSLSHRELKEWARGVLAPYAVPSE 549

Query: 495 VEFRTELPMTATGKILKREL 514
           +    E+P    GK+ KR+L
Sbjct: 550 LLLVEEIPRNQMGKVNKRDL 569


>4CL4_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 4;       
            Short=4CL 4;         Short=Os4CL4;       
           EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA synthase 4;
          Length = 559

 Score =  182 bits (462), Expect = 6e-48
 Identities = 116/357 (32%), Positives = 190/357 (53%), Gaps = 15/357 (4%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSH----DVFLTVLPLFHI 225
           DDV  + Y+SGTTG PKG  LTH +L+ +   +  +  + P+ +    DV L +LPLFHI
Sbjct: 190 DDVVALPYSSGTTGLPKGVMLTHRSLVTSV--AQQVDGENPNLYFRREDVVLCLLPLFHI 247

Query: 226 FGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIK 285
           +   +++ A L     +V+M +FD    + L  +  VT+   VP +   +  A+      
Sbjct: 248 YSLNSVLLAGLRAGSAIVIMRKFDLGALVDLTRRHGVTVAPFVPPIVVEI--AKSPRVTA 305

Query: 286 QISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYGLSETSPVVS----FNNPKRKAK 340
               ++   +SG A +  ++      K    +L +GYG++E  PV++    F     + K
Sbjct: 306 DDLASIRMVMSGAAPMGKDLQDAFMAKIPNAVLGQGYGMTEAGPVLAMCLAFAKEPFEVK 365

Query: 341 PGSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWF 398
            GS G  +   E+K+VD +     G    GEI +RG  +MKGY N PE+    + + GW 
Sbjct: 366 SGSCGTVVRNAELKIVDPDTGATLGRNQSGEICIRGEQIMKGYLNDPESTKNTIDKGGWL 425

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI   D++   FI+DR K++I   G+ V P E+E +L+THP +  AAVV +  +  G
Sbjct: 426 HTGDIGYVDDDDEIFIVDRLKEIIKYKGFQVPPAELEALLITHPDIKDAAVVPMIDEIAG 485

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           E   AF++  EG+ ++E+E+  +  + +  YK    V F   +P + +GKIL+++LR
Sbjct: 486 EVPVAFIVRIEGSAISENEIKQFVAKEVVFYKRLNKVFFADSIPKSPSGKILRKDLR 542


>4CL5_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 5;       
            Short=4CL 5;         Short=Os4CL5;       
           EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA synthase 5;
          Length = 539

 Score =  182 bits (461), Expect = 7e-48
 Identities = 145/504 (28%), Positives = 229/504 (45%), Gaps = 41/504 (8%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L++  V+ ++ +VA  L S G+  G  V L  PN   F   +  + + GAV    N L T
Sbjct: 51  LSFGDVDALSRRVAAGLSSIGVCHGSTVMLLLPNSVEFAVAFLASSRLGAVTTTANPLHT 110

Query: 88  PREIEYHLRDSGAKALF---AFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
           P EI   +  SGA  +    AF                     C  +  L AA G   SA
Sbjct: 111 PPEIAKQVAASGATVVVTEPAFVAKVSGLXXXXXXXXXXXXERCASFAGLAAADG---SA 167

Query: 145 IPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA 204
           +P                E      +D   + Y+SGTTG PKG  L+H  L+ +   +  
Sbjct: 168 LP----------------EVAIDVANDAVALPYSSGTTGLPKGVMLSHRGLVTSV--AQL 209

Query: 205 LFDQAPDSH----DVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKE 260
           +  + P+ H    DV L VLP+FH++   +++   +     +V+M RFD  + L L+E+ 
Sbjct: 210 VDGENPNLHLREDDVVLCVLPMFHVYSLHSILLCGMRAGAAIVVMKRFDTVKMLQLVERH 269

Query: 261 KVTIFAGVPTMYWGLL--NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL 318
            VTI   VP +   +   +A   HD+  I       +SG A +  E+   V  K    +L
Sbjct: 270 GVTIAPLVPPIVVEMAKSDALDRHDLSSIRMV----ISGAAPMGKELQDIVHAKLPNAVL 325

Query: 319 -EGYGLSETSPVVS----FNNPKRKAKPGSIGLPIWGVEMKLVDENFN-TIEGEGPGEIA 372
            +GYG++E  PV+S    F       K G+ G  +   E+K+VD +   ++    PGEI 
Sbjct: 326 GQGYGMTEAGPVLSMCMAFAKEPTPVKSGACGTVVRNAELKIVDPDTGLSLPRNQPGEIC 385

Query: 373 VRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
           +RG  +MKGY N PEA  + + +DGW  T                R K++I   G+ V P
Sbjct: 386 IRGKQIMKGYLNNPEATEKTIDKDGWLHTXXXXXXXXXXXXXXXXRLKELIKYKGFQVAP 445

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKY 491
            E+E +L+            +  D+ GE   AFV+  +G+ +T+DE+  +  +++  YK 
Sbjct: 446 AELEAMLIXXXXXXXXXXXPMKDDSCGEIPVAFVVARDGSGITDDEIKQYVAKQVVFYKR 505

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
              + F   +P   +GKIL+++LR
Sbjct: 506 LHKIFFVDAIPKAPSGKILRKDLR 529


>MENE_LISIN RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 467

 Score =  180 bits (457), Expect = 2e-47
 Identities = 144/509 (28%), Positives = 232/509 (45%), Gaps = 52/509 (10%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           L+   R  P   A+VF   +  +  +     ++A  L +RGIR  + VAL   N      
Sbjct: 5   LQKRVRLSPGETALVFEGKQETFEEIYEAVEKLAGKLFARGIRKDEMVALLGKNDRMTFL 64

Query: 68  VYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAE 127
           +     + GA+ + LN  LT +EI + L ++  K +       +      +++  Q+   
Sbjct: 65  LIHALQQLGAITLFLNNRLTKKEITFQLANAEVKQVIVADAFVDKVTSGISYEELQQ--- 121

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
                        TT   P     W          +  RT     A ++YTSGTTG+PKG
Sbjct: 122 -------------TTYVEPDLCKTW----------DLSRT-----ASVMYTSGTTGKPKG 153

Query: 188 AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR 247
              T+ N  ++AV+S  + +      D +L  +P+FHI G + MM + +Y    + L   
Sbjct: 154 VMQTYENHWWSAVSS--VLNLGLTEKDSWLCAVPIFHISGLSIMMRSVIYGI-PVYLEEH 210

Query: 248 FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR 307
           FD ++   L+E  K++  + V +M   LL  QG          + T + GG      V  
Sbjct: 211 FDEEKITQLLESGKISTISVVTSMLERLLKIQGG----SYHPNVRTVLLGGGPANKAVLE 266

Query: 308 KVKEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGE 366
             K++  I +++ +G++ET+  +    PK    K GS G  ++  E+K+ D+        
Sbjct: 267 ICKQR-DIPLVQSFGMTETASQIVTLPPKDALNKIGSSGKALFPAEVKIADD-------- 317

Query: 367 GPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
             GEI ++G  +  GY +  +A A+   DGWF+TGDI   DEEGF F+++R  D+II GG
Sbjct: 318 --GEILLKGPSITPGYLHNEKATAKAFIDGWFKTGDIGYLDEEGFLFVLERRSDLIISGG 375

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERL 486
            N+YP EIE V+            G      G    AF++  EG    E  L    +  L
Sbjct: 376 ENIYPTEIEHVIGXXXXXXXXXXXGKSDAKWGSVPVAFIVVNEG--FDEGVLKDICQTNL 433

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A++K P+ +     LP TA+GKI + +L+
Sbjct: 434 ASFKIPKQITIVEHLPKTASGKIQRNKLK 462


>ACSM5_RAT RecName: Full=Acyl-coenzyme A synthetase ACSM5,
           mitochondrial;         EC=6.2.1.2;Flags: Precursor;
          Length = 578

 Score =  180 bits (457), Expect = 2e-47
 Identities = 146/495 (29%), Positives = 234/495 (47%), Gaps = 36/495 (7%)

Query: 37  ANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95
           + + AN+L    G++PGD++ L  P +P +       ++ G V++P    LT ++++Y L
Sbjct: 98  SRKAANILEGACGLKPGDRLMLVLPRLPEWWLTIVACMRTGVVMIPGISQLTQKDLKYRL 157

Query: 96  RDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAAL 155
           + +  K++              A       A+C     L +    + ++ PG   F   L
Sbjct: 158 QAARVKSIITSDAL--------APHVDAISADCP---SLQSRLLVSDTSRPGWINFRELL 206

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDV 215
                E   +RT   D   I +TSGTTG PK  + +  +     VAS        +S D+
Sbjct: 207 RVASPEHNCLRTRSGDSMAIYFTSGTTGTPKMVEHSQCSYGLGFVASGRRLMALTES-DI 265

Query: 216 FLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALSLMEKEKVTIFAGVPTMY 272
           F        +    T+ +A  + +G  V    +P+ D    L+ + +  +T    VPT++
Sbjct: 266 FWNTTDTGWVKAAWTLFSA--WANGACVFVHELPQVDAQTILNTLCRFPITTICCVPTLF 323

Query: 273 WGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS 331
             L+      D+ +   Q L   ++GG +L ++V  K K + G+EI EGYG SET  ++ 
Sbjct: 324 RLLVQ----EDLTRYKFQCLRHCLAGGEALNSDVRDKWKNQTGLEIHEGYGQSETV-LIC 378

Query: 332 FNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR-----GHCVMKGYHNRP 386
            N      K GS+G      ++++VDE  N +     G IA+R       C+   Y + P
Sbjct: 379 GNFRGSTIKSGSMGKASPPYDVQIVDEEGNVLPPGKEGNIAIRIKPTRPFCLFNCYLDNP 438

Query: 387 EANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSL 446
           E  A   +  ++ TGD A  DE+G+++ + R+ D+I    Y + P E+E  L  HP V  
Sbjct: 439 EKTAASEQGDFYITGDRAHMDEDGYFWFVGRNDDVINSSSYRIGPVEVESALAEHPAVLE 498

Query: 447 AAVVGVPHDTHGEEIKAFVI--PA----EGATLTEDELIAWAKERLAAYKYPRIVEFRTE 500
           +AVV  P    GE +KAF++  PA    +   LT  EL    K   A YKYPR V F +E
Sbjct: 499 SAVVSSPDPIRGEVVKAFIVLSPAYVSHDPEALTR-ELQEHVKTVTAPYKYPRKVAFISE 557

Query: 501 LPMTATGKILKRELR 515
           LP T +GKIL+ +LR
Sbjct: 558 LPKTVSGKILRSKLR 572


>4CL4_ARATH RecName: Full=4-coumarate--CoA ligase 4;       
           Short=4CL 4;         EC=6.2.1.12;AltName:
           Full=4-coumarate--CoA ligase isoform 5;
          Length = 570

 Score =  180 bits (457), Expect = 2e-47
 Identities = 140/498 (28%), Positives = 229/498 (45%), Gaps = 20/498 (4%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L YA V     ++A  +   GIR GD V L  PN P F   +      GAV    N   T
Sbjct: 74  LTYADVQTNMRRIAAGIHRLGIRHGDVVMLLLPNSPEFALSFLAVAYLGAVSTTANPFYT 133

Query: 88  PREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPG 147
             EI    + S AK +       +  L ++      +     + +               
Sbjct: 134 QPEIAKQAKASAAKMIIT-----KKCLVDKLTNLKND-GVLIVCLXXXXXXXXXXXXXXX 187

Query: 148 AETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFD 207
              F         E    +   +D   + Y+SGTTG PKG  +TH  L+ +   +  +  
Sbjct: 188 XXXFTELTQADETELLKPKISPEDTVAMPYSSGTTGLPKGVMITHKGLVTSI--AQKVDG 245

Query: 208 QAPD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVT 263
           + P+    ++DV L  LP+FHI+    +M +A+     ++++PRF+ +  + L+++ K  
Sbjct: 246 ENPNLNFTANDVILCFLPMFHIYALDALMLSAMRTGAALLIVPRFELNLVMELIQRYKXX 305

Query: 264 IFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYG 322
                       + +      +    ++   +SG A+L  E+   V+ KF   I  +GYG
Sbjct: 306 XXXXXXXXXLAFIKSPETE--RYDLSSVRIMLSGAATLKKELEDAVRLKFPNAIFGQGYG 363

Query: 323 LSETSPV---VSFNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCV 378
           ++E+  V   ++F     K K G+ G  I   EMK+VD E   ++     GEI VRGH +
Sbjct: 364 MTESGTVAKSLAFAKNPFKTKSGACGTVIRNAEMKVVDTETGISLPRNKSGEICVRGHQL 423

Query: 379 MKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEV 437
           MKGY N PEA A+ + +DGW  T                R K++I   GY V P E+E +
Sbjct: 424 MKGYLNDPEATARTIDKDGWLHTXXXXXXXXXXXXXXXXRLKELIKFKGYQVAPAELEAL 483

Query: 438 LMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEF 497
           L++HP +  AAVV +  +   E   AFV  ++G+ LTED++ ++  +++  YK  ++V F
Sbjct: 484 LISHPSIDDAAVVAMKDEVADEVPVAFVARSQGSQLTEDDVKSYVNKQVVHYKRIKMVFF 543

Query: 498 RTELPMTATGKILKRELR 515
              +P   +GKIL+++LR
Sbjct: 544 IEVIPKAVSGKILRKDLR 561


>LUCI_LUCCR RecName: Full=Luciferin 4-monooxygenase;       
           Short=Luciferase;         EC=1.13.12.7;
          Length = 548

 Score =  180 bits (456), Expect = 3e-47
 Identities = 127/366 (34%), Positives = 193/366 (52%), Gaps = 14/366 (3%)

Query: 158 QPGEFESVRTEG-DDVAVIIYTSGTTGQPKGAQLTHTNLLFN-AVASSALFDQAPDSHDV 215
           Q   F++V  +  + VA+I+ +SG+TG PKG QLTH N +   + A   ++         
Sbjct: 179 QASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENTVTRFSHARDPIYGNQVSPGTA 238

Query: 216 FLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGL 275
            LTV+P  H FG  T +   +     +V++ +FD +  L  ++  K T    VPT++  +
Sbjct: 239 VLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTSVILVPTLF-AI 296

Query: 276 LNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSFNN 334
           LN     +   +S  +  A SGGA L  EV   V  +F +  + +GYGL+ET+  +    
Sbjct: 297 LNKSELLNKYDLSNLVEIA-SGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIIT- 354

Query: 335 PKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGP---GEIAVRGHCVMKGYHNRPEANAQ 391
           P+   KPG+ G  +   + K++D   +T +  GP   GE+ V+G  +MKGY N PEA  +
Sbjct: 355 PEGDDKPGASGKVVPLFKAKVID--LDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKE 412

Query: 392 VM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV 450
           ++  +GW  TGDI   DEE  +FI+DR K +I   GY V P E+E VL+ HP +  A V 
Sbjct: 413 LIDEEGWLHTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPSIFDAGVA 472

Query: 451 GVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR-IVEFRTELPMTATGKI 509
           GVP    GE   A V+   G  +TE E++ +   +++  K  R  V F  E+P   TGKI
Sbjct: 473 GVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAKRLRGGVRFVDEVPKGLTGKI 532

Query: 510 LKRELR 515
             R +R
Sbjct: 533 DGRAIR 538


>LUCI_LUCLA RecName: Full=Luciferin 4-monooxygenase;       
           Short=Luciferase;         EC=1.13.12.7;
          Length = 548

 Score =  179 bits (455), Expect = 4e-47
 Identities = 144/482 (29%), Positives = 231/482 (47%), Gaps = 22/482 (4%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           L + G+    ++AL   N   F       L  G  V P N + T RE+ + L  S    +
Sbjct: 69  LKNYGLVVDGRIALCSENCEEFFIPVLAGLFIGVGVAPTNEIYTLRELVHSLGISKPTIV 128

Query: 104 FAFT-GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF 162
           F+   G  ++   ++   A + +   +  +D               + F      Q  + 
Sbjct: 129 FSSKKGLDKVITVQKTVTAIKTIVILDSKVDY--------RGYQSMDNFIKKNTPQGFKG 180

Query: 163 ESVRT----EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN-AVASSALFDQAPDSHDVFL 217
            S +T      + VA+I+ +SG+TG PKG QLTH N +   + A   ++          L
Sbjct: 181 SSFKTVEVNRKEQVALIMNSSGSTGLPKGVQLTHENAVTRFSHARDPIYGNQVSPGTAIL 240

Query: 218 TVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLN 277
           TV+P  H FG  T +   L     +V++ +FD +  L  ++  K +    VPT++  +LN
Sbjct: 241 TVVPFHHGFGMFTTLGY-LTCGFRIVMLTKFDEETFLKTLQDYKCSSVILVPTLF-AILN 298

Query: 278 AQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSFNNPK 336
                D   +S  +  A SGGA L  E+   V  +F +  + +GYGL+ET+  +    P+
Sbjct: 299 RSELLDKYDLSNLVEIA-SGGAPLSKEIGEAVARRFNLPGVRQGYGLTETTSAIIIT-PE 356

Query: 337 RKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-R 394
              KPG+ G  +   + K++D +   T+     GE+ V+G  +MKGY + PEA  +++  
Sbjct: 357 GDDKPGASGKVVPLFKAKVIDLDTKKTLGPNRRGEVCVKGPMLMKGYVDNPEATREIIDE 416

Query: 395 DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPH 454
           +GW  TGDI   DEE  +FI+DR K +I   GY V P E+E VL+ HP +  A V GVP 
Sbjct: 417 EGWLHTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPNIFDAGVAGVPD 476

Query: 455 DTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR-IVEFRTELPMTATGKILKRE 513
              GE   A V+  +G ++TE E++ +   +++  K  R  V F  E+P   TGKI  + 
Sbjct: 477 PIAGELPGAVVVLEKGKSMTEKEVMDYVASQVSNAKRLRGGVRFVDEVPKGLTGKIDGKA 536

Query: 514 LR 515
           +R
Sbjct: 537 IR 538


>ACSM3_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM3,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 3;
          Length = 586

 Score =  179 bits (454), Expect = 5e-47
 Identities = 141/509 (27%), Positives = 237/509 (46%), Gaps = 39/509 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           +MR ++  +  ++ + AN+L     ++ GD+V L  P VP +       L+ G V++P  
Sbjct: 92  EMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPGT 151

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
             LT ++I Y L+ S A  +   T     P  +         ++CE   +L +    + +
Sbjct: 152 TQLTQKDILYRLQSSKANCII--TNDVLAPAVDAV------ASKCE---NLHSKLIVSEN 200

Query: 144 AIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL-LFNAVAS 202
           +  G       +         V+T+ +++  I +TSGT+G PK    TH++  L  +V  
Sbjct: 201 SREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNG 260

Query: 203 SALFDQAP-----DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLM 257
               D  P     ++ D          +F    +  A ++ H     +PRF+    L  +
Sbjct: 261 RFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPW-IQGACVFTHH----LPRFEPTSILQTL 315

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIE 316
            K  +T+F   PT+Y  L+     +DI     ++L   VS G  +  +V  K + K G++
Sbjct: 316 SKYPITVFCSAPTVYRMLVQ----NDITSYKFKSLKHCVSAGEPITPDVTEKWRNKTGLD 371

Query: 317 ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAV--- 373
           I EGYG +ET  ++  N    K KPGS+G P    ++K+VD N N +     G+I +   
Sbjct: 372 IYEGYGQTETV-LICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPGQEGDIGIQVL 430

Query: 374 --RGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
             R   +   Y + P   A  +R  ++ TGD    D++G+++ + R+ D+I+  GY + P
Sbjct: 431 PNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDVILSSGYRIGP 490

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI-PAEGATLTEDELIAWAKERL---- 486
            E+E  L  HP          P    GE +KAFV+   +  +  +++LI   +E +    
Sbjct: 491 FEVENALNEHPXXXXXXXXXXPDPIRGEVVKAFVVLNPDYKSHDQEQLIKEIQEHVKKTT 550

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YKYPR VEF  ELP T +GK  + ELR
Sbjct: 551 APYKYPRKVEFIQELPKTISGKTKRNELR 579


>ACSM5_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM5,
           mitochondrial;         EC=6.2.1.2;Flags: Precursor;
          Length = 579

 Score =  179 bits (453), Expect = 6e-47
 Identities = 146/493 (29%), Positives = 231/493 (46%), Gaps = 32/493 (6%)

Query: 37  ANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95
           + + AN+L    G++PGD++ L  P +P +  V    ++ G V++P    LT ++++Y L
Sbjct: 99  SRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRL 158

Query: 96  RDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAAL 155
           + S AK++              A +     AEC     L      + S+ PG   F   L
Sbjct: 159 QASRAKSIITSDSL--------APRVDAISAECP---SLQTKLLVSDSSRPGWLNFRELL 207

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDV 215
                E   +RT+  D   I +TSGTTG PK  + + ++     VAS   +    +S D+
Sbjct: 208 REASTEHNCMRTKSRDPLAIYFTSGTTGAPKMVEHSQSSYGLGFVASGRRWVALTES-DI 266

Query: 216 FLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALSLMEKEKVTIFAGVPTMY 272
           F        +    T+ +A  + +G+ +    +PR D    L+ + K  +T    VPT++
Sbjct: 267 FWNTTDTGWVKAAWTLFSA--WPNGSCIFVHELPRVDAKVILNTLSKFPITTLCCVPTIF 324

Query: 273 WGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSF 332
              L  Q D    Q  Q+L   ++GG +L  +V  K K + G+E+ EGYG SET  V+  
Sbjct: 325 --RLLVQEDLTRYQF-QSLRHCLTGGEALNPDVREKWKHQTGVELYEGYGQSETV-VICA 380

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR-----GHCVMKGYHNRPE 387
           N                  ++++VD+  N +     G +AVR       C    Y + PE
Sbjct: 381 NPXXXXXXXXXXXXASPPYDVQIVDDEGNVLPPGEEGNVAVRIRPTRPFCFFNCYLDNPE 440

Query: 388 ANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLA 447
             A   +  ++ TGD AR D++G+++ + R+ D+I    Y + P E+E  L  HP V  +
Sbjct: 441 KTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSYRIGPVEVESALAEHPAVLES 500

Query: 448 AVVGVPHDTHGEEIKAFVI--PAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELP 502
           A V  P    GE +KAF++  PA  +   E    EL    K   A YKYPR V F +ELP
Sbjct: 501 AAVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHVKRVTAPYKYPRKVAFVSELP 560

Query: 503 MTATGKILKRELR 515
            T +GKI + +LR
Sbjct: 561 KTVSGKIQRSKLR 573


>4HBCL_RHOPA RecName: Full=4-hydroxybenzoate--CoA/benzoate--CoA
           ligase;         EC=6.2.1.27;       
           EC=6.2.1.25;AltName: Full=4-hydroxybenzoyl-CoA
           synthetase;
          Length = 539

 Score =  177 bits (450), Expect = 1e-46
 Identities = 146/510 (28%), Positives = 226/510 (44%), Gaps = 23/510 (4%)

Query: 12  ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
           A  R  + A +     L+Y  +     +V  +L   G+   +++AL   +   FP +++G
Sbjct: 18  AEGRGGKIAFIDPQRSLSYGELRDAVARVGPMLARLGVEQENRIALVLKDTVDFPILFWG 77

Query: 72  ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
           A++AG V V LN  LT  +  Y L DS ++ +FA   +  LP+ E A      +      
Sbjct: 78  AIRAGIVPVLLNTRLTADQYRYLLEDSRSRVVFA--SSEFLPVIEEAAADLPHLRTIIAV 135

Query: 132 IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
            D PA      + +   +       G P       T  DD+A   Y+SGTTG PKG    
Sbjct: 136 GDAPAPTLQLANLLATEQE-----GGAPAA-----TCADDIAYWQYSSGTTGMPKGVMHV 185

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP-RFDG 250
           H++    A  +        D  DV  +   LF  +G    M   +    T VL P R   
Sbjct: 186 HSSPRVMAENAGRRIGYRED--DVVFSAAKLFFAYGLGNAMFCPMGIGATSVLYPERPTA 243

Query: 251 DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVK 310
           D     +   + T+   VPT+Y  +L A      + +   L   VS G  LPA+V    +
Sbjct: 244 DSVFDTLRLHQPTLLFAVPTLYAAML-ADPRSRTETLPDRLRLCVSAGEPLPAQVGLNWR 302

Query: 311 EKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            +FG +I+ G G +E   +   N P    + G+ G+P+ G  ++LV +    +  +  GE
Sbjct: 303 NRFGHDIVNGVGSTEMGHLFLTNLP-HAVEYGTSGVPVDGYRLRLVGDRGQDVADDEIGE 361

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + V G     GY N+ +         W RTGD   R  +G Y    R+ D+    G  V 
Sbjct: 362 LLVSGGSSAAGYWNQRDKTRTTFVGEWTRTGDKYHRRADGVYTYCGRTDDIFKVSGIWVS 421

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHG-EEIKAFVIPAEGATLTE----DELIAWAKER 485
           P EIE+ LM+H +V  AAV+    DT G  + KAF++ A    +      DEL    K  
Sbjct: 422 PFEIEQALMSHAKVLEAAVIPA-EDTDGLIKPKAFIVLASRGDIDPGALFDELKEHVKSA 480

Query: 486 LAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  +KYPR ++   +LP T++GK+ +  LR
Sbjct: 481 IGPWKYPRWIQIMDDLPKTSSGKLQRYLLR 510


>4CL_PINTA RecName: Full=4-coumarate--CoA ligase;         Short=4CL;
                   EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA
           synthase;
          Length = 537

 Score =  177 bits (450), Expect = 1e-46
 Identities = 142/514 (27%), Positives = 233/514 (45%), Gaps = 37/514 (7%)

Query: 17  ERDAIVFG--DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALK 74
           +R  ++ G  D    ++ V +I+ +VA  L               PN   F FV+ GA  
Sbjct: 40  DRPCLIDGATDRTYCFSEVELISRKVAAGLAKXXXXXXXXXXXXXPNCIEFAFVFMGASV 99

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDL 134
            GA+V   N    P EI    + +GA+ +       E            ++A+ + +  L
Sbjct: 100 RGAIVTTANPFYKPGEIAKQAKAAGARIIVTLAAYVE------------KLADLQSHDVL 147

Query: 135 PAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN 194
                       G +           +  +V+   DDV  + Y+SGTTG PKG  LTH  
Sbjct: 148 VITIDDAPKE--GCQHISVLTEADETQCPAVKIHPDDVVALPYSSGTTGLPKGVMLTHKG 205

Query: 195 LLFNAVASSALFDQAPD----SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDG 250
           L+ +   +  +  + P+    S DV L VLPLFHI+   +++  AL      ++M +F+ 
Sbjct: 206 LVSSV--AQQVDGENPNLYFHSDDVILCVLPLFHIYSLNSVLLCALRAGAATLIMQKFNL 263

Query: 251 DEALSLMEKEKVTIFAGVPTMYWGLLNAQ--GDHDIKQISQTLHTAVSGGASLPAEVARK 308
              L L++K KVT+   VP +   +  +     +D+  +       +SG A L  E+   
Sbjct: 264 TTCLELIQKYKVTVAPIVPPIVLDITKSPIVSQYDVSSV----RIIMSGAAPLGKELEDA 319

Query: 309 VKEKFGIEIL-EGYGLSETSPVVSFNNPKRK----AKPGSIGLPIWGVEMKLVD-ENFNT 362
           ++E+F   I  +GYG++E  PV++ N    K     K GS G  +   ++K++D E   +
Sbjct: 320 LRERFPKAIFGQGYGMTEAGPVLAMNLAFAKNPFPVKSGSCGTVVRNAQIKILDTETGES 379

Query: 363 IEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDM 421
           +     GEI +RG  +MKGY N PE+ A  +  +GW  TGD+   D++   FI+DR K++
Sbjct: 380 LPHNQAGEICIRGPEIMKGYINDPESTAATIDEEGWLHTGDVEYIDDDEEIFIVDRVKEI 439

Query: 422 IIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAW 481
           I   G+             HP ++ AAVV   H+  GE   AFV+              +
Sbjct: 440 IKYKGFQXXXXXXXXXXXXHPSIADAAVVPQKHEEAGEVPVAFVV--XXXXXXXXXXXXF 497

Query: 482 AKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +++  YK    V F   +P + +GKIL+++LR
Sbjct: 498 VAKQVIFYKKIHRVYFVDAIPKSPSGKILRKDLR 531


>MENE_STAAW RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  177 bits (449), Expect = 2e-46
 Identities = 131/444 (29%), Positives = 218/444 (49%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E++  +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGTDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
            +      T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TMNGLLDNTMDIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTIIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATLIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAAS RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  177 bits (449), Expect = 2e-46
 Identities = 131/444 (29%), Positives = 218/444 (49%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E++  +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGTDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
            +      T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TMNGLLDNTMDIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTIIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATLIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>LUCI_PHOPE RecName: Full=Luciferin 4-monooxygenase;       
           Short=Luciferase;         EC=1.13.12.7;
          Length = 545

 Score =  177 bits (449), Expect = 2e-46
 Identities = 140/477 (29%), Positives = 225/477 (47%), Gaps = 20/477 (4%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G++  D +A+   N   F      +L  G +  P++     RE+ + L     + +F   
Sbjct: 70  GLKQNDTIAVCSENGLQFFLPLIASLYLGIIAAPVSDKYIERELIHSLGIVKPRIIFCSK 129

Query: 108 GTPELPLGERAWQAFQE-VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVR 166
            T +  L  ++   + E +   +L  DL             ++        +P  F    
Sbjct: 130 NTFQKVLNVKSKLKYVETIIILDLNEDLGGYQCLNNFISQNSDINLDVKKFKPNSFN--- 186

Query: 167 TEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN-AVASSALFDQAPDSHDVFLTVLPLFHI 225
              D VA+++++SGTTG  KG  LTH N++   +      F  A +     LTV+P  H 
Sbjct: 187 -RDDQVALVMFSSGTTGVSKGVMLTHKNIVARFSHCKDPTFGNAINPTTAILTVIPFHHG 245

Query: 226 FGQTTMMNAALYRHGTMV-LMPRFDGDEALSLMEKEKVTIFAGVPTM--YWGLLNAQGDH 282
           FG TT +    +  G  V LM  F+    L  ++  KV     VPT+  ++        +
Sbjct: 246 FGMTTTLG--YFTCGFRVALMHTFEEKLFLQSLQDYKVESTLLVPTLMAFFPKSALVEKY 303

Query: 283 DIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYGLSETSPVVSFNNPKRKAKP 341
           D+  + +      SGGA L  E+   VK++F +  + +GYGL+ET+  V    P    +P
Sbjct: 304 DLSHLKEI----ASGGAPLSKEIGEMVKKRFKLNFVRQGYGLTETTSAVLIT-PDTDVRP 358

Query: 342 GSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-RDGWFR 399
           GS G  +    +K+VD     I G    GE+  +G  +MK Y+N  EA   ++ +DGW R
Sbjct: 359 GSTGKIVPFHAVKVVDPTTGKILGPNETGELYFKGDMIMKSYYNNEEATKAIINKDGWLR 418

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           +GDIA  D +G ++I+DR K +I   GY V P EIE +L+ HP +  A V G+P +  GE
Sbjct: 419 SGDIAYYDNDGHFYIVDRLKSLIKYKGYQVAPAEIEGILLQHPYIVDAGVTGIPDEAAGE 478

Query: 460 EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPR-IVEFRTELPMTATGKILKRELR 515
              A V+   G  L E  +  +   +++  K+ R  V+F  E+P  +TGKI ++ LR
Sbjct: 479 LPAAGVVVQTGKYLNEQIVQNFVSSQVSTAKWLRGGVKFLDEIPKGSTGKIDRKVLR 535


>4CL3_ORYSJ RecName: Full=Probable 4-coumarate--CoA ligase 3;       
            Short=4CL 3;         Short=Os4CL3;       
           EC=6.2.1.12;AltName: Full=4-coumaroyl-CoA synthase 3;
          Length = 554

 Score =  177 bits (449), Expect = 2e-46
 Identities = 135/482 (28%), Positives = 210/482 (43%), Gaps = 36/482 (7%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G+  GD V     N P F F +             N   TP E+      +GA+ +    
Sbjct: 73  GVGKGDVVMSLLRNCPEFAFSFXXXXXXXXXXXXXNPFYTPHEVHRQAEAAGARVIVT-- 130

Query: 108 GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAE---TFWAALNGQPGEFES 164
                           E    E   +  A  G     + GA      +            
Sbjct: 131 ----------------EACAVEKVREFAAERGVPVVTVDGAFDGCVEFRXXXXXXXXXXX 174

Query: 165 VRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSH----DVFLTVL 220
                     + Y+SGTTG PKG  LTH +L+ +   +  +  + P+ +    DV L +L
Sbjct: 175 XXXXXXXXXXLPYSSGTTGLPKGVMLTHRSLITSV--AQQVDGENPNLYFSKDDVILCLL 232

Query: 221 PLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG 280
           PLFHI+   +++ A L    T+V+M +FD    + L+ K  +TI   VP +   +  A+ 
Sbjct: 233 PLFHIYSLNSVLLAGLRAGSTIVIMRKFDLGALVDLVRKHNITIAPFVPPIVVEI--AKS 290

Query: 281 DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEIL-EGYGLSETSPVVS----FNNP 335
                +   ++   +SG A +  ++      K    +L +GYG++E  PV++    F   
Sbjct: 291 PRVTAEDLASIRMVMSGAAPMGKDLQDAFMAKIPNAVLGQGYGMTEAGPVLAMCLAFAKE 350

Query: 336 KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM- 393
             K K GS G  +   E+K+VD +  T  G    GEI +RG  +MKGY N PEA    + 
Sbjct: 351 PFKVKSGSCGTVVRNAELKIVDPDTGTSLGRNQSGEICIRGEQIMKGYLNDPEATKNTID 410

Query: 394 RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
            DGW  T                R K++I   G+ V P E+E +L+THP++  AAVV + 
Sbjct: 411 EDGWLHTXXXXXXXXXXXXXXXXRLKEIIKYKGFQVPPAELEALLITHPEIKDAAVVSMK 470

Query: 454 HDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRE 513
            D  GE   AF++  EG+ +TEDE+  +  + +  YK    V F   +P   +GKIL+++
Sbjct: 471 DDLAGEVPVAFIVRTEGSEITEDEIKKFVAKEVVFYKRINKVFFTDSIPKNPSGKILRKD 530

Query: 514 LR 515
           LR
Sbjct: 531 LR 532


>ACSM3_PONAB RecName: Full=Acyl-coenzyme A synthetase ACSM3,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 3;
          Length = 586

 Score =  177 bits (448), Expect = 2e-46
 Identities = 138/509 (27%), Positives = 232/509 (45%), Gaps = 39/509 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           ++R ++  +  ++ + AN+L     ++ GD+V L  P VP +       L+ G V++P  
Sbjct: 92  EVRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPGT 151

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
             LT ++I Y L+ S A  +        +              +CE   +L +    + +
Sbjct: 152 TQLTQKDILYRLQSSKANCI--------ITNXXXXXXXXXXXXKCE---NLHSKLIVSEN 200

Query: 144 AIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL-LFNAVAS 202
           +  G       +         V+T+ +++  I +TSGT+G PK    TH++  L  +V  
Sbjct: 201 SREGWGNLKEMMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNG 260

Query: 203 SALFDQAP-----DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLM 257
               D  P     ++ D          +F    +  A ++ H     +PRF+    L  +
Sbjct: 261 RFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPW-IQGACVFTHH----LPRFEPTSILQTL 315

Query: 258 EKEKVTIFAGVPTMYWGLL-NAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE 316
            K  +T+F   PT+Y  L+ N    +  K +       VS G  +  +V  K + K G++
Sbjct: 316 SKYPITVFCSAPTVYRMLVQNDMASYKFKSLKH----CVSAGEPITPDVTEKWRNKTGLD 371

Query: 317 ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAV--- 373
           I EGYG +ET  ++  N    K KPGS+G P    ++K+VD N N +     G+I +   
Sbjct: 372 IYEGYGQTETV-LICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPGQEGDIGIQVL 430

Query: 374 --RGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
             R   +   Y + P   A  +R  ++ TGD    DE+G+++ + R+ D+I+  GY + P
Sbjct: 431 PNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDEDGYFWFVARADDVILSSGYRIGP 490

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI-PAEGATLTEDELIAWAKERL---- 486
            E+E  L  HP          P    GE +KAFV+   +  +  +++LI   +E +    
Sbjct: 491 FEVENALNEHPXXXXXXXXXXPDPIRGEVVKAFVVLNPDYKSHDQEQLIKEIQEHVKKTT 550

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YKYPR VEF  ELP T +GK  + ELR
Sbjct: 551 APYKYPRKVEFIQELPKTISGKTKRNELR 579


>ACS2B_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2B,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 2B;
          Length = 577

 Score =  176 bits (447), Expect = 3e-46
 Identities = 146/511 (28%), Positives = 235/511 (45%), Gaps = 44/511 (8%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           ++  N+  ++  + Q AN+L    G++ GD+VA+  P VP +  V  G ++AG + +P  
Sbjct: 78  ELMWNFRELSENSQQAANVLSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGT 137

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGATT 142
           + +   +I Y L+ S AKA+ A         G+   Q    VA EC     L      + 
Sbjct: 138 IQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVASECP---SLRIKLLVSE 185

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
            +  G   F   LN        V T   + + I +TSGT+G PK A+ ++++L   A   
Sbjct: 186 KSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMD 245

Query: 203 SALFDQAPDSHDVFLTVLP---LFHIFG---QTTMMNAALYRHGTMVLMPRFDGDEALSL 256
           +        + D+  T+     + +I G   ++  + A  + H    L+P+FD    L  
Sbjct: 246 AGW--TGLQASDIMWTISDTGWILNILGSLLESWTLGACTFVH----LLPKFDPLVILKT 299

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +    +    G P +Y  LL      D+       L   ++GG SL  E     + + G+
Sbjct: 300 LSSYPIKSMMGAPIVYRMLLQ----QDLSSYKFPHLQNCLAGGESLLPETLENWRAQTGL 355

Query: 316 EILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG 375
           +I E YG +ET  +    +   K KPG +G      +++++D+  N +     G+I +R 
Sbjct: 356 DIREFYGQTETG-LTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRV 414

Query: 376 HCV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
             +       GY   P+  A  +R  ++  GD   +DE+G++  + R+ D+I   GY + 
Sbjct: 415 KPIRPIGIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIG 474

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA------EGATLTEDELIAWAKE 484
           P E+E  LM HP V   AV+  P    GE +KAFVI A      +   LT+ EL    K 
Sbjct: 475 PSEVENALMKHPAVVETAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTK-ELQQHVKS 533

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             A YKYPR +EF   LP T TGKI + +LR
Sbjct: 534 VTAPYKYPRKIEFVLNLPKTVTGKIQRTKLR 564


>MENE_STAAB RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  176 bits (445), Expect = 5e-46
 Identities = 131/444 (29%), Positives = 217/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA--FQEVAECELYI 132
           A   +  +N  LTP E++  +R    + +F       LPL  R +Q     ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMKNQMRSIDVQLIFC-----TLPLELRGFQIVLLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
            +      T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TMNGLLDNTMDIQYDTSNETVVPKDSPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYDLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPQMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDYEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 IPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_BACA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 487

 Score =  175 bits (443), Expect = 9e-46
 Identities = 142/505 (28%), Positives = 221/505 (43%), Gaps = 41/505 (8%)

Query: 12  ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYF 70
           A+  PER A++F + ++ +  +   + Q+A  L     ++ GD+ A+   N P   +   
Sbjct: 13  AQLTPERIALIFENKQMTFRELYHASKQMAARLSKYCSLKKGDRAAILLSNRPEMVYAVH 72

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECEL 130
                GA  V LN  L+ +E  + L DS AK L    G            A  +  + E 
Sbjct: 73  ACFLLGAEAVLLNTKLSKQERLFQLEDSQAKLLLMEDGFCREEYESAVATADVDELQAEE 132

Query: 131 YIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQL 190
             D+   A  T                            DD A ++YTSGTTG+PKG Q 
Sbjct: 133 AGDIEPEAYVTL---------------------------DDTATLMYTSGTTGRPKGVQQ 165

Query: 191 THTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDG 250
           T  N   +AV+S+   +      D +L  LPLFHI G + +  + +Y    +VL  +F  
Sbjct: 166 TFGNHYSSAVSSA--LNLGVTERDRWLIALPLFHISGLSALFKSVIYGM-PVVLHQKFSV 222

Query: 251 DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVK 310
            + L  +   +VTI + V TM  GLL      + +Q  ++L                + +
Sbjct: 223 TDVLDSISSHQVTIISAVQTMLSGLLA-----ETEQCPESLRCIXXXXXXXXXXXXEECR 277

Query: 311 EKFGIEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPG 369
            K    + + YGL+ET S +V+ +      K GS G P++  E++ ++++ N       G
Sbjct: 278 RK-QFPVFQSYGLTETCSQIVTLSPEFSMDKLGSAGKPLFSCEIR-IEKDGNPCAPFEHG 335

Query: 370 EIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNV 429
           EI V+G  VMKGY++R +AN     +GWF+TGD+   D+EGF +++DR  D+II GG N+
Sbjct: 336 EITVKGPNVMKGYYHRDDANQAAFHNGWFKTGDLGYLDDEGFLYVLDRRSDLIISGGENI 395

Query: 430 YPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAY 489
           Y                  V G      G+   AF               A+ +ERLA Y
Sbjct: 396 YXXXXXXXXXXXXXXXXXGVSGSEDPKWGKVPHAF--XXXXXXXXXXXXXAFCRERLAKY 453

Query: 490 KYPRIVEFRTELPMTATGKILKREL 514
           K P        LP  A+ K+++  L
Sbjct: 454 KIPAAFFEVDGLPRNASNKLMRHRL 478


>MENE_STAAN RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  174 bits (442), Expect = 1e-45
 Identities = 131/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAAM RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  174 bits (442), Expect = 1e-45
 Identities = 131/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAA9 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  174 bits (442), Expect = 1e-45
 Identities = 131/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAA2 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  174 bits (442), Expect = 1e-45
 Identities = 131/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAA1 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  174 bits (442), Expect = 1e-45
 Identities = 131/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>ACS2A_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM2A,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 2A;
          Length = 577

 Score =  174 bits (442), Expect = 1e-45
 Identities = 144/511 (28%), Positives = 232/511 (45%), Gaps = 44/511 (8%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           ++  N+  ++  + Q AN+L    G++ GD+VA+  P VP +  V  G ++AG + +P  
Sbjct: 78  ELMWNFRELSENSQQAANVLSGACGLQRGDRVAVVLPRVPEWWLVILGCIRAGLIFMPGT 137

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGATT 142
           + +   +I Y L+ S AKA+ A         G+   Q    VA EC     L      + 
Sbjct: 138 IQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVASECP---SLRIKLLVSE 185

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
            +  G   F   LN        V T   + + I +TSGT+G PK A+ ++++L   A   
Sbjct: 186 KSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMD 245

Query: 203 SALFDQAPDSHDVFLTV------LPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSL 256
           +        + D+  T+      L +     +   + A  + H    L+P+FD    L  
Sbjct: 246 AGW--TGLQASDIMWTISDTGWILNILCSLMEPWALGACTFVH----LLPKFDPLVILKT 299

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +    +    G P +Y  LL      D+       L   V+ G SL  E     + + G+
Sbjct: 300 LSSYPIKSMMGAPIVYRMLLQ----QDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGL 355

Query: 316 EILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG 375
           +I E YG +ET  +    +   K KPG +G      +++++D+  N +     G+I +R 
Sbjct: 356 DIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASCYDVQIIDDKGNVLPPGTEGDIGIRV 414

Query: 376 HCV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
             +       GY + P+  A  +R  ++  GD   +DE+G++  + R+ D+I   GY + 
Sbjct: 415 KPIRPIGIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRANDIINSSGYRIG 474

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA------EGATLTEDELIAWAKE 484
           P E+E  LM HP V   AV+  P    GE +KAFV+ A      +   LT+ EL    K 
Sbjct: 475 PSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPEQLTK-ELQQHVKS 533

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             A YKYPR +EF   LP T TGKI + +LR
Sbjct: 534 VTAPYKYPRKIEFVLNLPKTVTGKIQRAKLR 564


>DHBE_BACSU RecName: Full=2,3-dihydroxybenzoate-AMP ligase;       
           EC=6.3.2.-;AltName: Full=Dihydroxybenzoic
           acid-activating enzyme;
          Length = 539

 Score =  174 bits (441), Expect = 2e-45
 Identities = 155/518 (29%), Positives = 237/518 (45%), Gaps = 30/518 (5%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           LL D A    +R AI  G+   +Y  ++  A+++A      GI+  D+V +  PN+  F 
Sbjct: 30  LLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQMDRVVVQLPNIKEFF 89

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALF---AFTGTPELPLGERAWQAFQ 123
            V F   + GA+ V         EI Y    + A A     A++G     L  +      
Sbjct: 90  EVIFALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIIPDAYSGFDYRSLARQVQSKLP 149

Query: 124 EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
            +            AG     +P  +     L+ +P +   V++   DVA +  + G+TG
Sbjct: 150 TLKNI-------IVAGEAEEFLPLED-----LHAEPVKLPEVKSS--DVAFLQLSGGSTG 195

Query: 184 QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM-MNAALYRHGTM 242
             K    TH + +++   S  +     D   V+L  LP+ H +  ++  +   LY  G +
Sbjct: 196 LSKLIPRTHDDYIYSLKRSVEVCWL--DHSTVYLAALPMAHNYPLSSPGVLGVLYAGGRV 253

Query: 243 VLMPRFDGDEALSLMEKEKVTIFAGVP--TMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
           VL P    D+A  L+E+EKVTI A VP   M W +             Q L     GGA 
Sbjct: 254 VLSPSPSPDDAFPLIEREKVTITALVPPLAMVW-MXXXXXXXXXXXXXQVLQV---GGAK 309

Query: 301 LPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGV-EMKLVDEN 359
             AE AR+VK  FG  + + +G++E     +  +   +    + G P+    EM++ D++
Sbjct: 310 FSAEAARRVKAVFGCTLQQVFGMAEGLVNYTRLDDPEEIIVNTQGKPMSPYDEMRVWDDH 369

Query: 360 FNTIEGEGPGEIAVRGHCVMKGYHNRPEANA-QVMRDGWFRTGDIARRDEEGFYFIIDRS 418
              ++    G +  RG   ++GY+   E NA     DG++RTGDI R   +G+  +  R+
Sbjct: 370 DRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFYRTGDIVRLTRDGYIVVEGRA 429

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDEL 478
           KD I RGG  V   E+E  L+ HP V  AA+V +P    GE    F+IP + A     EL
Sbjct: 430 KDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAPKAA-EL 488

Query: 479 IAWAKER-LAAYKYPRIVEFRTELPMTATGKILKRELR 515
            A+ +ER LAAYK P  VEF    P T  GK+ K+ LR
Sbjct: 489 KAFLRERGLAAYKIPDRVEFVESFPQTGVGKVSKKALR 526


>ACSM4_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM4,
           mitochondrial;         EC=6.2.1.2;AltName:
           Full=Olfactory specific medium-chain acyl CoA
           synthetase;
          Length = 580

 Score =  174 bits (441), Expect = 2e-45
 Identities = 144/534 (26%), Positives = 236/534 (44%), Gaps = 50/534 (9%)

Query: 8   LEDGARNRPERDAIVF-----GDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPN 61
           L++ +  RP   A+ +      +++ ++  +  ++ + AN+L    G++ GD+VA+  P 
Sbjct: 64  LKEKSGERPANPALWWVNGKGDEVKWSFQELGSLSRKAANVLTKPCGLQRGDRVAVILPR 123

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
           +P +  +    ++ G V +P  + LT ++I Y L+ S AK + A          E A   
Sbjct: 124 IPEWWLINVACMRTGLVFMPGTIQLTRKDILYRLQASKAKCIVASE--------EVAPAV 175

Query: 122 FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGT 181
              V+EC     L      +     G   F   L     E   V T   +   I +TSGT
Sbjct: 176 DSIVSECP---SLKTKLLVSPHHWDGWLNFQELLQSASEEHNCVETGSQEPMAIYFTSGT 232

Query: 182 TGQPKGAQLTHTNL---------LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMM 232
           TG PK AQ +  +L          +  + SS +     D+  +   +  +F     T + 
Sbjct: 233 TGSPKMAQHSQGSLGIGYTLCGRYWLDLTSSDIMWNMSDTGWIKAAIGSVF----STWLR 288

Query: 233 NAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTL 291
            A ++ H     M +              +T     PT+Y  L+      D+K+   + L
Sbjct: 289 GACVFVHR----MAQXXXXXXXXXXXXYPITTLCSAPTVYRMLVQK----DLKRYQFKRL 340

Query: 292 HTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGV 351
              ++GG  L  EV  + K + G+E+ EGYG +E   ++  N      KPGS+G  +   
Sbjct: 341 RHCLTGGEPLNPEVLEQWKMQTGLELYEGYGQTEVG-IICANRKGEAIKPGSMGKGVVPY 399

Query: 352 EMKLVDENFNTIEGEGPGEIAVR-----GHCVMKGYHNRPEANAQVMRDGWFRTGDIARR 406
           +++++DEN N +     GEIA+R       C    Y + PE     +R  ++ TGD    
Sbjct: 400 DVQIIDENGNILPSGKEGEIALRLKSDRPFCFFSEYVDNPEKTDATIRRNFYVTGDRGVM 459

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           D++G+++ + R+ D+II  GY + P E+E  L+ HP          P    GE +KAF++
Sbjct: 460 DDDGYFWFVGRADDVIISSGYRIGPFEVESALIEHPXXXXXXXXXXPDPIRGEVVKAFIV 519

Query: 467 PAEGATLTEDELIA-----WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            A     +  E +        K   A YKYPR VEF  ELP T TGKI +  LR
Sbjct: 520 LAAPYKCSNREKLTAELQDHVKNSTAPYKYPRKVEFVQELPKTITGKIKRNVLR 573


>ACSM4_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM4,
           mitochondrial;         EC=6.2.1.2;Flags: Precursor;
          Length = 580

 Score =  174 bits (441), Expect = 2e-45
 Identities = 143/516 (27%), Positives = 236/516 (45%), Gaps = 53/516 (10%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           +++ ++  +  ++ + AN+L    G++ GD++A+  P +P +  V    ++ G + +P  
Sbjct: 86  EVKWSFRELGSLSRKAANVLTKPCGLQRGDRLAVILPRIPEWWLVNVACIRTGIIFMPGT 145

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGATT 142
           + LT ++I Y LR S AK + A          E    A + +  EC    DL      + 
Sbjct: 146 IQLTAKDILYRLRASKAKCIVA---------SEEVAPAVESIVLECP---DLKTKLLVSP 193

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL------- 195
            +  G  +F         E   V T   +   I +TSGTTG PK AQ + ++L       
Sbjct: 194 QSWNGWLSFQELFQFASEEHSCVETGSQEPMTIYFTSGTTGFPKMAQHSQSSLGIGFTLC 253

Query: 196 --LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA 253
              +  + SS +     D+  V   +  +F     + +  A ++ H     M +      
Sbjct: 254 GRYWLDLKSSDIIWNMSDTGWVKAAIGSVF----SSWLCGACVFVHR----MAQXXXXXX 305

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEK 312
                   +T     PT+Y  L+      D+K+   ++L   ++GG  L  EV  + + +
Sbjct: 306 XXXXXXYPITTLCSPPTVYRMLVQK----DLKRYKFKSLRHCLTGGEPLNPEVLEQWRVQ 361

Query: 313 FGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
            G+E+ EGYG +E   + + N   ++ KPGS+G  +   +++++DEN N +     GEIA
Sbjct: 362 TGLELYEGYGQTEVGMICA-NQKGQEIKPGSMGKGMLPYDVQIIDENGNVLPPGKEGEIA 420

Query: 373 VR-----GHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGY 427
           +R       C    Y + P+  A  +R  ++ TGD    D +G+++ + R+ D+II  GY
Sbjct: 421 LRLKPTRPFCFFSKYVDNPQKTAATIRGDFYVTGDRGVMDSDGYFWFVGRADDVIISSGY 480

Query: 428 NVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA--------EGATLTEDELI 479
            + P E+E  L+ HP          P    GE +KAFV+ A        E  TL   EL 
Sbjct: 481 RIGPFEVESALIEHPXXXXXXXXXXPDQIRGEVVKAFVVLAAPFKSYNPEKLTL---ELQ 537

Query: 480 AWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              K+  A YKYPR VEF  ELP T TGKI +  LR
Sbjct: 538 DHVKKSTAPYKYPRKVEFVQELPKTITGKIKRNVLR 573


>MENE_STAAR RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  172 bits (437), Expect = 4e-45
 Identities = 129/444 (29%), Positives = 215/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   +R    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMRSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGTDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
                   T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNGLLDNTMGIQYDTSNETVVPKDSPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYDLQKIL----LGGAKLSASMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      +G GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KKGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM GY   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +  A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGIIDAVCVGHPDDTWGQVPKLYFV--SESNISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>ACSM1_BOVIN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 1;
          Length = 577

 Score =  172 bits (436), Expect = 6e-45
 Identities = 153/502 (30%), Positives = 233/502 (46%), Gaps = 53/502 (10%)

Query: 39  QVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRD 97
           + AN+L    G++ GD++AL  P VP +  V  G ++ G + +P    +  ++I Y L+ 
Sbjct: 97  RTANVLTQTCGLQTGDRLALILPRVPEWWLVCVGCIRTGIIFMPGTTQMKAKDILYRLQV 156

Query: 98  SGAKALFAF-TGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGATTSAIPGAETFWAAL 155
           SGAKA+    T  PE+          + VA EC     L      +  +  G   F + +
Sbjct: 157 SGAKAIVTTDTLAPEV----------ESVAPECP---SLKTKLLVSDHSREGWLDFRSLV 203

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDV 215
                +   ++++  D   I +TSGTTG PK A+ +H           AL    P    +
Sbjct: 204 KSASPDHICIKSKTLDPMAIFFTSGTTGFPKMAKHSH---------GFALRSYFPACRKL 254

Query: 216 F-LTVLPLFHIFGQTTMMNAAL------YRHGTMVL---MPRFDGDEALSLMEKEKVTIF 265
             L +  +F     T  + AAL      +  G+ V    +P+FD    +    K  +T  
Sbjct: 255 LQLKMSDVFWCLSDTGWILAALGSLLEPWTAGSTVFAHHLPQFDPKVIIETFFKYPITQC 314

Query: 266 AGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSE 325
              P++Y  +L  Q ++   +     H    G A LP E   + K + G+ + + YG SE
Sbjct: 315 LAAPSVYRMIL--QQNYTSLRFPTLEHCCTGGEALLPEE-QEQWKRQTGVLLYQAYGQSE 371

Query: 326 TSPVVSFNNPK-RKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VM 379
           T   +S    +  K KPGS+G  I   +++++D+  N       G I +R        + 
Sbjct: 372 TG--ISCGTLRGMKIKPGSMGKAIPPFDIQIIDDKGNIQPPNTEGNIGIRIKPTRPIGLF 429

Query: 380 KGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLM 439
             Y N PE  A+V    ++ TGD A  DEEG+++ + RS D+I   GY V P E+E  L 
Sbjct: 430 MYYENNPEKTAEVECGDFYNTGDRATIDEEGYFWFLGRSDDVINASGYRVGPAEVENALA 489

Query: 440 THPQVSLAAVVGVPHDTHGEEIKAFVI------PAEGATLTEDELIAWAKERLAAYKYPR 493
            HP V+ +AVV  P    GE +KAF++        +   LT+ EL    K   A YKYPR
Sbjct: 490 EHPAVAESAVVSSPDPVRGEVVKAFIVLNPEFSSRDPGELTK-ELQQHVKSVTAPYKYPR 548

Query: 494 IVEFRTELPMTATGKILKRELR 515
            VEF +ELP T TGKI + ELR
Sbjct: 549 KVEFVSELPKTITGKIKRSELR 570


>ACSF3_HUMAN RecName: Full=Acyl-CoA synthetase family member 3,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 576

 Score =  172 bits (436), Expect = 6e-45
 Identities = 161/547 (29%), Positives = 226/547 (41%), Gaps = 79/547 (14%)

Query: 20  AIVFGDMRLNYALVNMIANQVANLLVSRGIRPG----------------DKVALACPNVP 63
           A+ FGD     ALV+         L SR +R                  ++V+  C N  
Sbjct: 50  ALAFGD---RIALVDQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDA 106

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPEL--PLGERAWQA 121
            +    + +  +G V VPL       ++EY + DS +  + A     EL  P+  +    
Sbjct: 107 SYVVAQWASWMSGGVAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVP 166

Query: 122 FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGT 181
                       LP      T              G        R +G   A+IIYTSGT
Sbjct: 167 L-----------LPLTPAIYTGXXXXXXXXXXXXQGW-------RNKG---AMIIYTSGT 205

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
           TG+PKG   TH N+   AV +  +   A    DV                +   L+   T
Sbjct: 206 TGRPKGVLSTHQNI--RAVVTGLVHKWAWTKDDVIXXXXXXXXXXXXXNALLCPLWVGAT 263

Query: 242 MVLMPRFDGD---EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV--- 295
            V+MP F      E     E  ++ +F  VPT+Y  L+     H  +  +Q    AV   
Sbjct: 264 CVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKLMEYYDRHFTQPHAQDFLRAVCEE 323

Query: 296 ------SGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
                 SG A+LP  V  K K   G  +LE YG++E    +S         PGS+G P+ 
Sbjct: 324 KIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEIGMALSGPLTTAVRLPGSVGTPLP 383

Query: 350 GVEMKLVDENFN------TIEGEGP--------------GEIAVRGHCVMKGYHNRPEAN 389
           GV++++V EN        TI  EG               GE+ VRG  V + Y N+PE  
Sbjct: 384 GVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEEKEGELLVRGPSVFREYWNKPEET 443

Query: 390 AQVMR-DGWFRTGDIARRDEEGFYFIIDR-SKDMIIRGGYNVYPREIEEVLMTHPQVSLA 447
                 DGWF+TGD     ++G Y+I  R S D+I  GGY V   E+E  L+ HP ++  
Sbjct: 444 KSAFTLDGWFKTGDTV-VFKDGQYWIRGRTSVDIIKTGGYKVSALEVEWHLLAHPSITDV 502

Query: 448 AVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATG 507
           AV+GVP  T G+ + A V   EG +L+  EL  WA+  LA Y  P  +    E+P    G
Sbjct: 503 AVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARNVLAPYAVPSELVLVEEIPRNQMG 562

Query: 508 KILKREL 514
           KI K+ L
Sbjct: 563 KIDKKAL 569


>ACSA_XANP2 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  172 bits (436), Expect = 6e-45
 Identities = 136/511 (26%), Positives = 229/511 (44%), Gaps = 26/511 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++   N++AN+L +RG+  GD+V +  P +P   F      + GA+   +    +
Sbjct: 107 ITYRELSSEVNKLANVLRNRGVEKGDRVTIYLPMIPEAAFAMLACARLGAIHSIVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  +   + D G+K +        G  ++PL      A  ++     ++ +    G    
Sbjct: 167 PDSLAGRVADCGSKCIITADEGLRGGRKVPLKANVDAAIAQINGGVDHVIVVRRTGGKVD 226

Query: 144 AIPGAETFWAALNGQ-PGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVA 201
            +PG + ++         E  +     +D   I+YTSG+TG+PKG    T   L++ ++ 
Sbjct: 227 MLPGRDVYYDEATAMVTDECPAEHVNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMT 286

Query: 202 SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS----LM 257
              +FD  P   D++     +  + G + ++   L    T ++        ++S    ++
Sbjct: 287 HQYIFDYHPG--DIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPNYPSVSRFWDVI 344

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV-SGGASLPAEVARKVKEKFGIE 316
           +K KV IF   PT    L+ A G+  +K           S G  +  E         G E
Sbjct: 345 DKHKVNIFYTAPTAIRSLMQA-GEEPVKXXXXXXXXXXGSVGEPINPEAWEWYYRVVGEE 403

Query: 317 ---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIA 372
              I++ +  +ET  ++    P   K KPGS   P +GV  ++VD     +EG   G + 
Sbjct: 404 RCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVMPEVVDAEGKVLEGACEGNLV 463

Query: 373 VRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGY 427
           +          + G H R E        G + TGD  RRD +GFY+I  R  D+I   G+
Sbjct: 464 IADSWPGQMRTVYGDHERFEQTYFSTYPGKYFTGDGCRRDADGFYWITGRVDDVINVSGH 523

Query: 428 NVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKE 484
            +   E+E  L+ HP+VS AAVVG PHD  G+ I A+V   +G   TE+   EL+ W + 
Sbjct: 524 RMGTAEVESALVAHPKVSEAAVVGFPHDIKGQGIYAYVTLMDGEEPTEELRKELVGWVRR 583

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            +     P +++F   LP T +GKI++R LR
Sbjct: 584 EIGPIASPDLIQFAPGLPKTRSGKIMRRILR 614


>MENE_STAAU RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAAT RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAAE RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAAC RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAA8 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_STAA3 RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 492

 Score =  170 bits (431), Expect = 2e-44
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 27/444 (6%)

Query: 75  AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ--AFQEVAECELYI 132
           A   +  +N  LTP E+   ++    + +F       LPL  R +Q  +  ++      I
Sbjct: 69  ANIEIAMINTRLTPNEMTNQMKSIDVQLIFC-----TLPLELRGFQIVSLDDIEFAGRDI 123

Query: 133 DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
              +    T                 P    +     DD+A I++TSGTTG  K    T 
Sbjct: 124 TTNSLLDNTMGIQYETSNETVVPKESPSNILNTSFNLDDIASIMFTSGTTGPQKAVPQTF 183

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDE 252
            N   +A+          D++  +L+VLP++HI G + ++ A +    T+ ++ +F+ ++
Sbjct: 184 RNHYASAIGCKESLGFDRDTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQ 240

Query: 253 ALSLMEKEKVTIFAGVP-TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKE 311
            L++++ E++T  + VP T+ W  L  QG H+   + + L     GGA L A +     +
Sbjct: 241 ILTMIKNERITHISLVPQTLNW--LMQQGLHEPYNLQKIL----LGGAKLSATMIETALQ 294

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            + + I   +G++ET        P+   A+P ++G+P   V++K+ + N      EG GE
Sbjct: 295 -YNLPIYNSFGMTETCSQFLTATPEMLHARPDTVGMPSANVDVKIKNPN-----KEGHGE 348

Query: 371 IAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
           + ++G  VM  Y   P        +G+F TGDIA  D EG+  I DR KD+II GG N+Y
Sbjct: 349 LMIKGANVMNVYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKDLIISGGENIY 407

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
           P +IE V    P +S A  VG P DT G+  K + +    + +++ +LIA+  + LA YK
Sbjct: 408 PYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSQHLAKYK 465

Query: 491 YPRIVEFRTELPMTATGKILKREL 514
            P+  E    LP T+TGK+ + +L
Sbjct: 466 VPKHFEKVDTLPYTSTGKLQRNKL 489


>MENE_ENTFA RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 485

 Score =  169 bits (429), Expect = 4e-44
 Identities = 148/507 (29%), Positives = 237/507 (46%), Gaps = 42/507 (8%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNM-IANQVANLLVSRGIRPGDK-VALACPNVPYF 65
           L    + RP+  A  F D    +  V   +++ VA     + + P +K VAL   N    
Sbjct: 4   LNKQVQKRPDHPAFYFQDESWTFLEVQQEVSHWVATY--QQVLAPEEKRVALFSKNSKEL 61

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
            F      + G  ++ LN  LT  E+ + L+D+  K +    G PE           Q +
Sbjct: 62  YFSILALWELGKELLFLNTHLTLAELTFQLKDAQVKTII---GAPET----------QAL 108

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
            E   ++D+        S     + F      QP + ESV       A I+YTSGTTGQP
Sbjct: 109 LEEISFVDVQPMIKKQHSL--SHQEFQ-----QPSDLESV-------ASIMYTSGTTGQP 154

Query: 186 KGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM 245
           KG      N L +A  +    +    + D +L  +PLFHI G + ++   L    ++ L 
Sbjct: 155 KGVLQRFKNHLASARGTQE--NMGITAEDCWLCAVPLFHISGLSIVVRQ-LVLGCSIRLY 211

Query: 246 PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
            +FD  +    +++ + T+ + V TM   LL+   +      S +    + GG  +  + 
Sbjct: 212 DKFDEQQVTQDLQEGRGTVISVVATMLQQLLSVYPEAGY---SASFKGMLLGGGPIAPDK 268

Query: 306 ARKVKEKFGIEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
             + +EK GI +++ YG++ET S VV+        K GS G P+  +++K+VDE      
Sbjct: 269 LAQCEEK-GIPVIQSYGMTETCSQVVALKFEDAALKIGSAGQPLKDMQIKIVDELGQEQP 327

Query: 365 GEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIR 424
            +  GEI ++G  V+ GY N+ +       DGWF+TGD+   D + + +++ R  ++II 
Sbjct: 328 EKQVGEILLKGPNVVSGYLNQRQPEKWTA-DGWFKTGDMGYLDAQSYLYLVSRLSELIIS 386

Query: 425 GGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKE 484
           GG N+YP E+E+VL     +  AAVVG P    G    A+VI  +  TL   ++      
Sbjct: 387 GGENIYPTEVEQVLQAITGIKAAAVVGEPDAQWGAVPVAYVISDQEITLA--QIQDQCSR 444

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILK 511
           +LA YK P+ + F    P TA+GKI K
Sbjct: 445 KLAKYKRPKRIYFCHSFPQTASGKIAK 471


>ACSA_NOVAD RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  169 bits (428), Expect = 5e-44
 Identities = 146/513 (28%), Positives = 235/513 (45%), Gaps = 31/513 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++    + ANLL ++G++ G++V +  P VP          + GA+   +    +
Sbjct: 108 ITYRQLHADVCRFANLLKAKGVQKGERVTIYLPMVPEAAVAMLACARIGAIHSIVFAGFS 167

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  +   + D  ++ +        G  ++PL     +A ++    +  I L    GA   
Sbjct: 168 PDALAGRITDCDSRIVLTSDEGLRGGRKVPLKANVDEALKQCPGVDTVIML-RRTGADVD 226

Query: 144 AIPGAETFWA-ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
            + G +  WA A+  Q  + +      +D   I+YTSG+TG+PKG  + HT   ++  AS
Sbjct: 227 FVEGRDIDWATAVAEQSADCQPEEMNAEDPLFILYTSGSTGKPKG--VLHTTGGYSVWAS 284

Query: 203 SA---LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALS 255
                +FD  P    ++     +  + G + ++   L    T V+   +P F D      
Sbjct: 285 MTHQYVFDYRPGQ--IYWCAADIGWVTGHSYVVYGPLMNGATTVMFEGVPNFPDASRFWQ 342

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEV---ARKVKE 311
           +++K KV IF G PT    L+  +GD  +K+ S+ +L    S G  +  E      KV  
Sbjct: 343 VVDKFKVEIFYGAPTALRALMR-EGDEWVKKTSRASLRLLGSVGEPINPEAWEWYHKVVG 401

Query: 312 KFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
                I++ +  +ET   +    P   A KPGS   P +GV+  LVD +   +EG   G 
Sbjct: 402 DSRCPIVDTWWQTETGGAMITPLPGATALKPGSASRPFFGVKPALVDNDGTFLEGATDGC 461

Query: 371 IAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRG 425
           + V          + G H R          G + TGD  RRDE+G+Y+I  R  D+I   
Sbjct: 462 LVVTDSWPGQMRTVWGDHERFFQTYFTTFKGLYFTGDGCRRDEDGYYWITGRIDDVINVS 521

Query: 426 GYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTEDELIAWA 482
           G+ +   EIE  L+ HP+V+ AAVVG+PHD  G+ I AFV      E   L   ELI W 
Sbjct: 522 GHRMGTAEIESALVAHPKVAEAAVVGMPHDIKGQGIYAFVTCNAEIEPDDLLRKELIQWV 581

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  +     P +++F   LP T +GKI++R LR
Sbjct: 582 RHEIGPIATPDVIQFAPGLPKTRSGKIMRRILR 614


>4CLL3_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 3;       
           EC=6.2.1.-;
          Length = 591

 Score =  169 bits (427), Expect = 6e-44
 Identities = 140/499 (28%), Positives = 228/499 (45%), Gaps = 25/499 (5%)

Query: 32  LVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREI 91
           L  ++A+  A L    G+R G  V L  PN   FP  +            +N   +P EI
Sbjct: 84  LRRLVASLAAGLRRRHGVRKGSVVLLLLPNSVAFPVSFXXXXXXXXXXXXMNPSSSPAEI 143

Query: 92  EYHLRDSGAKALFAFT-GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAET 150
               R +GA  + A   G               E+      +                  
Sbjct: 144 AAQARATGACLVLASRDGXXXXXXXXXXXXXXXEI------LXXXXXXXXXXXXXXXXXX 197

Query: 151 FWAALNGQPGEFESVRTE---GDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFD 207
           F A L+G  G+           DD   I+Y+SGT+G+ KG  LTH NL+  A+    +  
Sbjct: 198 FRAMLDGGGGDGTETAVPVVGQDDAVAILYSSGTSGRSKGVVLTHRNLI--AMTELFVRF 255

Query: 208 QAPDSH------DVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK 261
           +A   H      +V++  LP+ H++G +      L    T+V+M RFD  +A++ + + K
Sbjct: 256 EASQYHARGARENVYMAALPMSHVYGLSLFAVGLLSIGATVVVMRRFDAGDAVAAIGRYK 315

Query: 262 VTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS-GGASLPAEVARKVKEKFG-IEILE 319
           VT    VP +                       VS G A + A +  +  + F  ++ ++
Sbjct: 316 VTHMPLVPPIXXXXXXXXXXXXXXXSQVASLVQVSCGAAPITAALIHEFLQAFPHVDFIQ 375

Query: 320 GYGLSETSPVVS--FNNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGH 376
           GYG++E++ V +  FN  K K K  S+GL    +  K+V  E+ + +     GE+ + G 
Sbjct: 376 GYGMTESTAVGTRGFNTSKHK-KYTSVGLLAPNMHAKIVHLESSSCLPPGFSGELWLHGP 434

Query: 377 CVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEE 436
            +MKGY +  + +A   +DGW RTGDIA  D +G+ +I+ R KD I   G+ + P ++EE
Sbjct: 435 GIMKGYLSDDD-DACTRKDGWLRTGDIAYFDLDGYLYIVGRLKDTIKYKGFQIAPGDLEE 493

Query: 437 VLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVE 496
           VL+ HP++   AV     +  GE   AFV+   G+ L+  +++ +  +++A YK  R V 
Sbjct: 494 VLIHHPEILDVAVTSAEDEEAGEIPVAFVVRRSGSNLSCKQVMEYVAKQVAPYKRVRKVV 553

Query: 497 FRTELPMTATGKILKRELR 515
           F   +P +  GK+L+R LR
Sbjct: 554 FVEAIPKSPAGKVLRRLLR 572


>ACSM1_MOUSE RecName: Full=Acyl-coenzyme A synthetase ACSM1,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 1;
          Length = 573

 Score =  168 bits (426), Expect = 8e-44
 Identities = 141/481 (29%), Positives = 224/481 (46%), Gaps = 30/481 (6%)

Query: 48  GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT 107
           G++ GD +AL  P VP +  V  G ++ G + +P    L  ++I Y ++ S AKA+    
Sbjct: 103 GLQQGDHLALILPRVPEWWLVTVGCMRTGIIFMPGTTQLKAKDILYRIQISRAKAIVTTA 162

Query: 108 G-TPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVR 166
              PE+             +EC    DL      +  +  G   F + +     +   ++
Sbjct: 163 SLVPEVE---------SVASECP---DLKTKLVVSDHSHEGWLDFCSLIKSASPDHTCIK 210

Query: 167 TEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
           ++  D   I +TSGTTG PK A+  +  L F +   S        + D+   +     I 
Sbjct: 211 SKMKDPMAIFFTSGTTGYPKMAK-HNQGLAFRSYIPSCRKLLKLKTSDILWCMSDPGWIL 269

Query: 227 GQTTMMNAALYRHGTMVL--MPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDI 284
                +        T+ +  +P+FD    + ++ K  +T     P +Y  +L  Q   ++
Sbjct: 270 ATVGCLIEPWTSGCTVFIHHLPQFDPKVIVEVLFKYPITQCLAAPGVYRMVLQ-QKTSNL 328

Query: 285 KQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSI 344
           +    TL    +GG SL  E   + K++ G+ I E YG SET  + S    + K K GSI
Sbjct: 329 R--FPTLEHCTTGGESLLPEEYEQWKQRTGLSIHEVYGQSETG-ISSATLREMKIKRGSI 385

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFR 399
           G  I   +++++DE  N +     G I +R        +   Y N PE+ ++V    ++ 
Sbjct: 386 GKAILPFDLQIIDEKGNILPPNTEGYIGIRIKPTRPLGLFMEYENSPESTSEVECGDFYN 445

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           +GD A  DEEG+ + + R  D+I   GY + P E+E  L  HP V+ +AVV  P    GE
Sbjct: 446 SGDRATIDEEGYIWFLGRGDDVINASGYRIGPVEVENALAEHPAVAESAVVSSPDKDRGE 505

Query: 460 EIKAF-VIPAEGATLTEDELIA----WAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +KAF V+  E  +  +++LI       K   A YKYPR VEF +ELP T TGKI ++EL
Sbjct: 506 VVKAFIVLNPEFLSHDQEQLIKELQHHVKSVTAPYKYPRKVEFVSELPKTVTGKIKRKEL 565

Query: 515 R 515
           R
Sbjct: 566 R 566


>ACSA_BACSU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 572

 Score =  168 bits (426), Expect = 8e-44
 Identities = 140/487 (28%), Positives = 226/487 (46%), Gaps = 21/487 (4%)

Query: 37  ANQVANLLVSRG-IRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95
           +N+  N+L   G +  GD+V +  P  P   F+  GA+K GA+  PL        ++  L
Sbjct: 83  SNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAIKIGAIAGPLFEAFMEGAVKDRL 142

Query: 96  RDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAAL 155
            +S AK +     TPEL   ER      ++   +    +   A + T+ I   E    A 
Sbjct: 143 ENSEAKVVVT---TPELL--ERI--PVDKLPHLQHVFVVGGEAESGTNIINYDE----AA 191

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDV 215
             +    +    +  D  ++ YTSG+TG PKG    H  ++        + D   +  D+
Sbjct: 192 KQESTRLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKWVLDLKEE--DI 249

Query: 216 FLTVLPLFHIFGQTTMMNAALYRHGTMVLMP-RFDGDEALSLMEKEKVTIFAGVPTMYWG 274
           +        + G    + A      T V++  RF  +     +E+  V ++   PT +  
Sbjct: 250 YWCTADPGWVTGTVYGIFAPWLNGATNVIVGGRFSPESWYGTIEQLGVNVWYSAPTAFRM 309

Query: 275 LLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNN 334
           L+ A  +   K    +L   +S G  L  EV R   + F   I + + ++ET   +  N 
Sbjct: 310 LMGAGDEMAAKYDLTSLRHVLSVGEPLNPEVIRWGHKVFNKRIHDTWWMTETGSQLICNY 369

Query: 335 PKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH--CVMKGYHNRPEA-NAQ 391
           P    KPGS+G PI GVE  +VD   N +     G +A++     +M    N PE   + 
Sbjct: 370 PCMDIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMHTIWNNPEKYESY 429

Query: 392 VMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG 451
            M  GW+ +GD A  DEEG+++   R  D+I+  G  V P E+E  L+ HP ++ A V+G
Sbjct: 430 FMPGGWYVSGDSAYMDEEGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHPAIAEAGVIG 489

Query: 452 VPHDTHGEEIKAFVIPAEG---ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGK 508
            P    GE IKAF+   EG   +   ++E+  + K+ LAA+  PR +EF+ +LP T +GK
Sbjct: 490 KPDPVRGEIIKAFIALREGFEPSDKLKEEIRLFVKQGLAAHAAPREIEFKDKLPKTRSGK 549

Query: 509 ILKRELR 515
           I++R L+
Sbjct: 550 IMRRVLK 556


>ACSM1_HUMAN RecName: Full=Acyl-coenzyme A synthetase ACSM1,
           mitochondrial;         EC=6.2.1.2;AltName: Full=Acyl-CoA
           synthetase medium-chain family member 1;
          Length = 577

 Score =  167 bits (423), Expect = 2e-43
 Identities = 143/509 (28%), Positives = 230/509 (45%), Gaps = 39/509 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83
           +++ ++  +  +  +VAN+     G++ GD +AL  P VP +  V  G ++ G + +P  
Sbjct: 83  EVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPRVPEWWLVAVGCMRTGIIFIPAT 142

Query: 84  VLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           +LL  ++I Y L+ S AK +        + +   A +     ++C     L      +  
Sbjct: 143 ILLKAKDILYRLQLSKAKGI--------VTIDALASEVDSIASQCP---SLKTKLLVSDH 191

Query: 144 AIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASS 203
           +  G   F + +     E   V+++  D  VI +TSGTTG PK A+ +H   L  +   S
Sbjct: 192 SREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPGS 251

Query: 204 ALFDQAPDSH------DVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLM 257
                   S       D    V  ++ +    T        H     +P+FD    +  +
Sbjct: 252 RKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHH-----LPQFDTKVIIQTL 306

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
            K  +  F GV ++Y  +L  Q D    +     H    G   LP +   + K + G+ +
Sbjct: 307 LKYPINHFWGVSSIYRMIL--QQDFTSIRFPALEHCYTGGEVVLPKD-QEEWKRRTGLLL 363

Query: 318 LEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC 377
            E YG SET  ++       K KPG +G      +++++D+  + +     G I +R   
Sbjct: 364 YENYGQSETG-LICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRIKP 422

Query: 378 V-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPR 432
           V        Y   PE  A+V    ++ TGD  + DEEG+   + RS D+I   GY + P 
Sbjct: 423 VRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIGPA 482

Query: 433 EIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI------PAEGATLTEDELIAWAKERL 486
           E+E  L+ HP V+ +AVVG P    GE +KAF++        +   LT+ EL    K   
Sbjct: 483 EVESALVEHPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTK-ELQQHVKSVT 541

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           A YKYPR VEF +ELP T TGKI ++ELR
Sbjct: 542 APYKYPRKVEFVSELPKTITGKIERKELR 570


>4CL1_SOYBN RecName: Full=4-coumarate--CoA ligase 1;       
           Short=4CL 1;         EC=6.2.1.12;AltName:
           Full=4-coumaroyl-CoA synthase 1;
          Length = 293

 Score =  165 bits (417), Expect = 9e-43
 Identities = 104/283 (36%), Positives = 163/283 (57%), Gaps = 10/283 (3%)

Query: 241 TMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
           T++LMP+FD +  L+L+ K KVTI   VP +   +  +   H  K    ++    SGGA 
Sbjct: 4   TILLMPKFDINSLLALIHKHKVTIAPVVPPIVLAISKSPDLH--KYDLSSIRVLKSGGAP 61

Query: 301 LPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNNPKRK----AKPGSIGLPIWGVEMKL 355
           L  E+   ++ KF   ++ +GYG++E  PV++ +    K     KPG+ G  +   EMK+
Sbjct: 62  LGKELEDTLRAKFPNAKLGQGYGMTEAGPVLTMSLAFAKEPIDVKPGACGTVVRNAEMKI 121

Query: 356 VD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYF 413
           VD E  +++     GEI +RG  +MKGY N  EA  + + +DGW  TGDI   D++   F
Sbjct: 122 VDPETGHSLPRNQSGEICIRGDQIMKGYLNDGEATERTIDKDGWLHTGDIGYIDDDDELF 181

Query: 414 IIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT- 472
           I+DR K++I   G+ V P E+E +L+THP++S AAVV +  +  GE   AFV+ + G T 
Sbjct: 182 IVDRLKELIKYKGFQVAPAELEALLLTHPKISDAAVVPMKDEAAGEVPVAFVVISNGYTD 241

Query: 473 LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            TEDE+  +  +++  YK    V F   +P + +GKIL+++LR
Sbjct: 242 TTEDEIKQFISKQVVFYKRINRVFFIDAIPKSPSGKILRKDLR 284


>ACSA_PSYIN RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  163 bits (413), Expect = 3e-42
 Identities = 144/515 (27%), Positives = 236/515 (45%), Gaps = 27/515 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  ++    Q AN+L S+G+R GD V L  P  P          + GAV   +  
Sbjct: 105 DEKITYKQLHQRVCQFANVLKSQGVRKGDVVCLYMPMTPEAAVAMLACTRIGAVHSIVFG 164

Query: 85  LLTPREIEYHLRDSGAKALFAFT----GTPELPLGERAWQAF-QEVAECELYIDLPAAAG 139
             +P  I   + DS AK +        G   +PL     +A  ++  +C   + +    G
Sbjct: 165 GFSPDAIAGRIVDSSAKIVITADEGRRGGRVVPLKANVDEALTKDGTDCVKSVIVFKNTG 224

Query: 140 ATTSAIPGAETFWAALNG-QPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLF 197
              + + G +  W ++   +  E E      +D   I+YTSG+TG PKG    T   L++
Sbjct: 225 GEVNWVVGRDLDWESVCADESSECEPEAMNAEDPLFILYTSGSTGTPKGVLHTTGGYLVY 284

Query: 198 NAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL 254
            A+    +FD      D++     +  I G T  +   L    T ++   +P +     +
Sbjct: 285 AAMTFKYVFDY--QEGDIYWCTADVGWITGHTYSVYGPLANGATSLIFEGVPNYPTPARM 342

Query: 255 S-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVARKVKEK 312
           S +++K KV+I    PT    L+ A+GD  I+   ++ L    S G  +  E       K
Sbjct: 343 SEVVDKHKVSILYTAPTAIRALM-AKGDQAIEGTHRSSLRILGSVGEPINPEAWEWYYNK 401

Query: 313 FGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGP 368
            G E   I++ +  +ET  ++    P     KPGS   P +GV+  +VD     +EGE  
Sbjct: 402 IGDERCPIVDTWWQTETGGILISPLPGATDLKPGSATRPFFGVQPAIVDSEGVVLEGEAA 461

Query: 369 GEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMII 423
           G + +          +   H+R E        G + TGD ARRD +G+Y+I  R  D++ 
Sbjct: 462 GNLVMLDSWPGQMRTLYNNHDRFEQTYFSTFKGMYFTGDGARRDSDGYYWITGRVDDVLN 521

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIA 480
             G+ +   EIE  L++HP+++ AAVVGVPH+  G+ I A+V   EG   + +   E+  
Sbjct: 522 VSGHRMGTAEIESALVSHPKIAEAAVVGVPHEIKGQGIYAYVTLNEGEYPSPELYAEVKQ 581

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           W ++ + A   P I+ +   LP T +GKI++R LR
Sbjct: 582 WVRKEIGAIATPDILHWAEGLPKTRSGKIMRRILR 616


>ACSA_SHEFN RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  163 bits (412), Expect = 4e-42
 Identities = 139/512 (27%), Positives = 228/512 (44%), Gaps = 25/512 (4%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           +L YA ++    + AN L S+G+  GD V +  P VP          + GAV   +    
Sbjct: 107 KLTYAELHTQVCKFANALRSQGVNKGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGF 166

Query: 87  TPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEV-AECELYIDLPAAAGAT 141
           +P  I   + D  +K L        G  ++PL     +A       C   + +    G  
Sbjct: 167 SPDSIAARVIDGKSKVLITADEGIRGGRKIPLKRSIDEAISNPDVTCVEKVIVFKRTGGD 226

Query: 142 TSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNA 199
              + G + +W +L     EF +      +D   ++YTSG+TG PKG    T   +++ +
Sbjct: 227 IDWVEGRDVWWHSLMEVASEFCQPAEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAS 286

Query: 200 VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS- 255
           +    +FD   D  +V+     +  I G + M+        T+++   +P       L  
Sbjct: 287 MTHEYVFDYKAD--EVYWCTADVGWITGHSYMVYGPFANAATVLIHEGVPNHPTPARLGE 344

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
           ++++ KV I    PT+   L+    +        +L    S G  +  E  R   E  G 
Sbjct: 345 MIDRHKVNILYTAPTLIRALMAEGKEQFSSYKGDSLRIMGSVGEPINPEAWRWYHEVIGH 404

Query: 316 E---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   + +EG G G +
Sbjct: 405 ENCPIVDTWWQTETGGILISPLPGATDTKPGSATRPFFGVQPALVDNMGDIVEGTGEGNL 464

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H+R          G + TGD ARRDE+G+Y+I  R  D+I   G
Sbjct: 465 VILDSWPGQMRTVYGDHDRFALTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSG 524

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAK 483
           + +   E+E  L++H  V+ AAVVG PHD  G+ I A+V    G   TE+   EL  W +
Sbjct: 525 HRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGIEPTEELRQELRQWVR 584

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + + A   P ++++ + LP T +GKI++R LR
Sbjct: 585 KEIGALATPDLIQWASGLPKTRSGKIMRRFLR 616


>ACSA_METPB RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  162 bits (409), Expect = 8e-42
 Identities = 139/533 (26%), Positives = 249/533 (46%), Gaps = 37/533 (6%)

Query: 15  RPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
           R ++ AI++ GD       + Y  ++    ++AN+L +RG+  GD+V L  P +P   + 
Sbjct: 88  RGDQTAIIWEGDDPNESQHITYKQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYA 147

Query: 69  YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQE 124
                + GA+   +    +P  +   ++  G+K +        G  ++PL     +A + 
Sbjct: 148 MLACARLGAIHAIVFGGFSPDSLASRIKGCGSKLVITADEGLRGGRKVPLKANVDEAIKR 207

Query: 125 V-AECELYIDLPAAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
           + A+   ++ +    G   +  PG + ++  A      E  +   E +    I+YTSG+T
Sbjct: 208 LDADLVDHVIVVKRTGGNVAMEPGRDVYYHEAAEQVTDECPAEAVEAEHPLFILYTSGST 267

Query: 183 GQPKGAQLTHTN---LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           GQPKG  + HT    L++ ++    +FD      DV+     +  + G + ++   L   
Sbjct: 268 GQPKG--VVHTTGGYLVYASMTHQYVFDY--HDGDVYWCTADVGWVTGHSYIVYGPLANG 323

Query: 240 GTMVL---MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTA 294
            T ++   +P +  +     +++K KV IF   PT    L+   G+  +K+ S+ +L   
Sbjct: 324 ATTLMFEGIPTYPSNSRFWEVIDKHKVNIFYTAPTAIRSLMGG-GEGPVKKTSRASLRVL 382

Query: 295 VSGGASLPAEV---ARKVKEKFGIEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWG 350
            S G  +  E      +V       I++ +  +ET  ++    P   K KPGS   P +G
Sbjct: 383 GSVGEPINPEAWDWYYRVVGDSRCSIVDTWWQTETGGILITPLPGATKLKPGSATRPFFG 442

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIAR 405
           V+  +VD     ++G   G + ++         + G H R E          + TGD AR
Sbjct: 443 VQPVMVDAEGKELDGACEGNLCIKDSWPGQMRTVYGDHERFEQTYFSTYKNLYFTGDGAR 502

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           RD +G+Y+I  R  D+I   G+ +   E+E  L+ HP+VS AAVVG PH+  G+ I A+V
Sbjct: 503 RDADGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHNVKGQGIYAYV 562

Query: 466 IPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              EG   +++   EL+ W ++ +     P +++F   LP T +GKI++R LR
Sbjct: 563 TLNEGEDGSDELRKELVTWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILR 615


>ACSA_DESAA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 646

 Score =  162 bits (409), Expect = 8e-42
 Identities = 139/537 (25%), Positives = 244/537 (45%), Gaps = 33/537 (6%)

Query: 8   LEDGARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           L+     R ++ AI+F       + ++ Y  +     + +N+L S G++ GD+V++  P 
Sbjct: 80  LDRHLEKRGDQTAIIFEGNEPGVEEKITYRQLYERVCRFSNVLKSCGVKKGDRVSIYLPM 139

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGER 117
           +P          + GA+   +    +P  +   + D+    L        G   + L E 
Sbjct: 140 IPQLAVAMLACARIGAIHSIVFAGFSPDALANRITDAECTILITADEGLRGPKAIGLKEA 199

Query: 118 AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPG-EFESVRTEGDDVAVII 176
           A +A  +    +  I +    GA      G + +W  L  +   E      + +D   I+
Sbjct: 200 ADEAMDKAGMVKKCI-VVKHTGADVPMKAGRDLWWHELTAKESTECPPESMDSEDPLFIL 258

Query: 177 YTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           YTSG+TG PKG    T   +++ ++    +FD      D++     +  + G + ++   
Sbjct: 259 YTSGSTGTPKGVLHTTGGYIVYTSLTHQYVFDY--HDGDIYWCTADIGWVTGHSYIIYGP 316

Query: 236 LYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT- 290
           L      ++   +P + D      + +K +V IF   PT+   L+  QGD  +K  S+T 
Sbjct: 317 LANGAVTIMFEGIPNYPDFSRFWQICDKHQVNIFYTAPTVVRALMQ-QGDEPVKATSRTS 375

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGL 346
           +    + G  +  E         G E   I++ +  +ET  ++    P   A KPGS   
Sbjct: 376 VRLLGTVGEPINPEAWLWYHRVVGEERCPIVDTWWQTETGGIMITPLPGATALKPGSATR 435

Query: 347 PIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTG 401
           P +G++  L+D+  N +EG G G + +          + G H R ++   +   G + +G
Sbjct: 436 PFFGIQPALIDKEGNQLEGPGEGYLVMLDSWPALARTVYGDHRRFKSTYFIQCPGTYFSG 495

Query: 402 DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEI 461
           D ARRDE+G+Y+I  R  D+I   G+ +   EIE  L+ HP VS AAVVG PHD  G+ I
Sbjct: 496 DGARRDEDGYYWITGRIDDVINVSGHRLGTAEIESSLVAHPAVSEAAVVGFPHDIKGQAI 555

Query: 462 KAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            A+V  + G   +E+   EL  + ++ +     P +++F   LP T +GKI++R LR
Sbjct: 556 YAYVTLSSGYEPSEELRKELSLFVRKDIGPIATPEVLQFTDSLPKTRSGKIMRRILR 612


>ACSA_SYNFM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  161 bits (408), Expect = 1e-41
 Identities = 128/498 (25%), Positives = 228/498 (45%), Gaps = 27/498 (5%)

Query: 41  ANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGA 100
           AN+L ++G++ GD+  +  P +P          + G V   +    +P  +   + D G 
Sbjct: 119 ANVLKAQGLKKGDRATIYLPMIPELAVAMLACARIGVVHSIVFAGFSPESLAGRILDCGG 178

Query: 101 KALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWA-AL 155
           K +        G   +PL E   +A ++  + +  I +    G     +PG +  W  A+
Sbjct: 179 KVVITADEGLRGGKPIPLKENTEEALKKCPDVQKVI-VVKHTGGKVPVVPGRDVDWTEAI 237

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHD 214
                +      + +D   I+YTSG+TG+PKG    T   L++ A++   +FD      D
Sbjct: 238 KAASPDCPPEVMDAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTALSHQYVFDY--HDGD 295

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPT 270
           ++     +  + G + ++   L    T V+   +P + D     ++++K K+ IF   PT
Sbjct: 296 IYWCTADIGWVTGHSYIIYGPLANGATTVMFEGIPNYPDWSRFWNVVDKHKINIFYTAPT 355

Query: 271 MYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSET 326
               L+  QG+  ++  S+ +L    + G  +  E         G +   I++ +  +ET
Sbjct: 356 AIRALMR-QGEAPVRATSRKSLKLLGTVGEPINPEAWLWYYNNVGEQRCPIVDTWWQTET 414

Query: 327 SPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMK 380
             ++    P   A KPGS   P +GV+  ++D     ++G G G + ++         + 
Sbjct: 415 GGILITPLPGATALKPGSATRPFFGVQPAIIDPEGKMLDGPGSGYLIIKESWPGMLRTVY 474

Query: 381 GYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMT 440
           G H R +        G + TGD ARRDE+G+Y+I  R  D+I   G+ +   E+E  L+ 
Sbjct: 475 GDHERFKQTYFSNYPGLYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVA 534

Query: 441 HPQVSLAAVVGVPHDTHGEEIKAFVIPA---EGATLTEDELIAWAKERLAAYKYPRIVEF 497
           HP V+ +AVVG PHD  G+ I A+V      E +     EL+ W ++ +     P  +++
Sbjct: 535 HPAVAESAVVGFPHDIKGQGIYAYVTLKANWEHSDELRQELVKWVRKEIGPIATPDYIQW 594

Query: 498 RTELPMTATGKILKRELR 515
              LP T +GKI++R LR
Sbjct: 595 APGLPKTRSGKIMRRILR 612


>ACSA_METRJ RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 648

 Score =  161 bits (407), Expect = 1e-41
 Identities = 135/514 (26%), Positives = 238/514 (46%), Gaps = 31/514 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           ++Y  ++    ++AN+L +RG+  GD+V L  P +P   +      + GA+   +    +
Sbjct: 107 ISYRELHAQVCRMANVLRNRGVGKGDRVTLYMPMIPEAAYAMLACARLGAIHAIVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEV-AECELYIDLPAAAGATT 142
           P  +   ++  G+K +        G  ++PL     +A + + A+   ++ +    G + 
Sbjct: 167 PDSLASRIQGCGSKVVITADEGLRGGRKVPLKANVDEAIKRLDADLVDHVIVVRRTGGSV 226

Query: 143 SAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFN 198
           +   G + ++  A      E  +V  + +    I+YTSG+TGQPKG  + HT    L++ 
Sbjct: 227 AMEAGRDVYYDEAAEQVTDECPAVAVDAEHPLFILYTSGSTGQPKG--VVHTTGGYLVYA 284

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL- 254
           ++    +FD      DV+     +  + G + ++   L    T ++   +P +       
Sbjct: 285 SMTHEYVFDYREG--DVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSTSRFW 342

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKF 313
            +++K KV IF   PT    L+   G+  +K+ S Q+L    S G  +  E         
Sbjct: 343 EVVDKHKVNIFYTAPTAIRSLMGG-GEGPVKKTSRQSLRVLGSVGEPINPEAWEWYYNVV 401

Query: 314 G---IEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPG 369
           G     I++ +  +ET  ++    P   A KPGS   P +GV+ ++VD     +EG   G
Sbjct: 402 GDRRCSIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVKPQMVDAEGKVLEGPCEG 461

Query: 370 EIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIR 424
            + +          + G H R E        G + TGD ARRD +G+Y+I  R  D+I  
Sbjct: 462 NLCIADSWPGQMRTVYGDHERFEQTYFSTYPGKYFTGDGARRDADGYYWITGRVDDVINV 521

Query: 425 GGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI---PAEGATLTEDELIAW 481
            G+ +   E+E  L+ HP+V+ AAVVG PH+  G+ I A+V      EG      EL+ W
Sbjct: 522 SGHRMGTAEVESSLVAHPKVAEAAVVGYPHNVKGQGIYAYVTLNDGEEGDDALRKELVTW 581

Query: 482 AKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            ++ +     P +++F   LP T +GKI++R LR
Sbjct: 582 VRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILR 615


>ACSA_SHEAM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  160 bits (406), Expect = 2e-41
 Identities = 142/513 (27%), Positives = 230/513 (44%), Gaps = 27/513 (5%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           ++ Y  ++    Q AN L + G++ GD V +  P V           + GAV   +    
Sbjct: 107 KVTYRELHAEVCQFANALKAEGVKRGDVVTIYMPMVVEATVAMLACARIGAVHSVVFGGF 166

Query: 87  TPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGA 140
           +P  I   + D  +K L        G  ++PL     +A    +V   E  I L    GA
Sbjct: 167 SPDSIASRVIDGKSKLLITADEGVRGGRKIPLKGNIDEALNRPDVTTVETVIVLKRTGGA 226

Query: 141 TTSAIPGAETFWAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFN 198
             + + G + +W  + +G   E        +D   ++YTSG+TG PKG    T   L++ 
Sbjct: 227 V-NWVEGRDKWWHQVTDGAATECAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYA 285

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS 255
           ++    +FD  P   +V+     +  I G + M+   L    T+++   +P F     L 
Sbjct: 286 SMTHEYVFDYKPG--EVYWCTADVGWITGHSYMVYGPLANGATILIHEGIPNFPSPARLG 343

Query: 256 -LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            ++++ +V I    PT+   L+     H      ++L    S G  +  E  R   E  G
Sbjct: 344 EIVDRHQVNILYTAPTLIRALMAEGKQHFDNFDGKSLRIMGSVGEPINPEAWRWYHEVIG 403

Query: 315 IE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N +EG   G 
Sbjct: 404 HEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVDNEGNILEGATEGN 463

Query: 371 IAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRG 425
           + +          + G H R          G + TGD ARRDE+G+Y+I  R  D+I   
Sbjct: 464 LVLLDSWPGQMRTVYGDHERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVS 523

Query: 426 GYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWA 482
           G+ +   E+E  L+ H  V+ AAVVG PHD  G+ I A+V   +G   TE+   EL  W 
Sbjct: 524 GHRLGTAEVESALVAHDLVAEAAVVGYPHDIKGQGIYAYVTLTKGTEATEELRQELRQWV 583

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           ++ + A   P ++++ + LP T +GKI++R LR
Sbjct: 584 RKEIGALATPDLIQWASGLPKTRSGKIMRRFLR 616


>ACSA_METC4 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  160 bits (406), Expect = 2e-41
 Identities = 136/516 (26%), Positives = 242/516 (46%), Gaps = 35/516 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++    ++AN+L +RG+  GD+V L  P +P   +      + GA+   +    +
Sbjct: 107 ITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYAMLACARLGAIHAIVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECEL-YIDLPAAAGATT 142
           P  +   ++  G+K +        G  ++PL     +A + + +  + ++ +    G   
Sbjct: 167 PDSLASRIKGCGSKLVITADEGLRGGRKVPLKANVDEAIKRLDKDLVDHVIVVKRTGGNV 226

Query: 143 SAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFN 198
           +  PG + ++  A      E  +   E +    I+YTSG+TGQPKG  + HT    L++ 
Sbjct: 227 AMEPGRDVYYHEAAEQVTDECPAEAVEAEHPLFILYTSGSTGQPKG--VVHTTGGYLVYA 284

Query: 199 AVASSALFDQAPDSHD--VFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEA 253
           ++    +FD     HD  V+     +  + G + ++   L    T ++   +P +  +  
Sbjct: 285 SMTHQYVFDY----HDGEVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSR 340

Query: 254 L-SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEV---ARK 308
              +++K KV IF   PT    L+   G+  +K+ S Q+L    S G  +  E      +
Sbjct: 341 FWEVIDKHKVNIFYTAPTAIRSLMGG-GEGPVKKTSRQSLRVLGSVGEPINPEAWDWYYR 399

Query: 309 VKEKFGIEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEG 367
           V       I++ +  +ET  ++    P   + KPGS  LP +GV+  +VD     ++G  
Sbjct: 400 VVGDSRCPIVDTWWQTETGGILITPLPGATRLKPGSATLPFFGVQPVMVDAEGKILDGAC 459

Query: 368 PGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMI 422
            G + ++         + G H R E          + TGD ARRD +G+Y+I  R  D+I
Sbjct: 460 EGNLCIKDSWPGQMRTVYGDHERFEQTYFSTYKDLYFTGDGARRDADGYYWITGRVDDVI 519

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELI 479
              G+ +   E+E  L+ HP+VS AAVVG PH+  G+ I A+V   EG   T++   EL+
Sbjct: 520 NVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHNVKGQGIYAYVTLNEGEEGTDELRKELV 579

Query: 480 AWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            W ++ +     P +++F   LP T +GKI++R LR
Sbjct: 580 TWVRKDIGPIASPDLLQFAPGLPKTRSGKIMRRILR 615


>ACSA_METEP RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  160 bits (405), Expect = 2e-41
 Identities = 134/514 (26%), Positives = 240/514 (46%), Gaps = 31/514 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++    ++AN+L +RG+  GD+V L  P +P   +      + GA+   +    +
Sbjct: 107 ITYRQLHAEVCRMANVLRNRGVGKGDRVTLYLPMIPEAAYAMLACARLGAIHAIVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECEL-YIDLPAAAGATT 142
           P  +   ++  G+K +        G  ++PL     +A + + +  + ++ +    G   
Sbjct: 167 PDSLASRIKGCGSKLVITADEGLRGGRKVPLKANVDEAIKRLDKDLVDHVIVVKRTGGNV 226

Query: 143 SAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFN 198
           +  PG + ++  A      E  +   E +    I+YTSG+TGQPKG  + HT    L++ 
Sbjct: 227 AMEPGRDVYYHEAAEQVTDECPAEAVEAEHPLFILYTSGSTGQPKG--VVHTTGGYLVYA 284

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL- 254
           ++    +FD      DV+     +  + G + ++   L    T ++   +P +  +    
Sbjct: 285 SMTHQYVFDY--HDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSNSRFW 342

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEV---ARKVK 310
            +++K  V IF   PT    L+   G+  +K+ S Q+L    S G  +  E      +V 
Sbjct: 343 EVIDKHNVNIFYTAPTAIRSLMGG-GEGPVKKTSRQSLRVLGSVGEPINPEAWDWYYRVV 401

Query: 311 EKFGIEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPG 369
                 I++ +  +ET  ++    P   + KPGS  LP +GV+  +VD     ++G   G
Sbjct: 402 GDSRCPIVDTWWQTETGGILITPLPGATRLKPGSATLPFFGVQPVMVDAEGKILDGACEG 461

Query: 370 EIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIR 424
            + ++         + G H R E          + TGD ARRD +G+Y+I  R  D+I  
Sbjct: 462 NLCIKDSWPGQMRTVYGDHERFEQTYFSTYKDLYFTGDGARRDADGYYWITGRVDDVINV 521

Query: 425 GGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAW 481
            G+ +   E+E  L+ HP+VS AAVVG PH+  G+ I A+V   EG   T++   EL+ W
Sbjct: 522 SGHRMGTAEVESSLVAHPKVSEAAVVGYPHNVKGQGIYAYVTLNEGEEGTDELRKELVTW 581

Query: 482 AKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            ++ +     P +++F   LP T +GKI++R LR
Sbjct: 582 VRKDIGPIASPDLLQFAPGLPKTRSGKIMRRILR 615


>MENE_LACLA RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 451

 Score =  160 bits (404), Expect = 3e-41
 Identities = 111/348 (31%), Positives = 190/348 (54%), Gaps = 29/348 (8%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           + +AVI+ TS TTG+ K   +T   ++ N V +S     A D+ D +L +LP+FH+ G +
Sbjct: 130 EKIAVIMNTSATTGKFKSVPITW-GMISNHVKASKETLGAYDN-DNWLVILPMFHVSGLS 187

Query: 230 TMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ 289
            +M   LY   +  ++ +FD ++ L ++   K+ + + VPT+   + +       K  S 
Sbjct: 188 IIMRT-LYNATSATVVDKFDENQLLEMINSGKINMVSLVPTLLTRIAD-------KLHSN 239

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPI 348
            L   + GG  +P  + +K +E  G+ I + YG++E+ S  V+FN      K  S+G P+
Sbjct: 240 NLRLILLGGEFIPQPLIKKCQE-LGLPIYKTYGMTESFSQSVTFNILDFPDKTSSVGRPL 298

Query: 349 WGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY-HNRPEANAQVMRDGWFRTGDIARRD 407
            GVE+++   +       G GEI ++   +MK Y   +P   A       F TGDI   D
Sbjct: 299 PGVEIEIRQADL-----AGVGEIWLKSPMLMKAYLGQKPYGTA-------FETGDIGYLD 346

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
            +GF ++++R KD+II GG N+YP+EIE+++ + P++   A+V  P    G+    FV  
Sbjct: 347 TDGFLYLLNRRKDIIISGGENIYPKEIEDLVYSLPEIKECALVAKPDAKWGQVPILFV-- 404

Query: 468 AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                +++++L  +  E+LA YK P+ + F  ELP  A+GKIL++EL+
Sbjct: 405 --SGNISQEKLENFLTEKLAKYKRPQSITFMDELPKNASGKILRKELK 450


>ACSA_XANAC RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  160 bits (404), Expect = 3e-41
 Identities = 140/504 (27%), Positives = 223/504 (44%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++ N L + G++ GD+V +  P +           + GAV   +        I   + D 
Sbjct: 118 KLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGATTSAIPGAETFW 152
            +K +        G  ++PL      A +       E  + +    GA     P    F 
Sbjct: 178 QSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGGAVEMQAPRDRWFH 237

Query: 153 AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPD 211
             ++GQP   E  R   +D   I+YTSG+TG+PKG   T    LLF +     +FD   D
Sbjct: 238 DVVDGQPAACEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRED 297

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAG 267
             D++     +  + G + ++   L    T V+   +P +        +++K +VTIF  
Sbjct: 298 --DIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYT 355

Query: 268 VPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLS 324
            PT    L+    D   K   ++L    S G  +  E  R   E  G     I++ +  +
Sbjct: 356 APTAIRALMRDGADPVKKTSRKSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQT 415

Query: 325 ETSPVVSFNNPKRKA---KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKG 381
           ET  ++   +P   A   KPGS  LP +GV+  LVD     +EG   G + +       G
Sbjct: 416 ETGGILI--SPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDS--WPG 471

Query: 382 YHNRPEANAQVMRDGWFRT-------GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
                  + Q   D +FRT       GD  RRD +G+Y+I  R  D+I   G+ +   E+
Sbjct: 472 QMRSVYGDHQRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEV 531

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L++HP+V+ AAVVG PHD  G+ I A+V    G T +ED   EL++W ++ +     
Sbjct: 532 ESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGQTPSEDLHKELVSWVRKEIGPIAS 591

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P  +++   LP T +GKI++R LR
Sbjct: 592 PDHLQWAPGLPKTRSGKIMRRILR 615


>ACSA_RHOP5 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 648

 Score =  160 bits (404), Expect = 3e-41
 Identities = 141/532 (26%), Positives = 241/532 (45%), Gaps = 33/532 (6%)

Query: 13  RNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           ++R ++ AI++ GD      ++ Y  ++    ++AN+L +R ++ GD+V +  P +P   
Sbjct: 86  KDRADQVAIIWEGDDPSESRKITYRQLHDEVCKMANVLRNRNVQKGDRVTIYLPMIPEAA 145

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAF 122
           F      + GA+   +    +P  +   + D  +K +        G   +PL      A 
Sbjct: 146 FAMLACARIGAIHSVVFGGFSPDSLAQRITDCASKVVITADEGLRGGRTVPLKANVDAAL 205

Query: 123 QEVAECELYIDLPAAAGATTSAIPGAETFW--AALNGQPGEFESVRTEGDDVAVIIYTSG 180
           ++ +  + ++ +    GA    +     FW   A      E        +D   I+YTSG
Sbjct: 206 RKSSAVD-WVVVVKRTGADVF-MDDVRDFWYHEAAEMVTTECPVEPMHAEDPLFILYTSG 263

Query: 181 TTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           +TGQPKG    T   L+F ++    +FD      DV+     +  + G + ++   L   
Sbjct: 264 STGQPKGVLHTTGGYLVFASMTHQYVFDY--HDGDVYWCTADVGWVTGHSYILYGPLANG 321

Query: 240 GTMVL---MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            T ++   +P +  +     +++K +V IF   PT    L+    +   K   ++L    
Sbjct: 322 ATTLMFEGVPNYPTNSRFWEVIDKHQVNIFYTAPTAIRALMQGGDEPVTKTSRKSLRLLG 381

Query: 296 SGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGV 351
           S G  +  E         G +   I++ +  +ET  ++    P   K KPGS   P +GV
Sbjct: 382 SVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGV 441

Query: 352 EMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARR 406
             +++D + N +EGE  G + +          + G H R E        G + TGD  RR
Sbjct: 442 VPQIMDADANVLEGECTGNLCLAKSWPGQMRTVYGDHARFEQTYFSAYPGKYFTGDGCRR 501

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           D +G+Y+I  R  D+I   G+ +   E+E  L+ HPQVS AAVVG PHD  G+ I A+V 
Sbjct: 502 DADGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPQVSEAAVVGYPHDIKGQGIYAYVT 561

Query: 467 PAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              G   TE    EL+AW ++ +     P +++F   LP T +GKI++R LR
Sbjct: 562 LMTGVEPTEALRKELVAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILR 613


>ACSA_PARL1 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  160 bits (404), Expect = 3e-41
 Identities = 133/515 (25%), Positives = 233/515 (45%), Gaps = 29/515 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  ++    + AN+L +RG++ GD+V +  P +P   +      + GAV   +  
Sbjct: 104 DRKITYRELHDEVCRFANVLKARGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFG 163

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA 140
             +P  +   + D  +  +        G  ++PL     +A ++    +  I +    GA
Sbjct: 164 GFSPDSLAGRIVDCASSCVITADEGVRGGRKIPLKANTDEALKKCPGVKSVIVVKHTGGA 223

Query: 141 TTSAIPGAETFWAALNGQPGEFESVRTE--GDDVAVIIYTSGTTGQPKGA-QLTHTNLLF 197
              A+      W A             E   +D   I+YTSG+TG+PKG    T   +++
Sbjct: 224 V--AMEKGRDVWYAEEAAKVSATCAPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVY 281

Query: 198 NAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEA 253
            ++    +FD      D++     +  + G + ++   L    T ++   +P + D    
Sbjct: 282 ASMTHQYVFDY--HDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDASRC 339

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEV---ARKV 309
             +++K +V IF   PT    L+  +G+  +K+ S+ +L    S G  +  E      +V
Sbjct: 340 WQVIDKHEVNIFYTAPTALRALMR-EGEEPVKKTSRKSLRLLGSVGEPINPEAWLWYHRV 398

Query: 310 KEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGP 368
                  I++ +  +ET  ++    P   A KPGS   P +GV+  +VD   N  EG   
Sbjct: 399 VGDGRCPIVDTWWQTETGGILISPLPGAIATKPGSATKPFFGVQPVIVDAEGNVQEGATT 458

Query: 369 GEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMII 423
           G + +          + G H R      +   G + TGD  RRDE+G+Y+I  R  D++ 
Sbjct: 459 GNLCIDDSWPGQMRTVYGDHQRFVETYFIQYPGRYFTGDGCRRDEDGYYWITGRVDDVLN 518

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIA 480
             G+ +   E+E  L+ HP+V+ AAVVG PHD  G+ I A+V    G   TE+   EL+ 
Sbjct: 519 VSGHRMGTAEVESALVAHPKVAEAAVVGYPHDIKGQGIYAYVTLIAGEAATEELRKELVT 578

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           W ++ +     P +++F   LP T +GKI++R LR
Sbjct: 579 WVRKEIGPIASPDLIQFAPGLPKTRSGKIMRRILR 613


>ACSF3_XENLA RecName: Full=Acyl-CoA synthetase family member 3,
           mitochondrial;         EC=6.2.1.-;Flags: Precursor;
          Length = 578

 Score =  159 bits (402), Expect = 5e-41
 Identities = 137/498 (27%), Positives = 220/498 (44%), Gaps = 59/498 (11%)

Query: 53  DKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPEL 112
           ++V+  CPN   +    +    +GA+ VPL     P E++Y L+DS +  + A       
Sbjct: 97  ERVSFLCPNNSSYVVCQWAVWMSGAIAVPLCKSHPPSELKYVLQDSQSALVVA------- 149

Query: 113 PLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD- 171
                      E +   +   L    G     + G++    +   Q  +   +  +  D 
Sbjct: 150 -----------EESYTNVLSPLAEQLGIPVLTMSGSQNLHPSELLQEIKISQLDLDWKDR 198

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+IIYTSGTTG+PKG   TH NL   ++ ++ + +      D                 
Sbjct: 199 GAMIIYTSGTTGRPKGVLSTHYNLY--SMVTALVNEWGWTKEDSIXXXXXXXXXXXXXNK 256

Query: 232 MNAALYRHGTMVLMPRFDGDEALSLM---EKEKVTIFAGVPTMYWGLLNAQGDH----DI 284
           +   L+   T V++P F            +   + IF  VPT+Y  L+     H    ++
Sbjct: 257 LMCPLWVGATCVILPEFCPKTVWQHFLGRDVPSINIFMAVPTIYSKLIAYYEQHFTHSNV 316

Query: 285 KQI-----SQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA 339
           ++       + +   VSG ++LP  V  + +E  G  +LE YG++E    ++  NP    
Sbjct: 317 REFVRAACQERIRLMVSGSSALPVPVLERWQEITGHTLLERYGMTEIG--MALTNPLHGP 374

Query: 340 K-PGSIGLPIWGVEMKLVDEN------FNTIEGEG--------------PGEIAVRGHCV 378
           + PG++G P+ GVE++ V +N        T   +G               GE+ VRG  V
Sbjct: 375 RVPGAVGAPLPGVEVRTVTQNPRKEGTSYTTHAQGDSTGTMVSVGLENREGELQVRGPAV 434

Query: 379 MKGYHN-RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDR-SKDMIIRGGYNVYPREIEE 436
            K Y N R +       DGWF+TGD A   ++G Y+I+ R S D+I  GGY V   E+E 
Sbjct: 435 FKEYWNKRLDTQEAFTSDGWFKTGDTAMY-KDGTYWILGRTSVDIIKSGGYKVSALEVER 493

Query: 437 VLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVE 496
            L+ HP ++  AV+G P  T G+ + A V   +G  L+  EL  WA+  +A Y  P  + 
Sbjct: 494 HLLGHPSITDVAVIGAPDVTWGQRVAAIVKLRDGHALSLQELKEWARAVMAPYCIPAELI 553

Query: 497 FRTELPMTATGKILKREL 514
              E+P    GKI K++L
Sbjct: 554 RVEEIPRNQMGKINKKQL 571


>ACSA2_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 2;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 2;AltName:
           Full=Acyl-activating enzyme 2;
          Length = 645

 Score =  159 bits (402), Expect = 5e-41
 Identities = 144/533 (27%), Positives = 244/533 (45%), Gaps = 39/533 (7%)

Query: 15  RPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
           R E+ AIV+ GD       + Y  ++    ++AN+L SRG+  GD+V +  P +P   + 
Sbjct: 88  RGEQIAIVWEGDNPSESAHITYRKLHHNVCRLANVLKSRGVEKGDRVCIYMPMIPEAAYA 147

Query: 69  YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQE 124
                + GAV   +    +P  +   + D+  + +        G   +PL +   +A ++
Sbjct: 148 MLACARIGAVHSVVFGGFSPDSLRDRILDADCRTVITADEGVRGGKYIPLKQNVEKALKD 207

Query: 125 VAECELYIDLPAAAGATTSAIPGAET----FWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
             +    + +    G     IP  E     +  AL+    +  +   + +D   I+YTSG
Sbjct: 208 CPDVSTVVVVERTQGD----IPWVEGRDIWYHEALHAASADCPAEAMDAEDPLFILYTSG 263

Query: 181 TTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           +TG+PKG    T   LL  A+    +FD      DV+     +  + G + ++   L   
Sbjct: 264 STGKPKGVLHTTGGYLLGAAMTHKYVFDY--HDGDVYWCTADVGWVTGHSYIVYGPLANG 321

Query: 240 GTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            T ++   +P + D      +++K +V IF   PT    L+  +GD  ++Q         
Sbjct: 322 ATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRALMR-EGDAPVRQTXXXXXXXX 380

Query: 296 -SGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWG 350
            S G  +  E      +  G +   IL+ +  +ET  ++    P   A KPGS   P +G
Sbjct: 381 GSVGEPINPEAWEWYYQVVGEKRCPILDTWWQTETGSILITPLPGATALKPGSATRPFFG 440

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRGHCVMK-----GYHNRPEANAQVMRDGWFRTGDIAR 405
           V+  L+DE    I+G G G +A++     +     G H R          G++ +GD AR
Sbjct: 441 VQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQRMIDTYFKPYPGYYFSGDGAR 500

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           RDE+G+Y+I  R  D+I   G+ +   E+E  L+ H  V+ AAVVG PHD  G+ I AFV
Sbjct: 501 RDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVAEAAVVGCPHDVKGQAIYAFV 560

Query: 466 IPAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
               G+  +E    EL+A   + + ++  P  +++   LP T +GKI++R LR
Sbjct: 561 TLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLPKTRSGKIMRRILR 613


>ACSA_SHESA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  159 bits (401), Expect = 7e-41
 Identities = 142/526 (26%), Positives = 229/526 (43%), Gaps = 34/526 (6%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++            + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRQITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNIDDALKHPDVTS 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E  ++   G +D   ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKV-DWVEGRDVWWHSLVETASEHCAIEEMGAEDPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD  P   +++     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYKPG--EIYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P +     L  ++++ KV I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGIPNYPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQHFDKYDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 ENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFY 412
              N +EG   G + +          + G H R          G + TGD ARRDE+G+Y
Sbjct: 451 NMGNILEGATEGNLVLLDSWPGQMRTVYGDHERFVLTYFKTFRGMYFTGDGARRDEDGYY 510

Query: 413 FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA- 471
           +I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V    G  
Sbjct: 511 WITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGTX 570

Query: 472 --TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                      W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 571 XXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_SHESM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  158 bits (399), Expect = 1e-40
 Identities = 144/526 (27%), Positives = 228/526 (43%), Gaps = 34/526 (6%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++            + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNIDDALKHPDVTS 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPK 186
            E  I L    G     I G + +W +L     E  +V   G +D   ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKV-DWIEGRDVWWHSLVETASEHCAVEEMGAEDPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD  P   +++     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYKPG--EIYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGIPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQHFDKYDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 ENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFY 412
              N +EG   G + +          + G H R          G + TGD ARRDE+G+Y
Sbjct: 451 NMGNILEGATEGNLVLLDSWPGQMRTVYGDHERFVLTYFKTFRGMYFTGDGARRDEDGYY 510

Query: 413 FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA- 471
           +I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V    G  
Sbjct: 511 WITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGTX 570

Query: 472 --TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                      W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 571 XXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_BRAJA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 648

 Score =  158 bits (399), Expect = 1e-40
 Identities = 135/502 (26%), Positives = 228/502 (45%), Gaps = 31/502 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN+L +R ++ GD+V +  P +P   +      + GA+   +    +P  +   + D 
Sbjct: 118 RMANILRTRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDSLAQRINDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFW-- 152
            +K +        G  ++PL      A  +    + ++ +    G      P  + ++  
Sbjct: 178 QSKVIITADEGLRGGKKVPLKANVDAALAKADGVD-WVVVVKRTGGKIDMNPTRDLWYHE 236

Query: 153 -AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAP 210
            AA+       E +  E  D   I+YTSG+TGQPKG   T    L++ A+    +FD   
Sbjct: 237 AAAMVTTECPVEHMHAE--DPLFILYTSGSTGQPKGVLHTSAGYLVYAAMTHQYVFDY-- 292

Query: 211 DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFA 266
              D++     +  + G + ++   L    T ++   +P + D     ++++K KV  F 
Sbjct: 293 HDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDNSRFWNVIDKHKVNTFY 352

Query: 267 GVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYG 322
             PT    L+   GD  +K+ S+ +L    S G  +  E         G +   I++ + 
Sbjct: 353 TAPTAIRALMQG-GDEPVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWW 411

Query: 323 LSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC---- 377
            +ET  ++    P   K KPGS   P +GV  ++VD +   +EGE  G + +        
Sbjct: 412 QTETGGILITPLPGATKLKPGSATQPFFGVVPEIVDADGKVLEGETTGNLCLTRAWPGMM 471

Query: 378 -VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEE 436
             + G H R E        G + TGD  RRD +G+Y+I  R  D+I   G+ +   E+E 
Sbjct: 472 RTVYGDHARFEQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVES 531

Query: 437 VLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPR 493
            L+ H +VS AAVVG PHD  G+ I A+V    G   TED   EL+ W ++ +     P 
Sbjct: 532 ALVAHEKVSEAAVVGFPHDIKGQGIYAYVTLMAGVQPTEDLRKELVTWVRKEIGPIASPD 591

Query: 494 IVEFRTELPMTATGKILKRELR 515
            ++F   LP T +GKI++R LR
Sbjct: 592 QIQFAPGLPKTRSGKIMRRILR 613


>ACSA_SHESR RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  157 bits (397), Expect = 2e-40
 Identities = 142/526 (26%), Positives = 228/526 (43%), Gaps = 34/526 (6%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++            + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHTQVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNIDDALKHPDVTS 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E  ++   G +D   ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKV-DWVEGRDVWWHSLVETASEHCAIEEMGAEDPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD  P   +++     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYKPG--EIYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGIPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQHFDKYDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 ENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFY 412
              N +EG   G + +          + G H R          G + TGD ARRDE+G+Y
Sbjct: 451 NMGNILEGATEGNLVLLDSWPGQMRTVYGDHERFVLTYFKTFRGMYFTGDGARRDEDGYY 510

Query: 413 FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA- 471
           +I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V    G  
Sbjct: 511 WITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGTX 570

Query: 472 --TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                      W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 571 XXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_BRASO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  157 bits (397), Expect = 2e-40
 Identities = 132/499 (26%), Positives = 217/499 (43%), Gaps = 25/499 (5%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN+L +R ++ GD+V +  P +P   +      + GA+   +    +P  +   ++D 
Sbjct: 118 KMANILRNRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDSLAQRIKDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
            +K +        G  ++PL      A                 G           +  A
Sbjct: 178 DSKVVITADEGLRGGRKVPLKANVDAALXXXXXXXXXXXXXRTGGKIEMNPTRDLWYHEA 237

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSH 213
                 E        +D   I+YTSG+TGQPKG    T   L++ ++    +FD      
Sbjct: 238 AEMVTTECPVEHMNAEDALFILYTSGSTGQPKGVLHTTGGYLVYASMTHQYVFDY--HEG 295

Query: 214 DVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRF-DGDEALSLMEKEKVTIFAGV 268
           DV+     +  + G + ++   L  +G + LM    P + D     ++++K KV IF   
Sbjct: 296 DVYWCTADVGWVTGHSYILYGPL-ANGAVTLMFEGVPNYPDNSRFWNVIDKHKVNIFYTA 354

Query: 269 PTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSE 325
           PT    L+        K   ++L    S G  +  E         G     I++ +  +E
Sbjct: 355 PTAIRALMQGGDGPVTKTSRESLRLLGSVGEPINPEAWEWYHRVVGDNRCPIVDTWWQTE 414

Query: 326 TSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VM 379
           T  ++    P   + KPGS   P +GV  ++VD + NT+EG   G + +          +
Sbjct: 415 TGGILITPLPGATRLKPGSATRPFFGVVPEIVDADGNTLEGATEGNLCLTRSWPGQMRTV 474

Query: 380 KGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLM 439
            G H R E        G + TGD  RRD +G+Y+I  R  D+I   G+ +   E+E  L+
Sbjct: 475 YGDHARFEMTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALV 534

Query: 440 THPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVE 496
            HP+VS AAVVG PHD  G+ I A+V    G T +E+   EL+ W ++ +     P  ++
Sbjct: 535 AHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGETPSEELRKELVGWVRKEIGPIASPDQIQ 594

Query: 497 FRTELPMTATGKILKRELR 515
           F   LP T +GKI++R LR
Sbjct: 595 FSQGLPKTRSGKIMRRILR 613


>ACSA_XANOM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  157 bits (396), Expect = 3e-40
 Identities = 137/504 (27%), Positives = 224/504 (44%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++ N L + G++ GD+V +  P +           + GAV   +        I   + D 
Sbjct: 118 KLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGATTSAIPGAETFW 152
            +K +        G  ++PL      A +       E  + +    GA     P    F 
Sbjct: 178 QSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTIETVLVVRHTGGAVEMQAPRDRWFH 237

Query: 153 AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPD 211
             ++GQP E E  R   +D   I+YTSG+TG+PKG   T    LLF +     +FD   D
Sbjct: 238 DVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRED 297

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAG 267
             D++     +  + G + ++   L    T V+   +P +        +++K +VTIF  
Sbjct: 298 --DIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYT 355

Query: 268 VPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLS 324
            PT    L+    +   K   ++L    S G  +  E  R   +  G     I++ +  +
Sbjct: 356 APTAIRALMRDGAEPVKKTSRKSLRLLGSVGEPINPEAWRWYYDVVGDSRCPIVDTWWQT 415

Query: 325 ETSPVVSFNNPKRKA---KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKG 381
           ET  ++   +P   A   KPGS  LP +GV+  LVD     +EG   G + +       G
Sbjct: 416 ETGGILI--SPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDS--WPG 471

Query: 382 YHNRPEANAQVMRDGWFRT-------GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
                  + Q   D +FRT       GD  RRD +G+Y+I  R  D+I   G+ +   E+
Sbjct: 472 QMRSVYGDHQRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEV 531

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L++HP+V+ AAVVG PHD  G+ I A+V    G T +++   EL++W ++ +     
Sbjct: 532 ESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGETPSDELHKELVSWVRKEIGPIAS 591

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P  +++   LP T +GKI++R LR
Sbjct: 592 PDHLQWAPGLPKTRSGKIMRRILR 615


>4CLL5_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 5;       
           EC=6.2.1.-;
          Length = 542

 Score =  157 bits (396), Expect = 3e-40
 Identities = 110/364 (30%), Positives = 181/364 (49%), Gaps = 50/364 (13%)

Query: 171 DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD---------------- 214
           D A ++Y+SGTTG+ K   +TH NL+       AL     D+ +                
Sbjct: 197 DTAAVLYSSGTTGRVKAVAITHRNLI-------ALMSLHADNREKVARXXXXXXXXXXXX 249

Query: 215 -VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYW 273
                    FH+FG   ++ +      T VLM RFD   AL  +E+ +VT+    P +  
Sbjct: 250 XXXXXXXXXFHVFGFMMVLRSVSMGE-TSVLMERFDFIAALRAIERYRVTLLPAAPPVLV 308

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETSPVVSF 332
            ++  + +   + +S  L   + GGA L  EVA +    F  +E+++GYGL+E+S  V+ 
Sbjct: 309 AMVKYE-EARRRDLSSLLVIGI-GGAPLGREVAEQFASVFPNVELVQGYGLTESSGAVAA 366

Query: 333 N-NPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ 391
              P+     GS+G     ++ K+VD +                     GY    EA A 
Sbjct: 367 TVGPEESKAYGSVGKLGSHLQAKIVDPS--------------------TGYVGDDEATAA 406

Query: 392 VM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV 450
            +  +GW +TGD+   +E+GF +I+DR K++I   GY V P E+E +L +HP ++ AAV+
Sbjct: 407 TVDSEGWLKTGDLCYFNEDGFLYIVDRLKELIKYKGYQVPPAELEHILQSHPGIADAAVI 466

Query: 451 GVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
             P +  GE   AF++   G+ +T+++++ +  +++A YK  R V F T +P +  GKIL
Sbjct: 467 PYPDEEAGELPMAFIVRQPGSNITKEQVMDYVAKQVAPYKKVRRVAFVTAIPKSPAGKIL 526

Query: 511 KREL 514
           +REL
Sbjct: 527 RREL 530



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 36  IANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95
           + +    L  S G+RPGD   +  P+    P + F  +  GAVV P N + TP E  + +
Sbjct: 83  VRSLAGGLWCSLGLRPGDVALVVAPSRLEVPVLDFALMSIGAVVSPANPVSTPEEYAHQV 142


>ACSA_SODGM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  156 bits (395), Expect = 3e-40
 Identities = 150/539 (27%), Positives = 238/539 (44%), Gaps = 35/539 (6%)

Query: 8   LEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           L+   + R ++ AI++ GD       L Y  ++    + AN+L ++GI  GD VAL  P 
Sbjct: 82  LDRHLQERGDQTAIIWEGDDASQSKTLTYRQLHQAVCRFANVLKAQGIGKGDVVALYMPM 141

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGER 117
           VP          + GAV   +    +P  I   + DS AK +           ++PL + 
Sbjct: 142 VPEAAVAMLACARIGAVHSVIFAGFSPEAIAGRIIDSSAKLVVTADEGLRAGRKIPLKKN 201

Query: 118 AWQAFQ--EVAECELYIDLPAAAGATTSAIPGAETFWA-ALNGQPGEFESVRTEGDDVAV 174
              A    EV      I       A     P  + +W  A++G            +D   
Sbjct: 202 IDDALNHPEVKSVNRVIVFRRTGNAIDWQ-PERDVWWHDAIDGADDTCPPEAMGAEDPLF 260

Query: 175 IIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
           I+YTSG+TG PKG    T   L++ A     +FD  P   DV+     +  + G + ++ 
Sbjct: 261 ILYTSGSTGTPKGVLHTTGGYLVYAATTFKYVFDYHPG--DVYWCTADVGWVTGHSYLLY 318

Query: 234 AALYRHGTMVLMPRFDGDEALSLM----EKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ 289
             L      ++        A S M    +K +V I    PT    L+ A+GD  I    +
Sbjct: 319 GPLACCAITLMFEGVPNWPAASRMAQVVDKHQVNILYTAPTAIRALM-AEGDKAITGTHR 377

Query: 290 T-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPKRKA-KPGSI 344
           + L    S G  +  E       K G     I++ +  +ET   +    P   A KPGS 
Sbjct: 378 SSLRIMGSVGEPINPEAWEWYYHKIGNGRCPIVDTWWQTETGGFMITPLPGAMALKPGSA 437

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFR 399
            LP +GV+  LVD     ++G G G + +          + G H+R +        G + 
Sbjct: 438 ALPFFGVQPALVDNVGTPVDGAGEGNLVITDSWPGQARTLYGDHDRFKQTYFYTFKGMYF 497

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+PH+  G+
Sbjct: 498 SGDGARRDEDGYYWITGRVDDVLNVSGHRLGTSEIESALVAHPKIAEAAVVGMPHNIKGQ 557

Query: 460 EIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            I A++    G T T +   E+ AW ++ + A   P ++ +   LP T +GKI++R LR
Sbjct: 558 AIYAYITLNAGETPTPELYNEVRAWMRKEIGAIATPDVLHWTDSLPKTRSGKIMRRILR 616


>ACSA_SHEON RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  156 bits (395), Expect = 3e-40
 Identities = 140/513 (27%), Positives = 225/513 (43%), Gaps = 27/513 (5%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           ++ Y  ++    + AN L S+G+R GD V +  P VP          + GAV   +    
Sbjct: 107 KITYGELHTQVCKFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGF 166

Query: 87  TPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGA 140
           +P  I   + D  +K +        G   +PL      A +  +V   E  I L    G 
Sbjct: 167 SPDSIASRVIDGKSKIVITSDEGMRGGRAIPLKRNIDDALKHPDVTSVEKVIVLKRTGGK 226

Query: 141 TTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFN 198
               + G + +W +L     E  +V   G +D   ++YTSG+TG PKG    T   +++ 
Sbjct: 227 I-DWVEGRDVWWHSLVETASEHCAVEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYA 285

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS 255
           ++    +FD  P   +++     +  I G + M+   L    T+++   +P       L 
Sbjct: 286 SMTHEYVFDYKPG--EIYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLG 343

Query: 256 -LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            ++++ KV I    PT+   L+     H  K    +L    S G  +  E  R   E  G
Sbjct: 344 EMIDRHKVNILYTAPTLIRALMAEGKQHFDKYNGSSLRIMGSVGEPINPEAWRWYHEVIG 403

Query: 315 IE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N +EG   G 
Sbjct: 404 HEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGATEGN 463

Query: 371 IAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRG 425
           + +          + G H R          G + TGD ARRDE+G+Y+I  R  D+I   
Sbjct: 464 LVLLDSWPGQMRTVYGDHERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVS 523

Query: 426 GYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA---TLTEDELIAWA 482
           G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V    G             W 
Sbjct: 524 GHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRGTXXXXXXXXXXXXWV 583

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 584 RKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_HALHL RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  156 bits (394), Expect = 4e-40
 Identities = 138/513 (26%), Positives = 225/513 (43%), Gaps = 25/513 (4%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  + Y  +     ++AN L +RG++ GD+V +  P VP          + GAV   +  
Sbjct: 104 DEHITYRDLYERVGRLANALKARGVKKGDRVCIYLPMVPEAAVAMLACARIGAVHSIVFG 163

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA 140
             +P  +   ++D+ A+ +        G   +PL     +A +     +    +    G 
Sbjct: 164 GFSPEALRDRIQDADAEVVITSDEGVRGGRSIPLKANTDKALEGCPNVKTVFVVRRTGGD 223

Query: 141 TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQ-LTHTNLLFNA 199
                     F  A      +      + +D   I+YTSG+TG+PKG Q  T   LL  A
Sbjct: 224 IAWNDGRDVWFHEACAEASPDCPPEHMDAEDPLFILYTSGSTGKPKGVQHSTAGYLLGTA 283

Query: 200 VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRF-DGDEAL 254
           +    +FD      +V+     +  + G + ++   L  +G   LM    P + D     
Sbjct: 284 MTHKYIFDY--QDGEVYWCTADVGWVTGHSYIVYGPL-ANGAKTLMFEGVPTYPDAGRFW 340

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            +++K +V+IF   PT    L+    DH  K   ++L    + G  +  E         G
Sbjct: 341 QVVDKHEVSIFYTAPTAIRALMGQGDDHVKKTSRKSLRILGTVGEPINPEAWEWYYHTIG 400

Query: 315 IE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            +   I++ +  +ET  ++    P     KPGS  LP +GVE +LVD+  N +EG   G 
Sbjct: 401 EDRCPIVDTWWQTETGSILIAPLPGAMDLKPGSATLPFFGVEPQLVDDKGNVLEGATNGN 460

Query: 371 IAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRG 425
           + +          + G H R          G + TGD ARRDE+G+Y+I  R  D+I   
Sbjct: 461 LVINRAWPSMMRTIYGDHERFFNTYLAAYPGKYFTGDGARRDEDGYYWITGRVDDVINVS 520

Query: 426 GYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWA 482
           G+ +   E+E  L+ H +VS AAVVG PHD  G+ I A+V    G   +++   EL+   
Sbjct: 521 GHRMGTAEVESALVLHDKVSEAAVVGYPHDVKGQGIYAYVTLMAGEEPSDELKQELVKLC 580

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            + +     P I++F   LP T +GKI++R LR
Sbjct: 581 IQEIGPIAKPDIIQFAPGLPKTRSGKIMRRILR 613


>ACSA_XANCP RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  155 bits (393), Expect = 6e-40
 Identities = 139/505 (27%), Positives = 225/505 (44%), Gaps = 35/505 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++ N L + G++ GD+V +  P +           + GAV   +        I   + D 
Sbjct: 118 KLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGATTSAIPGAETFW 152
            +K +        G  ++PL      A +       E  + +    GA     P    F 
Sbjct: 178 QSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGGAVDMQAPRDRWFH 237

Query: 153 AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPD 211
             ++GQP E E  R   +D   I+YTSG+TG+PKG   T    LLF +     +FD   D
Sbjct: 238 DVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRED 297

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAG 267
             D++     +  + G + ++   L    T V+   +P +        +++K +VTIF  
Sbjct: 298 --DIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYT 355

Query: 268 VPTMYWGLLNAQGDHDIKQISQTLHTAV-SGGASLPAEVARKVKEKFG---IEILEGYGL 323
            PT    L+  +G+  +K+          S G  +  E  R   E  G     I++ +  
Sbjct: 356 APTAIRALMR-EGEAPVKKTXXXXXXXXGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQ 414

Query: 324 SETSPVVSFNNPKRKA---KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMK 380
           +ET  ++   +P   A   KPGS  LP +GV+  LVD     +EG   G + +       
Sbjct: 415 TETGGILI--SPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDS--WP 470

Query: 381 GYHNRPEANAQVMRDGWFRT-------GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
           G       + Q   D +FRT       GD  RRD +G+Y+I  R  D+I   G+ +   E
Sbjct: 471 GQMRTVYGDHQRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAE 530

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYK 490
           +E  L++HP+V+ AAVVG PHD  G+ I A+V    G T +E+   EL++W ++ +    
Sbjct: 531 VESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGETPSEELHKELVSWVRKEIGPIA 590

Query: 491 YPRIVEFRTELPMTATGKILKRELR 515
            P  +++   LP T +GKI++R LR
Sbjct: 591 SPDHLQWAPGLPKTRSGKIMRRILR 615


>ACSA_XANC8 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  155 bits (393), Expect = 6e-40
 Identities = 139/505 (27%), Positives = 225/505 (44%), Gaps = 35/505 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++ N L + G++ GD+V +  P +           + GAV   +        I   + D 
Sbjct: 118 KLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAAGATTSAIPGAETFW 152
            +K +        G  ++PL      A +       E  + +    GA     P    F 
Sbjct: 178 QSKLIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGGAVDMQAPRDRWFH 237

Query: 153 AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPD 211
             ++GQP E E  R   +D   I+YTSG+TG+PKG   T    LLF +     +FD   D
Sbjct: 238 DVVDGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRED 297

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAG 267
             D++     +  + G + ++   L    T V+   +P +        +++K +VTIF  
Sbjct: 298 --DIYWCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYT 355

Query: 268 VPTMYWGLLNAQGDHDIKQISQTLHTAV-SGGASLPAEVARKVKEKFG---IEILEGYGL 323
            PT    L+  +G+  +K+          S G  +  E  R   E  G     I++ +  
Sbjct: 356 APTAIRALMR-EGEAPVKKTXXXXXXXXGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQ 414

Query: 324 SETSPVVSFNNPKRKA---KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMK 380
           +ET  ++   +P   A   KPGS  LP +GV+  LVD     +EG   G + +       
Sbjct: 415 TETGGILI--SPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDS--WP 470

Query: 381 GYHNRPEANAQVMRDGWFRT-------GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
           G       + Q   D +FRT       GD  RRD +G+Y+I  R  D+I   G+ +   E
Sbjct: 471 GQMRTVYGDHQRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAE 530

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYK 490
           +E  L++HP+V+ AAVVG PHD  G+ I A+V    G T +E+   EL++W ++ +    
Sbjct: 531 VESALVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAGETPSEELHKELVSWVRKEIGPIA 590

Query: 491 YPRIVEFRTELPMTATGKILKRELR 515
            P  +++   LP T +GKI++R LR
Sbjct: 591 SPDHLQWAPGLPKTRSGKIMRRILR 615


>4CLL1_ARATH RecName: Full=4-coumarate--CoA ligase-like 1;       
           EC=6.2.1.-;AltName: Full=4-coumarate--CoA ligase isoform
           10;         Short=At4CL10;
          Length = 542

 Score =  155 bits (393), Expect = 6e-40
 Identities = 129/504 (25%), Positives = 212/504 (42%), Gaps = 40/504 (7%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  V     ++A  L S G+R G  + +  PNV  +  +  G + AG V    N    
Sbjct: 54  VTYGDVVRDTKRLAKALTSLGLRKGQVMVVVLPNVAEYGIIALGIMSAGGVFSGANPTAL 113

Query: 88  PREIEYHLRDSGAKALFAFT---------GTPELPLGERAWQAFQEVAECELYIDLPAAA 138
             EI+  +  SGA+ +             G P + LGE      +++     + DL  A 
Sbjct: 114 VSEIKKQVEASGARGIITDATNYEKVKSLGLPVIVLGE------EKIEGAVNWKDLLEAG 167

Query: 139 GATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
                                G+ ++      D+  + ++SGTTG  KG  LTH NL+ N
Sbjct: 168 DKC------------------GDTDNEEILQTDLCALPFSSGTTGLQKGVMLTHRNLIAN 209

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLME 258
             ++            V L ++P FHI+G   +  A +   G +V M R+D    L+ + 
Sbjct: 210 LCSTLFGVRSEMIGQIVTLGLIPFFHIYGIVGICCATMKNKGKVVAMSRYDLRIFLNALI 269

Query: 259 KEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEI 317
             +V+    VP +   L+      +       L + +                KF  +++
Sbjct: 270 AHEVSFAPIVPPIILNLVKNPIVDEFDLSKLKLQSVMXXXXXXXXXXXXXXXXKFPNVQV 329

Query: 318 LEGYGLSETSPVVSFNNPKRK----AKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIA 372
            E YGL+E S +   +    K    AK  S+G  +  +E+K +D +   ++     GE+ 
Sbjct: 330 QEAYGLTEHSCITLTHGDPEKGQGIAKRNSVGFILPNLEVKFIDPDTGRSLPKNTSGELC 389

Query: 373 VRGHCVMKGYH-NRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
           VR  CVM+GY  N+ E +  +   GW  T                  K++I   G+ V P
Sbjct: 390 VRSQCVMQGYFMNKEETDKTIDEQGWLHTXXXXXXXXXXXXXXXXXXKELIKYKGFQVAP 449

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKY 491
            E+E +L+THP V   AVV +P +  GE   A V+    AT  E++++ +    +A YK 
Sbjct: 450 AELEAILLTHPSVEDVAVVPLPDEEAGEIPAACVVINPKATEKEEDILNFVAANVAHYKK 509

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
            R V F   +P + +GKI++R LR
Sbjct: 510 VRAVHFVDSIPKSLSGKIMRRLLR 533


>LGRC_BREPA RecName: Full=Linear gramicidin synthetase subunit
            C;Includes:  RecName: Full=ATP-dependent valine
            adenylase;           Short=ValA;
          Length = 7756

 Score =  155 bits (392), Expect = 7e-40
 Identities = 132/524 (25%), Positives = 222/524 (42%), Gaps = 65/524 (12%)

Query: 9    EDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
            E      P+  A+V+ D+ L YA +N  ANQ+A+ L++ G++P + V +     P     
Sbjct: 5649 EQQVEKTPDAVALVYKDVELTYAELNERANQLAHRLLAEGVKPDELVGICVERSPEMIVA 5708

Query: 69   YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTG-TPELPLGERAWQAFQEVAE 127
            + G +KAGA  VPL+       I Y + DS A  L      T  LP   R          
Sbjct: 5709 FLGVMKAGAAYVPLDPAHPQERIAYMIEDSQASVLLTQASLTDRLPASSRQ--------- 5759

Query: 128  CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
              + +D    A      +  AET         GE         ++A +IYTSG+TG PKG
Sbjct: 5760 -VICLDSDELAN---EPVTNAET-------SVGEH--------NLAYVIYTSGSTGLPKG 5800

Query: 188  AQLTHTNLL---------FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
              + H +++         F   A+S +      S DV ++ + +  + G T ++      
Sbjct: 5801 VMIEHRSVINLAYDLIRHFQIDATSRVLQFISFSFDVSVSEIVMSLLAGATLVIE----- 5855

Query: 239  HGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
                 L+P   G E + +++++++T FA        ++++              T + GG
Sbjct: 5856 -DRESLLP---GPELIRVLQEQRITTFA--------MVSSVXXXXXXXXXXXXRTIIVGG 5903

Query: 299  ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDE 358
             +   E+  +     G + +  YG +ET+   +  + +   K   IG PI    + ++D 
Sbjct: 5904 EAPSRELVARYAT--GRQFINCYGPTETTVTATLKHCQDDGKNPPIGRPIANTTVYVLDA 5961

Query: 359  NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM--------RDGWFRTGDIARRDEEG 410
            +   +    PGE+ + G  V +GY NRPE  A+           +  +RTGD+ R  E G
Sbjct: 5962 HLQPVPIGVPGELYIGGKGVARGYWNRPELTAERFIADPFGQADERLYRTGDLVRYLENG 6021

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R  D +   GY +   EIE  L  HP V    V+        + + A+++ A G
Sbjct: 6022 ELEFLGRIDDQVKIRGYRIELGEIENALRQHPAVQNVVVIARQEGAGDKRLAAYLVAATG 6081

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                E EL+ + K  L  Y  P    +  ++P+T  GK+ +R L
Sbjct: 6082 QQPDEAELVRYLKSTLPEYMVPAGYVWLEKIPLTVNGKVDRRAL 6125



 Score =  139 bits (349), Expect = 7e-35
 Identities = 125/522 (23%), Positives = 210/522 (40%), Gaps = 66/522 (12%)

Query: 9    EDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
            E      P+  A+++ D+ L YA +N  ANQ+A+ L+++ ++P   V +     P     
Sbjct: 3070 EQQVEKTPDAVALIYKDVELTYADLNQRANQLAHRLLAQEVKPDTLVGICVERSPEMIIG 3129

Query: 69   YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAEC 128
             FG +KAGA  VP++  L    I Y + DS A  L       EL                
Sbjct: 3130 IFGVMKAGAAYVPIDPALPQERIAYMVEDSQASILLTQQSLAEL---------------- 3173

Query: 129  ELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDV-----AVIIYTSGTTG 183
                            +P  +     L+G     E V     +V     A ++YTSG+TG
Sbjct: 3174 ----------------LPKTQARVICLDGDSLANEPVANPASEVTEQNLAYVMYTSGSTG 3217

Query: 184  QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMM---NAALYRHG 240
             PKG  + H +++  A A    F   P S  +  T         +  M     AAL    
Sbjct: 3218 LPKGVMVEHHSVVNLAHALIEAFRIQPSSRVLQFTSFSFDVSVSEIVMALLAGAALVIED 3277

Query: 241  TMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
              VL+P   G E +S+++++++T  +        ++++              T + GG +
Sbjct: 3278 REVLLP---GPELISVLQQKRITTVS--------MVSSVXXXXXXXXXXXXQTLIVGGEA 3326

Query: 301  LPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENF 360
               E+  +  ++   +    YG +E +   +        K   IG P+    + ++D N 
Sbjct: 3327 PSRELVARYADRR--QFFNCYGPTEATVCSTMMLCNAGMKSAPIGRPLANATLYVLDANQ 3384

Query: 361  NTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ--------VMRDGWFRTGDIARRDEEGFY 412
              +    PGE+ + G  + +GY NRPE  A+           +  +RTGD+ R   +G  
Sbjct: 3385 KPVPVGVPGELYIGGKGLARGYWNRPELTAERFIAHPFGAKGERLYRTGDLVRYLPDGNL 3444

Query: 413  FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT 472
              + R    +   GY +   EIE  L  HP +  A V+        + + A+++ A  A 
Sbjct: 3445 EFLGRIDTQVKIRGYRIELGEIESALSQHPAIQEAVVI-----AWEQRLAAYMVAAGEAQ 3499

Query: 473  LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
               +EL  + KE L  Y  P    F   +P+T  GK+ +R L
Sbjct: 3500 PAAEELARYLKETLPDYMIPAGFVFMDAIPLTVNGKVDRRAL 3541



 Score =  133 bits (335), Expect = 3e-33
 Identities = 140/529 (26%), Positives = 220/529 (41%), Gaps = 62/529 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L  + A   PER A V GD +L YA ++  ANQ+AN L  +G+  G  V L         
Sbjct: 1539 LFAETAARYPERIAAVAGDQQLTYAELDTKANQLANYLQKQGVEAGTLVGLCVDRSLDML 1598

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAG   VPL+       + + L D+    L       +  LG++ W+  +   
Sbjct: 1599 VGLLAILKAGGAYVPLDPAYPEERLAFMLADANVSILLT-----QKHLGKQ-WKGRKRRT 1652

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
               +Y+D  A      S +  A                V    D +A +IYTSG+TG PK
Sbjct: 1653 ---VYLDRDAKKWTAESPLAPA----------------VDATKDSLAYVIYTSGSTGTPK 1693

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL------FHIFGQTTMMNAALYRHG 240
            G  + H  ++     ++ +        DVFL    +      F I+G       AL    
Sbjct: 1694 GVLVAHRGIVRLVKNTNYV---TITEEDVFLQASTVSFDAATFEIWG-------ALLNGA 1743

Query: 241  TMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYW--GLLNAQGDHDIKQISQTLHTAVSGG 298
             +VLMP     +  SL E  +  +   V T++   GL +   DH+   +       V GG
Sbjct: 1744 KLVLMP----PDLPSLDELGEAIVQHKVTTLWLTAGLFSIMVDHNADYLRGVRQLLV-GG 1798

Query: 299  ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGS---IGLPIWGVEMKL 355
              +     RKV    G+ ++ GYG +E +           A+  +   IG PI    + +
Sbjct: 1799 DVVSVPHVRKVLALDGVTVINGYGPTENTTFTCCYPVTELAEEITSFPIGRPISNTTVYV 1858

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF---------RTGDIARR 406
            +D+N   +     GE+ + G  +  GY N PE  A+   D  F         RTGD+ R 
Sbjct: 1859 LDKNRQPVPLGVAGELYIGGDGLASGYLNNPELTAERFVDNPFDPQKASRLYRTGDLVRY 1918

Query: 407  DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE-IKAFV 465
              +G    I R  + +   G+ +   EIE  L+ HP V  A ++ V  D  G++ + A++
Sbjct: 1919 LPDGAIEFIGRIDNQVKIRGFRIELGEIETALLRHPAVQEAFLM-VREDAPGDKRLAAYL 1977

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            + A G T+   E+ ++ K++L  Y  P         P+T  GK+ +R L
Sbjct: 1978 VFAGGQTVEPVEMRSYLKDKLPEYMIPSAFVQMDSFPLTPNGKVDRRAL 2026



 Score =  127 bits (319), Expect = 2e-31
 Identities = 136/531 (25%), Positives = 208/531 (39%), Gaps = 65/531 (12%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L  + A   PER A V GD +L YA +   ANQ+AN L  +G+  G  V L         
Sbjct: 473 LFAETAARHPERIAAVAGDQQLTYAELEARANQLANYLQKQGVEAGTLVGLCVDRSLDMX 532

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                        VP++       + + L D+    L       +  LG++ W+  +   
Sbjct: 533 XXXXXXXXXXXXYVPIDPAYPEERLAFMLADAKISILLT-----QKHLGKQ-WKGRKRRT 586

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
              +Y+D  A   A  S +                   V T  D +A +IYTSG+TG PK
Sbjct: 587 ---VYLDRDAKKWAEESPLA----------------PDVDTTKDSLAYVIYTSGSTGTPK 627

Query: 187 GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL------FHIFGQTTMMNAALYRHG 240
           G    H  ++   +             DVFL    +      F I+G       AL    
Sbjct: 628 GVLAVHRGVV--RLGQKTRTTSPISEADVFLQASTVSFDAATFEIWG-------ALLNGA 678

Query: 241 TMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYW--GLLNAQGDHDIKQISQTLHTAVSGG 298
            +VLMP     +  SL E  +  +   V T++   GL +   DH+   +       V GG
Sbjct: 679 KLVLMP----PDLPSLDELGEAIVQHKVTTLWLTAGLFSIMVDHNADYLRGVRQLLV-GG 733

Query: 299 ASLPAEVARKVKEKFGIEILEGYGLSETS------PVVSFNNPKRKAKPGSIGLPIWGVE 352
             +     RKV    G+ ++ GYG +E +      PV   +          IG PI    
Sbjct: 734 DVVSVPHVRKVLALGGVTVINGYGPTENTTFTCCYPVTELSEDITSFP---IGRPISNTT 790

Query: 353 MKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF---------RTGDI 403
           + ++D++   +     GE+ + G  +  GY N  E  A+   +  F         RTGD+
Sbjct: 791 VYVLDKHKQPVPYGAAGELYIGGDGLALGYLNNAELTAERFVENPFDPQKGSRLYRTGDL 850

Query: 404 ARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKA 463
            R    G    I R  + +   G+ +   E+E  L  HP+VS   V+   +D   + + A
Sbjct: 851 VRYLPNGTIEFIGRIDNQVKIRGFRIELGEVEAALALHPEVSETVVMARENDRGEKHLTA 910

Query: 464 FVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           +V  A+       +L AW K +L  Y  P    F   +P+TA GKI +R L
Sbjct: 911 YVTVAKDDAPEVADLQAWLKTKLPEYMVPSAYVFLDAMPLTANGKIDRRRL 961



 Score =  114 bits (285), Expect = 2e-27
 Identities = 131/523 (25%), Positives = 203/523 (38%), Gaps = 62/523 (11%)

Query: 12   ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
            A   PE+ A+V  +  L YA ++  ANQ+AN L  +GI P   V +             G
Sbjct: 6706 AEKMPEQLAVVSAEGSLTYAQLDAKANQLANYLQQQGITPETLVGICVERSSEMIVGQLG 6765

Query: 72   ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
             LKAG   VP++       + + + D         TG P +   ER  +           
Sbjct: 6766 ILKAGGAFVPMDPAYPQERLAFMMAD---------TGMPFVLTQERLLET---------- 6806

Query: 132  IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
              LPA   A        +  W  +  +  +   +    D +A +IYTSG+TG PKG ++ 
Sbjct: 6807 --LPAGDAAFICL----DADWEVIAEESTQAPELAVTTDQLAYVIYTSGSTGTPKGVEIE 6860

Query: 192  HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR------HGTMVLM 245
            H  LL         +   PD             I G  T  +AA++        G  + +
Sbjct: 6861 HRALLNLIYWHQHAYTITPDDR--------ASQIAG--TAFDAAVWEIWPYMTAGATLYL 6910

Query: 246  PRFDGDEALSLMEKEKVTIFA-GVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPA 303
            P+   +E   + EK +  + A G+   +     A+    +   S   L   ++GG  L  
Sbjct: 6911 PQ---EEIRLIPEKLRDWLVAEGITISFLPTPLAESMLSVDWPSHAALRYVLTGGDKLHH 6967

Query: 304  EVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA---KPGSIGLPIWGVEMKLVDENF 360
              A  V       ++  YG +E + V +      +A    P SIG PI  V++ ++DE  
Sbjct: 6968 YPAEHVP----FTLVNQYGPTENAVVATAGIVAVQAGQVTPPSIGRPIDNVQVYILDEQR 7023

Query: 361  NTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF---------RTGDIARRDEEGF 411
              +     GE+ + G  + +GY+ RP+   +   D  F         RTGD+ R   +G 
Sbjct: 7024 QPVPIGVTGELYIAGSSLARGYYKRPDLTQERFVDNPFTANRGAKMYRTGDLVRYLPDGQ 7083

Query: 412  YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA 471
               I RS D +   G+ V   EIE VL  HP V  A V+        + +          
Sbjct: 7084 IEFIGRSDDQVSIRGFRVELGEIESVLYQHPAVKEAIVLAREDMPGVKRLXXXXXXXXXX 7143

Query: 472  TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                  L  + KE+L  Y  P        LP+T  GK+ +R L
Sbjct: 7144 XXXXXXLRGYLKEKLPEYMVPAAFVTLKALPLTPNGKVDRRAL 7186



 Score =  105 bits (263), Expect = 7e-25
 Identities = 130/536 (24%), Positives = 219/536 (40%), Gaps = 85/536 (15%)

Query: 12   ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
            A+  P + A+V  + ++ YA ++  ANQVAN L  +GI     V +             G
Sbjct: 4122 AQQLPNQLAVVSDEGQITYAELDAKANQVANYLHKQGIISETLVGVCLDRSIDMLVAQLG 4181

Query: 72   ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
             LKAG   VP++       + + ++D+            E+P+          + +  L 
Sbjct: 4182 ILKAGGAYVPMDPAYPQERLAFMMQDA------------EMPV---------VLTQEHLL 4220

Query: 132  IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
              LP A  AT   +   +  W+ +  +      + T  D++A +IYTSG+TG PKG ++ 
Sbjct: 4221 AQLPEAR-ATFLCL---DRDWSLIAEESDVAPVIATNRDNLAYVIYTSGSTGTPKGVEIE 4276

Query: 192  HTNLL---------FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            H  LL         +   A       A  + D  +  +  +   G T  + +   R    
Sbjct: 4277 HAALLNLVSWHQRAYEVGAEDRATQIAGTAFDASVWEIWPYLTKGATLYLPSEEIR---- 4332

Query: 243  VLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG---- 298
             L+P    ++    +    +TI      +   LL  +   D K     L   ++GG    
Sbjct: 4333 -LVP----EQLRDWLVASGITISFLPTPLAERLLTLEWPSDAK-----LRYMLTGGDKLH 4382

Query: 299  ----ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA---KPGSIGLPIWGV 351
                A+LP  +A +            YG +E + V +       A      SIG PI  V
Sbjct: 4383 DYPPATLPFVLANQ------------YGPTENAVVATAGIVPAAAGQVSAPSIGRPIDNV 4430

Query: 352  EMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDG--WFRTGD 402
            ++ ++DE    +     GE+ + G  + +GY +RP+       AN    + G   ++TGD
Sbjct: 4431 QVYVLDEKLQPVPIGVAGELYIAGDSLARGYLHRPDLTRERFIANPYGQKAGARMYKTGD 4490

Query: 403  IARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG-EEI 461
            + R   +G    I R+ D +   G+ V   EIE  L +HP V    +V V  D  G + +
Sbjct: 4491 LVRYLPDGNIEFIGRADDQVSIRGFRVELGEIETALYSHPAVK-ETIVLVREDMPGMKRL 4549

Query: 462  KAFVIP---AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             A+++     EG  +   +  ++ KE L  Y  P    F  +LP+T  GK+ +R L
Sbjct: 4550 VAYIVQREGQEGQAVQAGDFRSYLKELLPEYMVPAAFVFMADLPLTPNGKVDRRAL 4605


>4CLL7_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 7;       
           EC=6.2.1.-;
          Length = 558

 Score =  155 bits (391), Expect = 1e-39
 Identities = 139/483 (28%), Positives = 202/483 (41%), Gaps = 35/483 (7%)

Query: 40  VANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           +A  L SR G+R GD   +  P     P +YF  L  GAVV P N  LTP E+       
Sbjct: 91  LAGALRSRVGLRGGDVAFVLAPAGLDVPVLYFALLSIGAVVSPANPALTPAEVSRLXXXX 150

Query: 99  GAKALFAFTGTP-ELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNG 157
                     T  +LP G              L +D   A G     +            
Sbjct: 151 XXXXXXXXXXTATKLPAGLTTVVLLDSPHFRSLLMDCGQAQGQEPLPV------------ 198

Query: 158 QPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFL 217
                  V     + A I Y+SGTTG+ K A L H + +       AL  +A +     L
Sbjct: 199 -------VVVRQSETAAIQYSSGTTGRVKAAALPHRSFIAMVAGFHALRAKAREVRT--L 249

Query: 218 TVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK---VTIFAGVPTMYWG 274
              P+FH  G   ++                       L+E  +   V      P +  G
Sbjct: 250 LGAPMFHSMGFLFVLQXXXXXXXXXXXXXXXXXXXIRGLVEAAERWAVMDMTASPPVVLG 309

Query: 275 LLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG-IEILEGYGLSETSPVVSFN 333
           +   +           L     GGA LPA    + + +F  +++  GYG +E   +    
Sbjct: 310 MTKQRCR------LPALERITCGGAPLPAPAIERFRRRFPHVDLCMGYGSTEAGGISRMI 363

Query: 334 NPKRKAKPGSIGLPIWGVEMKLVDE-NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQV 392
           + +     GS G     VE+K+VD      +     GE+ VRG  VM GY    EANA  
Sbjct: 364 SQEECNHIGSAGRVTENVEVKIVDHVTGKPLPAGQQGELWVRGPAVMTGYVGDNEANATT 423

Query: 393 MR-DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG 451
              +GW +TGD+   D++GF F++DR K++I    Y V P E+E VL + PQ+  AAV+ 
Sbjct: 424 FNSEGWLKTGDLCYIDQDGFLFVVDRLKELIKYKAYQVPPAELELVLHSLPQIVDAAVMP 483

Query: 452 VPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILK 511
            PH+  G+   A V+   G+ LTE E++    +++A YK  R V F   +P + +GKIL+
Sbjct: 484 YPHEEAGQIPVALVVKQPGSKLTEAEVMYNVAKQVAPYKKIRKVLFVDSIPKSPSGKILR 543

Query: 512 REL 514
           REL
Sbjct: 544 REL 546


>ACSA_XYLFA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  153 bits (386), Expect = 4e-39
 Identities = 141/529 (26%), Positives = 227/529 (42%), Gaps = 39/529 (7%)

Query: 17  ERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAG 76
           E DA      R+ Y  +     Q+ N L    I  GD+V +  P +P          + G
Sbjct: 96  EPDAPDAPSSRITYRELYERVCQLGNALRHLNIEKGDRVTIYLPMIPDAVVAILACARIG 155

Query: 77  AVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAECEL 130
           A+   +     P  I   + D G+K +        G  ++PL      A +       E 
Sbjct: 156 AIHSVVFGGFAPNSIADRINDCGSKLIITADEGLRGGRKIPLKANVDAALKIHGTQSVET 215

Query: 131 YIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-Q 189
            + +    G      P    F   ++ Q  E    R   +D   I+YTSG+TG+PKG   
Sbjct: 216 VLVVRHTGGTINMHTPRDRWFHHVVDIQATECAPERMNAEDPLFILYTSGSTGKPKGVLH 275

Query: 190 LTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFD 249
            T   L++ +     +FD     +D++     +  I G + ++   L    T++L     
Sbjct: 276 TTGGYLVYTSYTHETVFDLR--ENDIYWCTADIGWITGHSYIVYGPLANGATVLLFEGVP 333

Query: 250 GDEALS----LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAE 304
               +S    +++K  VT+F   PT    L+  +GD  +K+ S+ +L    S G  +  E
Sbjct: 334 HYPTVSRFWEVIDKHHVTLFYTAPTAIRALMR-EGDTPVKKTSRKSLRLLGSVGEPINPE 392

Query: 305 VARKVKEKFG---IEILEGYGLSET-----SPVVSFNNPKRKAKPGSIGLPIWGVEMKLV 356
                    G     I++ +  +ET     +P++   +     KPGS+ LP +G+   LV
Sbjct: 393 AWHWYYTIVGNGRCPIVDTWWQTETGGILITPLIGATD----LKPGSVTLPFFGIRPALV 448

Query: 357 DENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRT-------GDIARRDEE 409
           D N   ++G   G + +       G       + Q   D +FRT       GD  RRD +
Sbjct: 449 DTNGQILDGPAAGNLVLLDS--WPGQMRTVYGDHQRFIDTYFRTYPNTYFTGDGCRRDAD 506

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           G+Y+I  R  D+I   G+ +   EIE  L+ HP+V+ AAVVG PH   G+ I A+V    
Sbjct: 507 GYYWITGRVDDVINISGHRIGTAEIESTLVAHPKVAEAAVVGFPHPIKGQGIYAYVTLIT 566

Query: 470 GATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           G T +E    EL+ W ++ + A   P  V++   LP T +GKI++R LR
Sbjct: 567 GETPSEALHQELLTWVRKEIGAIATPDHVQWAPNLPKTRSGKIMRRILR 615


>ACSA_XYLFT RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  152 bits (385), Expect = 5e-39
 Identities = 144/532 (27%), Positives = 231/532 (43%), Gaps = 45/532 (8%)

Query: 17  ERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAG 76
           E DA      R+ Y  +     Q+ N L   GI  GD+V +  P +P          + G
Sbjct: 96  EPDAPDAPSSRITYRELYERVCQLGNALRHLGIEKGDRVTIYLPMIPDAVVAILACARIG 155

Query: 77  AVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAECEL 130
           A+   +        I   + D G+K +        G  ++PL      A +       E 
Sbjct: 156 AIHSVVFGGFAANSIADRVNDCGSKLIITADEGLRGGRKIPLKANVDAALKIHGTQSVET 215

Query: 131 YIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-Q 189
            + +           P    F   ++ Q  E    R   +D   I+YTSG+TG+PKG   
Sbjct: 216 VLVVRHTGSTINMHTPRDRWFHDLVDIQATECAPERMNAEDSLFILYTSGSTGKPKGVLH 275

Query: 190 LTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFD 249
            T   L++ +     +FD     +D++     +  I G + ++   L  +GT VL+  F+
Sbjct: 276 TTGGYLVYTSYTHETVFDLR--ENDIYWCTADIGWITGHSYIVYGPL-ANGTTVLL--FE 330

Query: 250 G-------DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASL 301
           G            +++K  VT+F   PT    L+  +GD  +K+ S+ +L    S G  +
Sbjct: 331 GTPHYPTVSRFWEVIDKHHVTLFYTAPTAIRALMR-EGDTPVKKTSRKSLRLLGSVGEPI 389

Query: 302 PAEVARKVKEKFG---IEILEGYGLSET-----SPVVSFNNPKRKAKPGSIGLPIWGVEM 353
             E         G     I++ +  +ET     +P++   +     KPGS+ LP +G+  
Sbjct: 390 NPEAWHWYYTIVGNGRCPIVDTWWQTETGGILITPLIGATD----LKPGSVTLPFFGIRP 445

Query: 354 KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRT-------GDIARR 406
            LVD N  T++G   G + +       G       + Q   D +FRT       GD  RR
Sbjct: 446 ALVDTNGQTLDGPAAGNLVLLDS--WPGQMRTLYGDHQRFIDTYFRTYPNTYFTGDGCRR 503

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           D +G+Y+I  R  D+I   G+ +   EIE  L+ HP+V+ AAVVG PH   G+ I A+V 
Sbjct: 504 DADGYYWITGRVDDVINISGHRIGTAEIESTLVAHPKVAEAAVVGFPHPIKGQGIYAYVT 563

Query: 467 PAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              G T +E    EL+ W ++ + A   P  V++ + LP T +GKI++R LR
Sbjct: 564 LITGETPSEALHQELLTWVRKEIGAIAIPDHVQWASNLPKTRSGKIMRRILR 615


>ACSA_BEII9 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  152 bits (383), Expect = 8e-39
 Identities = 140/530 (26%), Positives = 236/530 (44%), Gaps = 32/530 (6%)

Query: 15  RPERDAIVF-----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
           R ++ AI+F      D R + Y  ++    ++AN+L + G+  GD V+L  P +P   F 
Sbjct: 88  RGDQTAILFEGDDPADSRAITYKELHDSVCRLANVLKAHGVGKGDTVSLYLPMIPEAAFA 147

Query: 69  YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQE 124
                + GA+   +    +P  +   +    +K L        G  ++PL   A  A  +
Sbjct: 148 MLACARIGAIHSVIFGGFSPDSLAGRIEGCRSKVLITADEGLRGGRKVPLKANADLAIAK 207

Query: 125 VAECELYIDLPAAAGATTSAIPGAET-FWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
             +    + +    G     + G +  +  A+     E      E +    I+YTSG+TG
Sbjct: 208 TGDIVQTMIVVTRTGGAVDWVEGRDVRYEEAIAAASPECPLTEVEAEHPLFILYTSGSTG 267

Query: 184 QPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            PKG    T   L++ ++    +FD      DV+     +  + G + ++   L    T 
Sbjct: 268 APKGVVHCTGGYLVYASMTHQYVFDY--HDGDVYWCTADVGWVTGHSYIVYGPLANGATT 325

Query: 243 VLMPRFDGDEALS----LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSG 297
           ++        ++S    +++K KVTIF   PT    L+ + G+  +K+ S+ +L    S 
Sbjct: 326 LMFEGVPNYPSVSRFWEVIDKHKVTIFYTAPTAIRALMGS-GEAPVKKTSRASLRLLGSV 384

Query: 298 GASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEM 353
           G  +  E         G E   I++ +  +ET  ++    P     KPGS  LP +GV+ 
Sbjct: 385 GEPINPEAWEWYHRVVGEERCPIVDTWWQTETGGILITPLPGATPEKPGSATLPFFGVKP 444

Query: 354 KLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDE 408
           ++VD     +EG   G + +          + G H+R   +      G + TGD  RRD 
Sbjct: 445 QVVDATGAVLEGVCEGNLVIADSWPGQMRTIFGDHDRFVQSYFSTYPGKYFTGDGCRRDA 504

Query: 409 EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
           +G+Y+I  R  D+I   G+ +   E+E  L+ H  VS AAVVG PHD  G+ I A+V   
Sbjct: 505 DGYYWITGRVDDVINVSGHRLGTAEVESSLVAHELVSEAAVVGYPHDIKGQGIYAYVTLM 564

Query: 469 EGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            G   ++    EL+ W ++ +     P +V F T LP T +GKI++R LR
Sbjct: 565 NGIEPSDRLRTELVTWVRKDIGPIATPDVVHFATGLPKTRSGKIMRRILR 614


>ACSA_VIBCH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  151 bits (382), Expect = 1e-38
 Identities = 145/521 (27%), Positives = 234/521 (44%), Gaps = 39/521 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  L Y  ++    + AN L  +G+R GD V +  P VP          + GAV   +  
Sbjct: 105 DKTLTYKQLHQEVCRFANALKEQGVRKGDVVCIYMPMVPEAAVAMLACTRIGAVHTIVFG 164

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAF--QEVAECELYIDLPAAA 138
             +P  +   + DS AK +        G   +PL +   +A    EV      + L    
Sbjct: 165 GFSPEALAGRIIDSNAKLVITADEGVRGGRAVPLKKNVDEALCNPEVKNISKVMVLKRTG 224

Query: 139 GATTSAIPGAETFW------AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLT 191
           G   +     + +W      A+ N  P E ++     +D   I+YTSG+TG+PKG    T
Sbjct: 225 G-NVAWHEHRDIWWHEATAKASDNCPPEEMKA-----EDPLFILYTSGSTGKPKGVLHTT 278

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF 248
              L++  +    +FD  P+  +VF     +  I G + ++   L      +L   +P +
Sbjct: 279 GGYLVYATMTFKYVFDYQPN--EVFWCTADVGWITGHSYLVYGPLANGAKTILFEGVPNY 336

Query: 249 DGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVA 306
                +S +++K KV I    PT    L+ A+GD  IK  S+ +L    S G  +  E  
Sbjct: 337 PTTARMSEVVDKHKVNILYTAPTAIRALM-AKGDEAIKGTSRDSLRIMGSVGEPINPEAW 395

Query: 307 RKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNT 362
                  G E   I++ +  +ET  ++    P   A KPGS   P +GV+  LVD     
Sbjct: 396 EWYYRTIGNEKSPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVQPALVDNMGEI 455

Query: 363 IEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDR 417
           +EG   G + +          + G H+R E        G + TGD ARRDE+G+Y+I  R
Sbjct: 456 VEGATEGNLVLLDSWPGQMRTVYGDHDRFEQTYFSTFKGMYFTGDGARRDEDGYYWITGR 515

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED- 476
             D++   G+ +   EIE  L+   +++ AAVVGVPHD  G+ I A++   +G   + + 
Sbjct: 516 VDDVLNVSGHRMGTAEIESALVAFNKIAEAAVVGVPHDIKGQAIYAYITLNDGVYPSAEL 575

Query: 477 --ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             E+  W ++ + A   P ++ +   LP T +GKI++R LR
Sbjct: 576 HKEVKDWVRKEIGAIATPDVLHWTDALPKTRSGKIMRRILR 616


>PPSB_BACSU RecName: Full=Plipastatin synthetase subunit B;       
            EC=2.3.1.-;AltName: Full=Peptide synthetase 2;Includes:
            RecName: Full=ATP-dependent tyrosine adenylase 1;
          Length = 2560

 Score =  150 bits (378), Expect = 3e-38
 Identities = 133/526 (25%), Positives = 225/526 (42%), Gaps = 48/526 (9%)

Query: 3    NLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNV 62
            N+  L E      PE  A+V G  +L Y  +N  A + A +L+ +G+R GD V L     
Sbjct: 1501 NIVSLFEKQVAQYPEHIAVVCGHSQLTYRDLNEKAERAAAMLIKQGVRTGDIVGLMLDRS 1560

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
            P         LKAG   +P++       I + L DSGAK L          L ER     
Sbjct: 1561 PDMIIGVLSILKAGGAYLPIDPEYPKERISFMLNDSGAKLL----------LTERGLNKP 1610

Query: 123  QEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
             +     LYID         ++IP        +  QP             A +IYTSGTT
Sbjct: 1611 ADYTGHILYID-----ECENNSIPADVNIEEIVTDQP-------------AYVIYTSGTT 1652

Query: 183  GQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            GQPKG  + H N++      +  F+    +H+   T+   +        M  AL    T+
Sbjct: 1653 GQPKGVIVEHRNVISLLKHQNLPFE---FNHEDVWTLFHSYCFDFSVWEMFGALLNGSTL 1709

Query: 243  VLMPR---FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            V++ +    D      L++KE+VT+    PT ++GL+    +H        +   + GG 
Sbjct: 1710 VVVSKETARDPQAFRLLLKKERVTVLNQTPTAFYGLMLEDQNH---TDHLNIRYVIFGGE 1766

Query: 300  SLPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNNPKR---KAKPGSIGLPIWGVEMKL 355
            +L   + +   EK+   +++  YG++ET+  V+F             +IG P+  ++  +
Sbjct: 1767 ALQPGLLQSWNEKYPHTDLINMYGITETTVHVTFKKLSAADIAKNKSNIGRPLSTLQAHV 1826

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDE 408
            +D + N      PGE+ + G  V +GY NR E       +N  +  D  +RTGD+A+R  
Sbjct: 1827 MDAHMNLQPTGVPGELYIGGEGVARGYLNRDELTADRFVSNPYLPGDRLYRTGDLAKRLS 1886

Query: 409  EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
             G    + R  + +   G+ +   EI+  L+ +P +  AAV+    +     I A+++  
Sbjct: 1887 NGELEYLGRIDEQVKVRGHRIELGEIQAALLQYPMIKEAAVITRADEQGQTAIYAYMVIK 1946

Query: 469  EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +       ++  + K  L  +  P  +     +P+T  GK+ ++ L
Sbjct: 1947 DQQAANISDIRTYLKNALPDFMLPARMIQIDSIPVTVNGKLDQKAL 1992



 Score =  127 bits (320), Expect = 2e-31
 Identities = 135/516 (26%), Positives = 218/516 (42%), Gaps = 55/516 (10%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L E+ A   PE  A+  G+    Y  + + ANQ+A+ L+ +G+  GD VA+        P
Sbjct: 474 LFEEQAHKTPEAAALKMGNECWTYRQLQVRANQIAHALIEKGVGSGDIVAVMMGRSMEMP 533

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G  KAG   +PL+       + + L+DS                     QA Q + 
Sbjct: 534 AALLGIWKAGGAYMPLDPHFPAERLSFLLKDS---------------------QAAQLLI 572

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWA-ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
           E +L   +P +    T  I   E++   A N  PG          D+A +IYTSGTTG+P
Sbjct: 573 EEDLISLIPPSYEGNTITIEHTESYQTEAPNMPPG----------DLAYLIYTSGTTGRP 622

Query: 186 KGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLF-HIF-GQTTMMNAALYRHGTMV 243
           KG  + H     + +A++  + +   S       L LF ++F G  T +   L     ++
Sbjct: 623 KGVLVDH-----HGIANTLQWRREEYSMTEQDISLHLFSYVFDGCVTSLFTPLLSGACVL 677

Query: 244 LMPRFDGDEALSLMEK---EKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
           L    +  + L+L  K    KV+    VP++Y  LL      D K +        +G A 
Sbjct: 678 LTTDDEAKDVLALKRKIARYKVSHMIIVPSLYRVLLEVMTADDAKSLR---IVTFAGEAV 734

Query: 301 LPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENF 360
            P  +          E+   YG +E S   +      K +  +IG PI   ++ ++  N 
Sbjct: 735 TPDLLELNQIICPSAELANEYGPTENSVATTILRHLNKKERITIGHPIRNTKVFVLHGNQ 794

Query: 361 NTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF-------RTGDIARRDEEGFYF 413
               G   GE+ + G  + +GY+ + E   +   D  F       RTGD  R   +G   
Sbjct: 795 MQPIG-AAGELCISGAGLARGYYKQQELTQKAFSDHPFLEGERLYRTGDAGRFLPDGTIE 853

Query: 414 IIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATL 473
            I R  D +   GY +  REIE VL   P V  AAV+        +E+ A+++P +G +L
Sbjct: 854 YIGRFDDQVKIRGYRIELREIETVLRQAPGVKEAAVLARDVSAEEKELVAYIVPEKGNSL 913

Query: 474 TEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
              +L       L +Y  P  +   +++P+T++GK+
Sbjct: 914 --PDLYQHLAGTLPSYMIPASIINISQMPLTSSGKL 947


>ACSA_YERPS RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  150 bits (378), Expect = 3e-38
 Identities = 141/504 (27%), Positives = 229/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S GI+ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H+R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_YERP3 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  150 bits (378), Expect = 3e-38
 Identities = 141/504 (27%), Positives = 229/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S GI+ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H+R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_RHILO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  150 bits (378), Expect = 3e-38
 Identities = 135/536 (25%), Positives = 239/536 (44%), Gaps = 37/536 (6%)

Query: 13  RNRPERDAIV------FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           + R ++ AI+      + D ++ Y  +     ++AN++   G++ GD+V +  P +P   
Sbjct: 86  KKRGDQTAIIWEGDNPYDDKKITYNELYERVCRLANVMKKHGVKKGDRVTIYMPMIPEAA 145

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQ 120
           +      + GA+   +    +P  +   + D   ++ F  T      G   +PL E   +
Sbjct: 146 YAMLACTRIGAIHSIVFGGFSPDALAGRIVD--CESTFVITADEGLRGGKSIPLKENTDK 203

Query: 121 AFQEVAECELYID---LPAAAGATTSAIPGAETFWA-ALNGQPGEFESVRTEGDDVAVII 176
           A    A+  + +    +    G      PG + ++   +     E +  + + +D   I+
Sbjct: 204 AIDIAAKNFVMVKNVLVVRRTGGKVGWAPGRDLWYHDEVATVKAECKPEKMKAEDPLFIL 263

Query: 177 YTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           YTSG+TG+PKG   T    L++ ++    +FD      D++     +  + G + ++   
Sbjct: 264 YTSGSTGKPKGVLHTTAGYLVYASMTHQYVFDY--HDGDIYWCTADVGWVTGHSYIVYGP 321

Query: 236 LYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTL 291
           L    T ++   +P +        +++K KV IF   PT    L+ A  D   K   ++L
Sbjct: 322 LANGATTLMFEGVPNYPSQSRFWEVIDKHKVNIFYTAPTALRALMGAGNDPVKKTSRKSL 381

Query: 292 HTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLP 347
               S G  +  E         G   + I++ +  +ET  ++    P     K GS   P
Sbjct: 382 RVLGSVGEPINPEAWEWYFNVVGNGKVPIVDTWWQTETGGILITPLPGATDLKAGSATRP 441

Query: 348 IWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGD 402
            +GV+ +LVD     +EG   G + +          + G H+R          G + TGD
Sbjct: 442 FFGVKPQLVDGEGKVLEGAADGNLCITDSWPGQMRTVYGDHDRFVQTYFSTYKGKYFTGD 501

Query: 403 IARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIK 462
             RRD +G+Y+I  R  D+I   G+ +   E+E  L++H +VS AAVVG PHD  G+ I 
Sbjct: 502 GCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVSHDKVSEAAVVGYPHDIKGQGIY 561

Query: 463 AFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           ++V   +G   TED   ELIA  ++ + A   P  ++F   LP T +GKI++R LR
Sbjct: 562 SYVTLMKGEEPTEDLRKELIAHVRKEIGAIASPDKIQFAPGLPKTRSGKIMRRILR 617


>ACSA_PSEA6 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 646

 Score =  149 bits (377), Expect = 4e-38
 Identities = 135/509 (26%), Positives = 223/509 (43%), Gaps = 44/509 (8%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN L   G+  GD+VA+  P +P   +      + GAV   +    +P  I   + + 
Sbjct: 118 KIANGLRKLGVGKGDRVAIYMPMIPQAVYAMLACARIGAVHTVIFGGFSPNAIADRVNNC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
            AK L            +PL +    A  E        D P+          G+   W  
Sbjct: 178 QAKVLITADEGLRAGKHIPLKDNVDTALAEH-------DCPSMEQVIVFKHTGSHVSWGK 230

Query: 155 --------LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASS 203
                    +G   +        +D   I+YTSG+TGQPKG  + HT    LL+ ++   
Sbjct: 231 DDVWWHDLTDGCSTDCPPEVMNAEDPLFILYTSGSTGQPKG--VVHTTGGYLLWASITHK 288

Query: 204 ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEK 259
            +FD  P   D++     +  + G + ++   L    T V+   +P +     +  +++K
Sbjct: 289 YVFDYKPG--DIYWCAADVGWVTGHSYIVYGPLANGATSVMFEGVPTYPDVRRIGQIVDK 346

Query: 260 EKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFG---I 315
            KV I    PT    L+ A GD   + IS ++L    S G  +  E         G    
Sbjct: 347 HKVNILYTAPTAIRALM-AHGDFPTEGISGESLRLLGSVGEPINPEAWHWYYTTVGQSRC 405

Query: 316 EILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVR 374
            I++ +  +ET   +    P   A KPG+   P +GV+  LVD   N + G   G + + 
Sbjct: 406 PIVDTWWQTETGAAMLTPLPSVTAMKPGAASHPFFGVQPALVDGQGNELSGATEGNLIIT 465

Query: 375 GHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNV 429
                    + G H R          G + TGD ARRDE+ +++I  R  D++   G+ +
Sbjct: 466 DSWPGQARTVYGDHERFVQTYFTTYPGTYCTGDGARRDEDDYFWITGRVDDVLNVSGHRL 525

Query: 430 YPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERL 486
              EIE  L++H  V+ AAVVG PHD  G+ I  +++P EG  +T++   E+  W ++ L
Sbjct: 526 GTAEIESALVSHNAVAEAAVVGYPHDLKGQGIYVYLMPNEGVEITDELTKEVSNWVRKEL 585

Query: 487 AAYKYPRIVEFRTELPMTATGKILKRELR 515
           +    P ++++ + LP T +GKI++R LR
Sbjct: 586 SPIATPDLIQWSSGLPKTRSGKIMRRILR 614


>ACSA_ALCBS RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  149 bits (377), Expect = 4e-38
 Identities = 132/513 (25%), Positives = 227/513 (44%), Gaps = 25/513 (4%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  ++Y  +    ++  N+L +RG++ GD+V +  P +P   +      + GA+   +  
Sbjct: 104 DKHISYQQLFEEVSKFGNVLKNRGVKKGDRVVIYMPMIPEAAYAMLACARIGAIHSVVFG 163

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA 140
             +P  ++  + ++ A AL        G   +PL   A +A   +      + +    G 
Sbjct: 164 GFSPEALKDRILNAEACALITADEGVRGGKTIPLKVNADKALDGIDCVHTCLTVKRTGGD 223

Query: 141 TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN-A 199
                P    +  A+     + E    E +D    +YTSG+TG+PKG   T    L N A
Sbjct: 224 VDWQAPRDVWYHEAMADASSDCEPEWVEAEDPLFTLYTSGSTGKPKGVVHTTAGYLLNTA 283

Query: 200 VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALS 255
           +    +FD      D++     +  I G + ++   L    T ++   +P + D      
Sbjct: 284 LTHKYVFDY--QDGDIYWCTADVGWITGHSYIVYGPLANGATTLMFEGVPTYPDASRCWQ 341

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG 314
           +++K KV IF   PT    L+   GD  ++Q S+ +L    + G  +  E         G
Sbjct: 342 VVDKHKVNIFYTAPTAIRALMGL-GDAPVEQTSRASLKLLGTVGEPINPEAWEWYYRVVG 400

Query: 315 ---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
                I++ +  +ET  ++    P     K GS  LP++GV+  L+D + N ++G   G 
Sbjct: 401 DSRCPIVDTWWQTETGAIMIAPLPGAVDLKAGSATLPMFGVQPGLMDPDGNELDGAASGN 460

Query: 371 IAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRG 425
           + ++         + G H R          G + TGD ARRDE+G+Y+I  R  D++   
Sbjct: 461 LVLKASWPSQIRTVYGDHQRLIDTYFSAYKGCYFTGDGARRDEDGYYWITGRVDDVLNVS 520

Query: 426 GYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIA---WA 482
           G+ +   EIE  L+ HP +S AAVVG  HD  G+ I A+V    G   +E+ + A     
Sbjct: 521 GHRLGTAEIESALVLHPSISEAAVVGYQHDVKGQGIYAYVSLMAGKEGSEELVKALRDLV 580

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            + +     P ++ F   LP T +GKI++R LR
Sbjct: 581 TQEIGPIAKPDLIHFAPGLPKTRSGKIMRRILR 613


>ACSA_YERPP RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  149 bits (376), Expect = 5e-38
 Identities = 140/504 (27%), Positives = 228/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S G++ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_YERPN RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  149 bits (376), Expect = 5e-38
 Identities = 140/504 (27%), Positives = 228/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S G++ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_YERPE RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  149 bits (376), Expect = 5e-38
 Identities = 140/504 (27%), Positives = 228/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S G++ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_YERPA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  149 bits (376), Expect = 5e-38
 Identities = 140/504 (27%), Positives = 228/504 (45%), Gaps = 33/504 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L S G++ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWA 153
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH 238

Query: 154 ALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQA 209
            L  +   +        +D   I+YTSG+TG+PKG  + HT    L++ A+    +FD  
Sbjct: 239 DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAALTFKYVFDYH 296

Query: 210 PDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTI 264
           P   D++     +  + G + ++   L   G + LM    P + G   LS +++K KV I
Sbjct: 297 PG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVVDKHKVNI 353

Query: 265 FAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320
               PT    L+ A+GD  I+   + +L    S G  +  E       K G     I++ 
Sbjct: 354 LYTAPTAIRALM-AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDT 412

Query: 321 YGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-- 377
           +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +      
Sbjct: 413 WWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPG 472

Query: 378 ---VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREI 434
               + G H R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EI
Sbjct: 473 QARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEI 532

Query: 435 EEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKY 491
           E  L+ HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +     
Sbjct: 533 ESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLAT 592

Query: 492 PRIVEFRTELPMTATGKILKRELR 515
           P I+ +   LP T +GKI++R LR
Sbjct: 593 PDILHWTDSLPKTRSGKIMRRILR 616


>4CLL2_ORYSJ RecName: Full=4-coumarate--CoA ligase-like 2;       
           EC=6.2.1.-;
          Length = 583

 Score =  149 bits (376), Expect = 5e-38
 Identities = 106/318 (33%), Positives = 165/318 (51%), Gaps = 19/318 (5%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNA---VASSALFDQAPDSHDVFLTVLPLFHIF 226
           DD A ++Y+SGT+G+ KG  +TH NL+      V   A     P   +V+L  LP+FH++
Sbjct: 199 DDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFVRFEASQYTRPARDNVYLAALPMFHVY 258

Query: 227 GQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQ 286
           G +      L    T+V+M RF+ D+A+  + K KVT    VP +   LL A    ++  
Sbjct: 259 GLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKYKVTHLPLVPPIMSALLRANPPLELDS 318

Query: 287 ISQTLHTAVSGGASLPAEVARKVKEKFG-IEILEGYGLSETSPVVS--FNNPKRKAKPGS 343
           + Q      SG A L   +       F  ++ ++GYG++E++ V +  FN  K K K  S
Sbjct: 319 LLQVS----SGAAPLNHTLIHHFLHAFPHVDFIQGYGMTESTAVGTRGFNTCKHK-KYAS 373

Query: 344 IGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMK------GYHNRPEANAQVMRDG 396
           +GL    +  K+V  E+ + +     GE+ + G  +MK      GY N  + +A   +DG
Sbjct: 374 VGLLAPNMHAKIVHLESGSCLPPGSYGELWLHGPAIMKEFCFVTGYLNDDD-DAFTRKDG 432

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W RTGDIA  D +G+ FI+ R KD I   G+ + P ++E VL+ HP++   AV     + 
Sbjct: 433 WLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQIAPADLEAVLIRHPEIIDVAVTSDEDEE 492

Query: 457 HGEEIKAFVIPAEGATLT 474
            GE   AFV+   G+TL+
Sbjct: 493 AGEIPVAFVVRKSGSTLS 510


>ACSA_YERE8 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  148 bits (374), Expect = 9e-38
 Identities = 140/507 (27%), Positives = 229/507 (45%), Gaps = 39/507 (7%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN+L   GI+ GD VA+  P VP          + GAV   +    +P  +   + DS
Sbjct: 119 QFANVLKKLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS 178

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFW- 152
            +K +            +PL +   +A +  A   +  + +    G  +    G + +W 
Sbjct: 179 NSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWKDGRDVWWH 238

Query: 153 -----AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALF 206
                A+++  P E  +     +D   I+YTSG+TG+PKG    T   L++ A+    +F
Sbjct: 239 DLIKDASVDCPPEEMNA-----EDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVF 293

Query: 207 DQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEK 261
           D  P   D++     +  + G + ++   L   G + LM    P + G   L  +++K +
Sbjct: 294 DYHPG--DIYWCTADVGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLGQVIDKHQ 350

Query: 262 VTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEI 317
           V I    PT    L+ A+GD  I+   +T L    S G  +  E       K G     I
Sbjct: 351 VNILYTAPTAIRALM-AEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYYNKIGNSKCPI 409

Query: 318 LEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH 376
           ++ +  +ET   +    P   + K GS   P +GV+  LVD   N  EG   G + +   
Sbjct: 410 VDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGAAEGNLVITDS 469

Query: 377 C-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYP 431
                  + G H R E        G + +GD ARRDE+G+Y+I  R  D++   G+ +  
Sbjct: 470 WPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGT 529

Query: 432 REIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAA 488
            EIE  L++HP+++ AAVVGVPH+  G+ I A++    G   T +   E+  W ++ +  
Sbjct: 530 AEIESALVSHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGP 589

Query: 489 YKYPRIVEFRTELPMTATGKILKRELR 515
              P I+ +   LP T +GKI++R LR
Sbjct: 590 IATPDILHWTDSLPKTRSGKIMRRILR 616


>ACSA_AERS4 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 648

 Score =  148 bits (374), Expect = 9e-38
 Identities = 142/549 (25%), Positives = 245/549 (44%), Gaps = 41/549 (7%)

Query: 1   MLNLSV-LLEDGARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGD 53
           +LN+S   L+     R ++ AI++       D +L Y  ++    + +N+L ++G+  GD
Sbjct: 74  LLNVSANCLDRHLAQRGDKVAIIWEGDNPAEDRKLTYRELHAEVCKFSNVLKAQGVHRGD 133

Query: 54  KVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGT 109
            V L  P VP          + GAV   +    +P  +   + DSG+  +        G 
Sbjct: 134 VVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLRGG 193

Query: 110 PELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFW-----AALNGQPGEFES 164
             +PL +   +A          + +    G   +     + +W     AA +  P E   
Sbjct: 194 RPVPLKKNVDEALTNPDTRVSKVIVLKRTGGNVAWHNHRDIWWHEATAAASSDCPPE--- 250

Query: 165 VRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLF 223
                +D   ++YTSG+TG+PKG    T   L++  +    +FD   +  D++     + 
Sbjct: 251 -AMNAEDPLFVLYTSGSTGKPKGVLHTTGGYLVYATLTFKYVFDYHEE--DIYWCTADVG 307

Query: 224 HIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQ 279
            + G + ++   L    T ++   +P +     +S +++K +VTI    PT    L+ A+
Sbjct: 308 WVTGHSYLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVTILYTAPTAIRALM-AK 366

Query: 280 GDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP 335
           G   ++  S Q+L    S G  +  E         G E   I++ +  +ET  ++    P
Sbjct: 367 GRDAVEGTSRQSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGILISPLP 426

Query: 336 K-RKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEAN 389
                KPGS   P +GV+  LVD     +EG   G + +          + G H R E  
Sbjct: 427 GVTDLKPGSATRPFFGVQPALVDNMGEPLEGATEGNLVITDSWPGQMRTVFGDHERFEQT 486

Query: 390 AQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAV 449
                 G + TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAV
Sbjct: 487 YFSTFPGRYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVAHPKIAEAAV 546

Query: 450 VGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTAT 506
           VGVPH+  G+ I A+V    G   + +   E+  W ++ + A   P ++ +   LP T +
Sbjct: 547 VGVPHEIKGQGIYAYVTLIAGEEPSRELHKEVKEWVRKEIGAIATPDVIHWAEGLPKTRS 606

Query: 507 GKILKRELR 515
           GKI++R LR
Sbjct: 607 GKIMRRILR 615


>ACSA_NEUCR RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 667

 Score =  148 bits (373), Expect = 1e-37
 Identities = 149/545 (27%), Positives = 240/545 (44%), Gaps = 56/545 (10%)

Query: 12  ARNRPERDAIVF-----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           A   P R AI++     G  R + Y  +    +++A++L + G+R GD VA+  P +P  
Sbjct: 104 AHKDPNRVAIIYEADEPGQGRNVTYGELLREVSKLAHVLTNLGVRKGDTVAIYLPMIPEA 163

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA---------FTGTPELPLGE 116
                   + GA+   +    +   +   + D+ +K +             GT ++   +
Sbjct: 164 IVAMLACTRIGAIHSVVFAGFSSDSLRDRVVDAQSKVVITTDEGKRGGKLIGTKKIV--D 221

Query: 117 RAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVI 175
            A Q   +V    +Y       GA  S  PG + +W   +   P  +  V    +D   +
Sbjct: 222 EALQQCPDVRNVLVY----KRTGADISMTPGRDLWWHEEVEKYPAYYTPVAMASEDPLFL 277

Query: 176 IYTSGTTGQPKG-AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           +YTSG+TG+PKG A  T   LL  A+    +FD      D +     +  I G T ++ A
Sbjct: 278 LYTSGSTGKPKGVAHSTGGYLLGAAMTGKYVFDI--HDGDRYFCGGDVGWITGHTYVLYA 335

Query: 235 ALYRHGTMVLMPRFDGDEAL-------SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQI 287
            L    + V+   F+G  A         ++E+ KVT F   PT    LL   GDH ++  
Sbjct: 336 PLLLGVSTVV---FEGTPAYPNFSRYWDIIEEHKVTQFYVAPTAL-RLLKRAGDHHVRNE 391

Query: 288 SQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSET-SPVVSFNNPKRKAKPGS 343
            + L    S G  + AEV +   +  G    +I + Y  +ET S V++        KPGS
Sbjct: 392 MKHLRVLGSVGEPIAAEVWKWYYDVVGKGRAQICDTYWQTETGSNVITPLAGVTPTKPGS 451

Query: 344 IGLPIWGVEMKLVDE------NFNTIEG----EGPGEIAVRGHCVMKGYHNRPEANAQVM 393
              P +G+E  LVD       + N +EG    + P     R    + G H R       +
Sbjct: 452 ASFPFFGIEPALVDPVTGEEIHGNDVEGVLAFKQPWPSMAR---TVWGAHKRYMETYLHV 508

Query: 394 RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
             G++ TGD A RD EGFY+I  R  D++   G+ +   EIE  L+ H  ++ AAVVGV 
Sbjct: 509 YKGYYFTGDGAARDHEGFYWIRGRVDDVVNVSGHRLSTAEIEAALIEHHSIAEAAVVGVA 568

Query: 454 HDTHGEEIKAFVIPAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
            +  G+ + AFV   EG  + +    E +   +  +  +  P+ +    +LP T +GKI+
Sbjct: 569 DELTGQAVNAFVAVKEGTQINDALRKEFVLQVRRSIGPFAAPKAIYIVPDLPKTRSGKIM 628

Query: 511 KRELR 515
           +R LR
Sbjct: 629 RRILR 633


>ACSA_AGRRK RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  148 bits (373), Expect = 1e-37
 Identities = 135/519 (26%), Positives = 226/519 (43%), Gaps = 33/519 (6%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +      + GAV   +  
Sbjct: 103 DKKVTYNELYEHVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYID---LP 135
             +P  +   + D   ++ F  T      G   +PL E    A    A+  + ++   + 
Sbjct: 163 GFSPEALGGRIVD--CQSTFVITCDEGLRGGKPIPLKENTDTAIHIAAKQFVTVEKVLVV 220

Query: 136 AAAGATTSAIPGAETFWAALNGQ-PGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHT 193
              G  T   PG + ++     +   +   V+ + +D   I+YTSG+TG+PKG    T  
Sbjct: 221 RRTGGKTGWAPGRDLWYHEETAKVKADCPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGG 280

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-D 249
            L++ A+     FD  P   D++     +  + G + ++   L    T ++   +P + D
Sbjct: 281 YLVYAAMTHEYTFDYHPG--DIYWCTADVGWVTGHSYIVYGPLANAATSLMFEGVPNYPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG-GASLPAEVAR- 307
                 +++K KV IF   PT    L+ A GDH +K             G  +  E    
Sbjct: 339 QGRFWDIIDKHKVNIFYTAPTAIRSLMGA-GDHFVKXXXXXXXXXXGTVGEPINPEAWEW 397

Query: 308 --KVKEKFGIEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
             KV       I++ +  +ET   +    P     KPGS  LP +GV+ +LVD     +E
Sbjct: 398 YYKVVGDSRSPIVDTWWQTETGGHMITPLPGATDLKPGSATLPFFGVQPELVDSEGKVLE 457

Query: 365 GEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSK 419
           G   G + +          + G H R          G + TGD  RRDE+G+Y+I  R  
Sbjct: 458 GAADGNLVIADSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVD 517

Query: 420 DMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTED 476
           D++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V   +  EG+     
Sbjct: 518 DVLNVSGHRLGTAEVESALVSHKHVSEAAVVGYPHSIKGQGIYCYVTLMVGQEGSDALRQ 577

Query: 477 ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           EL+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 578 ELVKHVRAEIGPIASPDKIQFTPGLPKTRSGKIMRRILR 616


>ACSA_AGRT5 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  147 bits (371), Expect = 2e-37
 Identities = 138/533 (25%), Positives = 238/533 (44%), Gaps = 39/533 (7%)

Query: 17  ERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           ER AI++       D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +   
Sbjct: 89  ERTAIIWEGDNPYIDKKITYNQLYDYVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAML 148

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQE 124
              + GAV   +    +P  +   + D   ++ F  T      G   +PL E   +A   
Sbjct: 149 ACARIGAVHSVVFGGFSPEALAGRIVD--CESTFVITCDEGVRGGKPIPLKENTDKAIDI 206

Query: 125 VAECELYID---LPAAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSG 180
            A+  + ++   +    G  T   PG + ++   +     +   V+   +D   I+YTSG
Sbjct: 207 AAKQYVIVNKVLVVRRTGGKTGWAPGRDIWYHQEIATVKPDCPPVKMRAEDPLFILYTSG 266

Query: 181 TTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           +TG+PKG    T   L++ ++    +FD      +VF     +  + G + ++   L   
Sbjct: 267 STGKPKGVLHTTGGYLVYTSMTHEYVFDYKDG--EVFWCTADVGWVTGHSYIVYGPLANC 324

Query: 240 GTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTA 294
            T ++   +P F D      +++K KV IF   PT    L+ A GD  +++ S ++L   
Sbjct: 325 ATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTALRSLMGA-GDQFVQRSSRESLRLL 383

Query: 295 VSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWG 350
            + G  +  E         G +   I++ +  +ET  ++    P     KPGS   P +G
Sbjct: 384 GTVGEPINPEAWEWYYHVVGEDKSPIVDTWWQTETGGILISPLPGATDLKPGSATRPFFG 443

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRGHCV-----MKGYHNRPEANAQVMRDGWFRTGDIAR 405
           V+ +LVD   N +EG   G + +          + G H R          G + TGD  R
Sbjct: 444 VQPQLVDAEGNVLEGPADGNLCIIDSWPGQSRSVYGDHQRFVDTYFSTYKGKYFTGDGCR 503

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           RDE+G+Y+I  R  D++   G+ +   E+E  L++H QVS AAVVG PH   G+ I  +V
Sbjct: 504 RDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHHQVSEAAVVGYPHPIKGQGIYCYV 563

Query: 466 IPAEGAT---LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
               G +      +EL+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 564 TLMAGQSGDYALREELVKHVRNEIGPVATPDKIQFAPGLPKTRSGKIMRRILR 616


>ACSA_AERHH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 648

 Score =  147 bits (371), Expect = 2e-37
 Identities = 139/545 (25%), Positives = 244/545 (44%), Gaps = 33/545 (6%)

Query: 1   MLNLSV-LLEDGARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGD 53
           +LN+S   L+     R ++ AI++       D +L Y  ++    + AN+L ++G+  GD
Sbjct: 74  LLNVSANCLDRHLAQRGDKVAIIWEGDNPAEDRKLTYRELHTEVCKFANVLKAQGVHRGD 133

Query: 54  KVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGT 109
            V L  P VP          + GAV   +    +P  +   + DSG+  +        G 
Sbjct: 134 VVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLRGG 193

Query: 110 PELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWA-ALNGQPGEFESVRTE 168
             +PL +   +A          + +    G   +     + +W  A+     +       
Sbjct: 194 RPVPLKKNVDEALTNPETKVNNVIVLKRTGGNIAWHNHRDIWWHDAVATVSADCPPEAMG 253

Query: 169 GDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFG 227
            +D   I+YTSG+TG+PKG    T   L++  +    +FD   +  D++     +  + G
Sbjct: 254 AEDPLFILYTSGSTGKPKGVLHTTGGYLVYATLTFKYIFDYHEE--DIYWCTADVGWVTG 311

Query: 228 QTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHD 283
            + ++   L    T ++   +P +     +S +++K +V+I    PT    L+ A+G+  
Sbjct: 312 HSYLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVSILYTAPTAIRALM-AKGNEA 370

Query: 284 IKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPK-RK 338
           +   S++ L    S G  +  E         G E   I++ +  +ET  ++    P    
Sbjct: 371 VADTSRSSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGILISPLPGVTD 430

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVM 393
            KPGS   P +GV+  LVD     +EG   G + +          + G H R E      
Sbjct: 431 LKPGSATRPFFGVQPALVDNMGEPLEGATEGNLVITDSWPGQMRTVFGDHERFEQTYFST 490

Query: 394 RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
             G + TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  L++HP+++ AAVVGVP
Sbjct: 491 FPGRYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVSHPKIAEAAVVGVP 550

Query: 454 HDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
           H+  G+ I A+V    G   + +   E+  W ++ + A   P ++ +   LP T +GKI+
Sbjct: 551 HEIKGQGIYAYVTLIAGEEPSRELHKEVKEWVRKEIGAIATPDVIHWAEGLPKTRSGKIM 610

Query: 511 KRELR 515
           +R LR
Sbjct: 611 RRILR 615


>ACSA_METSO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 672

 Score =  147 bits (370), Expect = 3e-37
 Identities = 133/519 (25%), Positives = 232/519 (44%), Gaps = 36/519 (6%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           ++ Y  +    N+ AN L S G++ GD+V++  P +P  P       K G   + +    
Sbjct: 133 KITYGDLYKEVNKFANGLKSLGLKKGDRVSIYMPMIPQLPIAMLACAKLGVSHIVVFSGF 192

Query: 87  TPREIEYHLRDSGAKALFAFTGT----PELPLGERAWQAFQEVAECELYIDLPAAAGATT 142
           + + +       G++A+    G       +PL   A +A       E  I +   AG   
Sbjct: 193 SSKGLMDRAAHCGSRAIITVDGFYRRGKPVPLKPNADEAAGGAPSVEKII-VYKRAGVDV 251

Query: 143 SAIPGAETFWAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQ-LTHTNLLFNAV 200
           S   G + +W  L  GQ  E E V  + +    I+YTSGTTG+PKG +  T  N +  A 
Sbjct: 252 SMKEGRDVWWHDLVKGQSEECEPVWVDPEHRLYILYTSGTTGKPKGIEHATGGNAVGPAQ 311

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF----DGDEALSL 256
               +FD   D  DV+     +  + G + ++ A L    T ++        D       
Sbjct: 312 TLHWVFDLKDD--DVWWCTADIGWVTGHSYIVYAPLILGMTSLMYEGAADYPDFGRWWKN 369

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG-- 314
           ++  KVT+    PT     +    +   K    +L    S G  +  E     +E  G  
Sbjct: 370 IQDHKVTVLYTAPTAVRMFMKQGAEWPDKYDLSSLRLLGSVGEPINPEAWMWYREHIGRG 429

Query: 315 -IEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE-GEGPGEIA 372
            ++I++ +  +ET   ++   P    KPGS   P+ G ++ ++DE  N +  G G   +A
Sbjct: 430 ELQIMDTWWQTETGTFLNSPLPITPLKPGSCTFPLPGYDISILDEEGNEVPLGSGGNIVA 489

Query: 373 VRGH-CVMKGYHNRPEANAQVMRDGW------------FRTGDIARRDEEGFYFIIDRSK 419
           ++ +  +++ +    E   + M++ W            +  GD A+RD++G++FI  R  
Sbjct: 490 LKPYPSMLRAFWGDKE---RFMKEYWQFYWDVPGRRGVYLAGDKAQRDKDGYFFIQGRID 546

Query: 420 DMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED--- 476
           D++   G+ +   E+E  L+ HP+++ AAVVG P +  GE I AFVI   G   + +   
Sbjct: 547 DVLSVAGHRIANAEVESALVAHPKIAEAAVVGKPDEVKGESIVAFVILRVGNEPSPELAK 606

Query: 477 ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + IA+ ++ L     P  V F  +LP T +GKI++R ++
Sbjct: 607 DAIAFVRKTLGPVAAPTEVHFVNDLPKTRSGKIMRRVVK 645


>ACSA_RHOCA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 656

 Score =  146 bits (369), Expect = 3e-37
 Identities = 147/554 (26%), Positives = 242/554 (43%), Gaps = 49/554 (8%)

Query: 1   MLNLSV-LLEDGARNRPERDAIVFGD-------MRLNYALVNMIANQVANLLVSRGIRPG 52
           +LN SV  ++   R+R  + AI+F           + Y  ++   N++AN+L+S+GI  G
Sbjct: 80  VLNASVNCIDRHLRDRALQTAIIFEPDDPKEPARHITYKELSEKVNRMANVLLSQGIMRG 139

Query: 53  DKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE- 111
           D+V +  P +P   +      + GA+   +    +P  +   + D GAK +      P  
Sbjct: 140 DRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALANRINDCGAKLVITADTAPRG 199

Query: 112 ---LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPG-EFESVRT 167
               PL      A    ++ ++   +    G   S + G +     L      E      
Sbjct: 200 GRRTPLKANTDAALLHCSD-KVRCLVVKHTGDQISWVHGRDVDLLYLMEHVSPECPPRPM 258

Query: 168 EGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQAPDSHDVFLTVLPLFH 224
             +D   I+YTSG+TG+PKG  + HT    L++ A+     FD      DVF     +  
Sbjct: 259 NAEDPLFILYTSGSTGKPKG--VVHTTGGYLVYAAMTHQYTFDYKDG--DVFWCTADVGW 314

Query: 225 IFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG 280
           + G + ++   L    T ++   +P F D     ++ EK KV  F   PT    L+    
Sbjct: 315 VTGHSYIIYGPLANGATTLMFEGVPTFPDAGRFWAVCEKHKVNQFYTAPTAIRALMGQGP 374

Query: 281 DHDIKQISQTLHTAVSGGASLPAEV---ARKVKEKFGIEILEGYGLSETSPVVSFNNP-K 336
           +   K    +L    S G  +  E      K   K    I++ +  +ET   +    P  
Sbjct: 375 EWVEKYDLSSLRVLGSVGEPINPEAWVWYDKYVGKGKCPIVDTFWQTETGGHMITPLPGA 434

Query: 337 RKAKPGSIGLPIWGVEMKLVDEN----FNTIEGEG--------PGEIAVRGHCVMKGYHN 384
              KPGS   P +GV+  ++D         +E EG        PG++       + G H+
Sbjct: 435 TPTKPGSATNPFFGVKPVVLDPQTAVRIGEVECEGVLCISDSWPGQMRT-----VWGDHD 489

Query: 385 RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV 444
           R +        G++ TGD  RRD++G+Y+I  R  D+I   G+ +   E+E  L+ HPQV
Sbjct: 490 RFQETYFGQYRGYYFTGDGCRRDKDGYYWITGRVDDVINVSGHRMGTAEVESALVAHPQV 549

Query: 445 SLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTEL 501
           + AAVVG PHD  G+ I A+V    G   +ED   +L+ W +  +     P ++++   L
Sbjct: 550 AEAAVVGYPHDIKGQGIYAYVTLMNGIEPSEDLRKDLVKWVRTEIGPIASPDLIQWAPGL 609

Query: 502 PMTATGKILKRELR 515
           P T +GKI++R LR
Sbjct: 610 PKTRSGKIMRRILR 623


>ACSA_EMENI RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 670

 Score =  146 bits (369), Expect = 3e-37
 Identities = 143/511 (27%), Positives = 222/511 (43%), Gaps = 46/511 (9%)

Query: 38  NQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRD 97
           ++VA +L  RG++ GD VA+  P +P     +    + GAV   +    +   +   + D
Sbjct: 138 SRVAWVLKQRGVKKGDTVAIYLPMIPEAIIAFLACSRIGAVHSVVFAGFSSDSLRDRVLD 197

Query: 98  SGAKALFA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGA 148
           +G+K +             GT  +   +   +   +V+   +Y       GA      G 
Sbjct: 198 AGSKVVITTDEGKRGGKVIGTKRIV--DEGLKQCPDVSTVLVY----KRTGAEVPWTEGR 251

Query: 149 ETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA-LF 206
           + +W   +   P          +D   ++YTSG+TG+PKG   T    L  A  +   +F
Sbjct: 252 DIWWHEEVEKYPAYIAPDSVNSEDPLFLLYTSGSTGKPKGVMHTTAGYLLGAAMTGKYVF 311

Query: 207 DQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRF-DGDEALSLMEKEKV 262
           D   D  D +     +  I G T ++ A L    + V+    P + D      ++EK KV
Sbjct: 312 DIHDD--DRYFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPDFSRYWDVIEKHKV 369

Query: 263 TIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE---ILE 319
           T F   PT    LL   GDH I    + L    S G  + AEV +   EK G E   I +
Sbjct: 370 TQFYVAPTAL-RLLKRAGDHHIHHKMEHLRVLGSVGEPIAAEVWKWYFEKVGKEEAHICD 428

Query: 320 GYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV 378
            Y  +ET S V++        KPGS  LP +G+E  ++D     + GE      V G   
Sbjct: 429 TYWQTETGSNVITPLAGVTPTKPGSASLPFFGIEPAIIDP----VSGEEISGNDVEGVLA 484

Query: 379 MK-----------GYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGY 427
            K           G H R       +  G++ TGD A RD EG+Y+I  R  D++   G+
Sbjct: 485 FKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNVSGH 544

Query: 428 NVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKE 484
            +   EIE  L+ HP V+ AAVVG+  +  G+ + AFV   EG    +    +LI   ++
Sbjct: 545 RLSTAEIEAALIEHPMVAEAAVVGIADELTGQAVNAFVSLKEGNETNDQVRKDLILQVRK 604

Query: 485 RLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            +  +  P+ V    +LP T +GKI++R LR
Sbjct: 605 SIGPFAAPKAVFVVDDLPKTRSGKIMRRILR 635


>ACSA_MAGSM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 644

 Score =  146 bits (368), Expect = 4e-37
 Identities = 133/518 (25%), Positives = 234/518 (45%), Gaps = 35/518 (6%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  ++ + N+ AN L +RG++ GD+V +  P +P          + GAV   +  
Sbjct: 104 DRKITYRELSALVNKFANALKARGVKKGDRVCIYMPMIPEAAVAMLACTRIGAVHSIVFG 163

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQE---VAECELYIDLPAA 137
             +P  +   + D+  + +        G+ ++PL +    A  +   V  C +  D    
Sbjct: 164 GFSPDALRDRIIDAECRVVITADGGMRGSKKIPLRKNVETALAQCPNVHTCFVVQDTQLE 223

Query: 138 AGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNL 195
              T     G + ++  A+     +      + +D   ++YTSG+TG+PKG    T   L
Sbjct: 224 IEWTE----GRDVWYHEAIAAASADCPPEEMDAEDPLFVLYTSGSTGKPKGVLHTTGGYL 279

Query: 196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGD 251
           L+ ++    +FD   D  D++     +  + G T ++   L    T ++   +P + D  
Sbjct: 280 LYASITHQYIFDYHED--DIYWCTADVGWVTGHTYIVYGPLANGATTLMFEGVPTYPDAS 337

Query: 252 EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVK 310
               +++K +V+IF   PT    +++ QGD  +K  S Q+L    S G  +  E      
Sbjct: 338 RFWQVVDKHQVSIFYTAPTAIRSIMS-QGDALVKATSRQSLRILGSVGEPINPEAWEWYY 396

Query: 311 EKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGE 366
              G     I++ +  +ET  ++    P     KPGS   P +GV  K++      +EG 
Sbjct: 397 HVVGEGRCPIVDTWWQTETGGILITPLPGATPLKPGSATRPFFGVNPKVLSNEGKEMEGP 456

Query: 367 GPGEIAVRGHC------VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
             G I V  H        + G H+R          G++  GD  RRDE+G+Y+I  R  D
Sbjct: 457 CEG-ILVLDHPWPGMMRTVYGDHDRFINTYFANYPGYYFCGDGCRRDEDGYYWITGRVDD 515

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG---ATLTEDE 477
           +I   G+ +   E+E  L+ H QV+ AAVVG+PH+  G+ I A+V    G   +   + E
Sbjct: 516 VINVSGHRLGTAEVESALVLHDQVAEAAVVGMPHEIKGQGIYAYVTLMSGVEPSDALKTE 575

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           L+   ++ +       +++F   LP T +GKI++R LR
Sbjct: 576 LVKLVRKEIGPIASLDVIQFAPGLPKTRSGKIMRRILR 613


>ACSA_RHOBA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 671

 Score =  145 bits (367), Expect = 6e-37
 Identities = 138/514 (26%), Positives = 223/514 (43%), Gaps = 34/514 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L YA +     + A  L   GI  GD V++  P  P          + GA+   +    +
Sbjct: 138 LTYAELQTEVAKCAEGLTQLGIGVGDVVSIYMPMTPELAVAMLACARIGAIHSVIFAGFS 197

Query: 88  PREIEYHLRDSGAKALFAFTGTPE----LPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
              I     D+ AK +    G       LPL     +A ++    E  + L    G    
Sbjct: 198 AESIAERNNDASAKLVITSDGLYRRGKVLPLKATVDEALEKSPTVEKCLVL-RRTGDDAP 256

Query: 144 AIPGAETFWA-ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
              G + +W   +  QPGE  +   + +    I+YTSG+TG+PKG  + HT   +N  A 
Sbjct: 257 MQEGRDVWWHDVVENQPGEMAAKPLDSETPLFILYTSGSTGKPKG--ILHTTAGYNLWAK 314

Query: 203 SA---LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRFDGDEAL-S 255
                +FD      DV+        I G + ++   L    T ++    P F  ++    
Sbjct: 315 RTFEWVFDHREG--DVYWCTADCGWITGHSYVVYGPLSAGATCLMYEGAPNFPAEDRFWD 372

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGI 315
           ++E+ KV+I    PT     +    +H  K    +L    S G  +  E      +K G 
Sbjct: 373 IVERHKVSILYTAPTAVRAFIKWGDEHVDKHDLSSLRLLGSVGEGINPEAWMWYHKKIGG 432

Query: 316 E---ILEGYGLSETSPVVSFNNPK-RKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P+ GV   +VDE  N+++ E  G++
Sbjct: 433 EKCPIVDTWWQTETGGIMMSPLPGITPTKPGSCTRPLPGVVPSIVDELGNSVDSEHGGKL 492

Query: 372 AVRGHC--VMKGYHNRPEANAQVMRDGW------FRTGDIARRDEEGFYFIIDRSKDMII 423
            +      +++G +   E   + +   W      + TGD AR D +G+Y+I+ R  D+I 
Sbjct: 493 CISQPWPGMLRGIYGDEE---RFVEQYWSDVPDKYLTGDNARCDTDGYYWIMGRIDDVIN 549

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE--DELIAW 481
             G+ +   E+E  L++HP V  AAVVG PHD  G+ I AFV   +     E  +EL   
Sbjct: 550 VSGHRLSTIEVESALVSHPDVCEAAVVGRPHDLKGQAIAAFVTSNDRGHDDEFRNELKQH 609

Query: 482 AKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            ++++ A   P  + F   LP T +GKI++R LR
Sbjct: 610 VRKQIGALAQPDDIRFTAALPKTRSGKIMRRLLR 643


>ACSA_METSB RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  145 bits (366), Expect = 8e-37
 Identities = 134/500 (26%), Positives = 225/500 (45%), Gaps = 26/500 (5%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN+L S GI  GD V +  P +P   +      + GA+   +    +   +   +   
Sbjct: 118 RLANVLKSYGISKGDTVTIYLPMIPEAAYAMLACARIGAIHSIVFGGFSADSLGGRIEGC 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFW-A 153
            +K +      + G  ++PL   A  A ++V      + +    G   +   G + ++  
Sbjct: 178 KSKLIITADEGYRGGRKVPLKVNADAAIKKVDGIVETMIVVRRTGGKVAWTEGRDVWYDE 237

Query: 154 ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDS 212
           AL     +  +     +D   I++TSG+TG PKG    T   L++ ++    +FD  P  
Sbjct: 238 ALAKASPDCPAAEMNAEDPLFILFTSGSTGAPKGVVHSTGGYLVWASMTHQYVFDYRPG- 296

Query: 213 HDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALS----LMEKEKVTIFAGV 268
            +V+     +  + G + ++   L    T ++         +S    +++K +V IF   
Sbjct: 297 -EVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPSYPTISRFWDVVDKHQVNIFYTA 355

Query: 269 PTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLS 324
           PT    L+ A GD  +K  S+ TL    S G  +  E         G E   I++ +  +
Sbjct: 356 PTAIRSLMGA-GDGPVKATSRKTLRVLGSVGEPINPEAWEWYYRVVGEERCPIVDTWWQT 414

Query: 325 ETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH--CVMKG 381
           ET  ++    P   A KPGS   P +GV+ ++VD     +EG   G + +       M+ 
Sbjct: 415 ETGGILISPLPGATALKPGSATQPFFGVQPQVVDAAGEVLEGPCSGNLVIADSWPAQMRT 474

Query: 382 YHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVL 438
             N  E   Q       G + TGD  RRDE+G+Y+I  R  D+I   G+ +   E+E  L
Sbjct: 475 LFNDHERFVQAYFSAYPGKYFTGDGCRRDEDGYYWITGRVDDVINVSGHRLGTAEVESSL 534

Query: 439 MTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIV 495
           + H +V+ AAVVG PHD  G+ I A+V    G   +E+   EL++W ++ +     P IV
Sbjct: 535 VAHIKVAEAAVVGYPHDLKGQGIYAYVTLMTGIEPSEELRKELVSWVRKDIGPIASPDIV 594

Query: 496 EFRTELPMTATGKILKRELR 515
            F   LP T +GKI++R LR
Sbjct: 595 HFAPGLPKTRSGKIMRRILR 614


>ACSA_LEPIN RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 661

 Score =  145 bits (365), Expect = 1e-36
 Identities = 134/516 (25%), Positives = 232/516 (44%), Gaps = 30/516 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  V    N+ AN+L   G++ GD+V +  P +P          + GA+   +    +
Sbjct: 114 LTYYDVYREVNRFANILKKFGVKKGDRVLVYLPMIPELAITILACTRIGAIHSVVFGGFS 173

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  ++  + D   K +      F G   + L +    A ++  E    + +    G  + 
Sbjct: 174 PEALQSRIDDCKPKLVVTADGGFRGGKPIELKKNVDLALEKSKEKVKTVIVVRRTGNESG 233

Query: 144 AI--PGAETFWAALNGQPGEFESVRTE---GDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
                G + ++  L   P      + E    +D   I+YTSG+TG+PKG   T    L  
Sbjct: 234 LTWKDGQDYWYHFLMNDPELSAYCKPEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLG 293

Query: 199 A-VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEA 253
           A +    +FD  P+  D +     +  + G + ++   L    + V+   +P + D    
Sbjct: 294 ANLTFHYVFDIKPE--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMFEGVPSYPDAGRF 351

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
             +++K  V IF   PT    L+    +H  K+   +L    S G  +  E      +  
Sbjct: 352 WDVIDKYGVNIFYTAPTAIRALMREGLNHIQKRDLSSLRLLGSVGEPINPEAWEWYFKNI 411

Query: 314 G---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTI--EGEG 367
           G     I++ +  +ET  ++    P     KPGS  LP +GV+  LVD +   I  +GE 
Sbjct: 412 GKGKCPIVDTWWQTETGSIMITALPGAIPQKPGSATLPFFGVQPVLVDNDGKEITDKGEV 471

Query: 368 PGEIAVRGH--CVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKDMI 422
            G + ++G    +M+G +  P+   +       G++ TGD ARRD++G+++I  R  D+I
Sbjct: 472 SGNLCIKGPWPSMMRGVYGDPKRFFETYFSQFKGYYFTGDGARRDKDGYFWITGRVDDVI 531

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELI 479
              G+ +   E+E  L+ +  V+ AAVVG PHD  G+ I A+V   EG T   + + ELI
Sbjct: 532 NVSGHRIGSAEVESALVENKSVAEAAVVGFPHDIKGQGIYAYVTVKEGVTTNDVLKKELI 591

Query: 480 AWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 592 STVEKMIGKIARPDVIHWAPGLPKTRSGKIMRRILR 627


>ACSA_LEPIC RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 661

 Score =  145 bits (365), Expect = 1e-36
 Identities = 134/516 (25%), Positives = 232/516 (44%), Gaps = 30/516 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  V    N+ AN+L   G++ GD+V +  P +P          + GA+   +    +
Sbjct: 114 LTYYDVYREVNRFANILKKFGVKKGDRVLVYLPMIPELAITILACTRIGAIHSVVFGGFS 173

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  ++  + D   K +      F G   + L +    A ++  E    + +    G  + 
Sbjct: 174 PEALQSRIDDCKPKLVVTADGGFRGGKPIELKKNVDLALEKSKEKVKTVIVVRRTGNESG 233

Query: 144 AI--PGAETFWAALNGQPGEFESVRTE---GDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
                G + ++  L   P      + E    +D   I+YTSG+TG+PKG   T    L  
Sbjct: 234 LTWKDGQDYWYHFLMNDPELSAYCKPEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLG 293

Query: 199 A-VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEA 253
           A +    +FD  P+  D +     +  + G + ++   L    + V+   +P + D    
Sbjct: 294 ANLTFHYVFDIKPE--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMFEGVPSYPDAGRF 351

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
             +++K  V IF   PT    L+    +H  K+   +L    S G  +  E      +  
Sbjct: 352 WDVIDKYGVNIFYTAPTAIRALMREGLNHIQKRDLSSLRLLGSVGEPINPEAWEWYFKNI 411

Query: 314 G---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTI--EGEG 367
           G     I++ +  +ET  ++    P     KPGS  LP +GV+  LVD +   I  +GE 
Sbjct: 412 GKGKCPIVDTWWQTETGSIMITALPGAIPQKPGSATLPFFGVQPVLVDNDGKEITDKGEV 471

Query: 368 PGEIAVRGH--CVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKDMI 422
            G + ++G    +M+G +  P+   +       G++ TGD ARRD++G+++I  R  D+I
Sbjct: 472 SGNLCIKGPWPSMMRGVYGDPKRFFETYFSQFKGYYFTGDGARRDKDGYFWITGRVDDVI 531

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELI 479
              G+ +   E+E  L+ +  V+ AAVVG PHD  G+ I A+V   EG T   + + ELI
Sbjct: 532 NVSGHRIGSAEVESALVENKSVAEAAVVGFPHDIKGQGIYAYVTVKEGVTTNDVLKKELI 591

Query: 480 AWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 592 STVEKMIGKIARPDVIHWAPGLPKTRSGKIMRRILR 627


>ACSA_ECOLI RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  145 bits (365), Expect = 1e-36
 Identities = 141/546 (25%), Positives = 246/546 (45%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGE-FESVRT 167
            +PL +    A +   V   E  + L    G       G + +W  L  Q  +  ++   
Sbjct: 195 SIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQ-EGRDLWWHDLVEQASDQHQAEEM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A+    +FD  P   D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPG--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     ++ +++K +V I    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KR 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGAT 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   N +EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH+  G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>ACSA_ECOL6 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  145 bits (365), Expect = 1e-36
 Identities = 141/546 (25%), Positives = 246/546 (45%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITSDEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPG-EFESVRT 167
            +PL +    A +   V   E  + L    G       G + +W  L  Q   + ++   
Sbjct: 195 SIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQ-EGRDLWWHDLVEQASAQHQAEEM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A+    +FD  P   D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPG--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     ++ +++K +V I    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KR 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGAT 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   N +EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH+  G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>MENE_STAEQ RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 474

 Score =  144 bits (364), Expect = 1e-36
 Identities = 104/349 (29%), Positives = 177/349 (50%), Gaps = 21/349 (6%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA--SSALFDQAPDSHDVFLTVLPLFHIFG 227
           + +A I++TSGTTG  K    T  N L +A     S  F+Q    + V+L+VLP++HI G
Sbjct: 132 ESIASIMFTSGTTGPQKAVPQTFNNHLASAKGCKQSLGFEQ----NTVWLSVLPIYHISG 187

Query: 228 QTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQI 287
            + ++ A +    T+ L+ +F  D+ L+ ++   +T  + VP     L++A         
Sbjct: 188 LSVILRAVIEGF-TVRLVKKFQTDDMLTQIKTYPITHMSLVPQTLKWLMDAGLTQPF--- 243

Query: 288 SQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGL 346
             +L   + GGA L  ++  +    + + +   +G++ET       +P+  K +  ++G 
Sbjct: 244 --SLEKILLGGAKLSPQLIEQALT-YRLPVYNSFGMTETCSQFLTASPQMLKERFDTVGK 300

Query: 347 PIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARR 406
           P   VE+K+ + N       G GE+ ++G  VM GY            DG+F+TGDIA  
Sbjct: 301 PSENVEVKIKNPN-----AYGHGELLIKGENVMNGYLYPKYLKDTFDNDGYFQTGDIAEI 355

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           D+EG+  I DR KD+II GG N+YP +IE +      +  A  VG+  DT G+    + +
Sbjct: 356 DDEGYVIIYDRRKDLIISGGENIYPYQIETIAKDFEGIEDAVCVGISDDTWGQVPILYYV 415

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +   + + ELI   +  LA YK P+       LP T+TGK+ +++++
Sbjct: 416 TNQ--DINQTELIEHFENHLARYKIPKKYYQVKSLPYTSTGKLQRKKVK 462


>ACSA_ENTS8 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  144 bits (364), Expect = 1e-36
 Identities = 140/545 (25%), Positives = 241/545 (44%), Gaps = 34/545 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+     R ++ AI++ GD       ++Y  ++    + AN L S GI+ GD 
Sbjct: 75  LNLAANCLDRHLSERGDQTAIIWEGDDATQSKHISYRELHRDVCRFANTLTSLGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS A+ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSARLVITADEGVRAGR 194

Query: 111 ELPLGERAWQAFQEVAECEL-YIDLPAAAGATTSAIPGAETFWAAL-NGQPGEFESVRTE 168
            +PL +    A +      + ++ +    G       G + +W+ L        + V   
Sbjct: 195 AIPLKKNVDDALKNPGVTSVEHVVVFKRTGGNIEWHEGRDLWWSELVKKASAHHQPVEMN 254

Query: 169 GDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFG 227
            +D   I+YTSG+TG+PKG    T   L++ A      FD  P   D++     +  + G
Sbjct: 255 AEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFLYAFDYHPG--DIYWCTADVGWVTG 312

Query: 228 QTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHD 283
            + ++   L    T ++   +P +     ++ +++K KV I    PT    L+ A+GD  
Sbjct: 313 HSYLLYGPLACGATTLMFEGVPNWPSANRMAQVVDKHKVNILYTAPTAIRALM-AEGDKA 371

Query: 284 IKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRK 338
           I    ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   +
Sbjct: 372 IDGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVIDTWWQTETGGFMITPLPGATE 431

Query: 339 AKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVM 393
            K GS   P +GV+  LVD   N  +G   G + +          + G H R E      
Sbjct: 432 LKAGSATRPFFGVQPALVDNEGNPQQGATEGNLVITDSWPGQARTLFGDHERFEQTYFST 491

Query: 394 RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
               + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L++HP+++ AAVVG+P
Sbjct: 492 FKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIP 551

Query: 454 HDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
           H   G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI+
Sbjct: 552 HSIKGQAIYAYVTLNHGEEPSAELYSEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIM 611

Query: 511 KRELR 515
           +R LR
Sbjct: 612 RRILR 616


>ACSA_BARHE RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  144 bits (364), Expect = 1e-36
 Identities = 130/518 (25%), Positives = 227/518 (43%), Gaps = 27/518 (5%)

Query: 23  FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           + D ++ Y  +     + AN+L + G++ GDKV +    +P   +      + GA+   +
Sbjct: 101 YHDKKITYNELYEHVCRFANILKNHGVKKGDKVTIYLTMIPEAAYAMLACARIGAIHSVI 160

Query: 83  NVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAA 138
               +P  I   + D  +  +        G  ++ L +    A +  A   +++D     
Sbjct: 161 FAGFSPEAIAGRIVDCESTFIITANQGLRGGKQINLKDSVDHAIEIAARQNVHVDQVMVI 220

Query: 139 GATTSAIPGAE--TFW--AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN 194
             T   I   E   FW    ++    +  + +   +D   I+YTSG+TG+PKG   T   
Sbjct: 221 RRTCGPIHWVEGRDFWYHEEVSHTKTDCPAEKMNAEDPLFILYTSGSTGKPKGVLHTTAG 280

Query: 195 -LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRF-D 249
            L++ ++    +FD    + +++     +  I G + ++   L    T ++    P F D
Sbjct: 281 YLVYASMTHKYVFDY--HAGEIYWCTADIGWITGHSYLVYGPLCNAATTLMFEGTPTFPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV 309
                 +++K +V IF   PT    L+ A      +    +L    S G  +  E     
Sbjct: 339 NGRFWEIVDKHQVNIFYTAPTAIRALMGAGNSFVERSKRTSLRLLGSVGEPINPEAWEWF 398

Query: 310 KEKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEG 365
               G     IL+ +  +ET   +    P     K GS   P +GV+++++D   N +EG
Sbjct: 399 YHTVGNNHCPILDTWWQTETGGHMITPLPGATPLKAGSATRPFFGVQLQIIDAEGNVLEG 458

Query: 366 EGPGEIAVRGHCV--MKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKD 420
           E  G + +       M+  +N  E   Q       G + TGD  RRD +G+Y+I  R  D
Sbjct: 459 ETEGNLCIIDSWPGQMRTLYNDHERFIQTYFSTYKGKYFTGDGCRRDSDGYYWITGRVDD 518

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---E 477
           ++   G+ +   EIE  L++HP VS AAVVG PH   G+ I +F+   EG   +E+   E
Sbjct: 519 ILNVSGHRLGTAEIESALVSHPAVSEAAVVGYPHTIKGQGIYSFITLMEGTAPSEELHQE 578

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           LI   ++ + +      V+F  +LP T +GKI++R LR
Sbjct: 579 LIRHVRKEIGSIAILDKVQFAPQLPKTRSGKIMRRILR 616


>ENTE_ECOLI RecName: Full=Enterobactin synthetase component
           E;AltName: Full=Enterochelin synthase E;Includes:
           RecName: Full=2,3-dihydroxybenzoate-AMP ligase;
          Length = 536

 Score =  144 bits (362), Expect = 2e-36
 Identities = 127/503 (25%), Positives = 229/503 (45%), Gaps = 23/503 (4%)

Query: 20  AIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVV 79
           A++ G+ +L+Y  +N  A+ +A  L  +GI+PG+   +   NV      +F  LK G  V
Sbjct: 41  AVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLG--V 98

Query: 80  VPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAG 139
            P+  L + +  E +         +A    P L + +R    F        ++   ++  
Sbjct: 99  APVLALFSHQRSELNA--------YASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIR 150

Query: 140 ATTSAIPGAE-TFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
                    E     A+N    +F +  +  D+VA    + GTTG PK    TH +  ++
Sbjct: 151 VVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYS 210

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY-RHGTMVLMPRFDGDEALSLM 257
              S  +      +   +L  +P  H +  ++  +  ++   GT+VL           L+
Sbjct: 211 VRRSVEICQFTQQTR--YLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLI 268

Query: 258 EKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEI 317
           EK +V + A VP      L A  + + +    +L     GGA L A +A ++  + G ++
Sbjct: 269 EKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQL 328

Query: 318 LEGYGLSETSPVVSFNNPKRKAKP--GSIGLPIW-GVEMKLVDENFNTIEGEGPGEIAVR 374
            + +G++E   +V++      A+    + G P+    E+ + D   N +     G +  R
Sbjct: 329 QQVFGMAEG--LVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTR 386

Query: 375 GHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPRE 433
           G    +GY+  P+ NA     +G++ +GD+   D EG+  +  R KD I RGG  +   E
Sbjct: 387 GPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEE 446

Query: 434 IEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYP 492
           IE +L+ HP V  AA+V +  +  GE+  A+++  E   L   ++  + +E+ +A +K P
Sbjct: 447 IENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKE--PLRAVQVRRFLREQGIAEFKLP 504

Query: 493 RIVEFRTELPMTATGKILKRELR 515
             VE    LP+TA GK+ K++LR
Sbjct: 505 DRVECVDSLPLTAVGKVDKKQLR 527


>ACSA_VIBVY RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  144 bits (362), Expect = 2e-36
 Identities = 139/522 (26%), Positives = 227/522 (43%), Gaps = 40/522 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  L Y  +     + +N L  +G+R GD V L  P VP          + GAV   +  
Sbjct: 105 DKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTIVFG 164

Query: 85  LLTPREIEYHLRDSGAKALF----AFTGTPELPLGERAWQAF--QEVAECELYIDLPAAA 138
             +P  +   + DS AK +        G   +PL +   +A    EV      + +    
Sbjct: 165 GFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVV-VFKRT 223

Query: 139 GATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLL 196
           G         + +W     +  +       + +D   I+YTSG+TG+PKG    T   L+
Sbjct: 224 GGNIDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLV 283

Query: 197 FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEA 253
           +  +    +FD  P   + F     +  I G T ++   L      +L   +P +     
Sbjct: 284 YATMTFKYVFDYQPG--ETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPNYPNTSR 341

Query: 254 LS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKE 311
           +S +++K +V I    PT    L+ A+G+  I+   + +L    S G  +  E      +
Sbjct: 342 MSEVVDKHQVNILYTAPTAIRALM-AKGNEAIEGTDRSSLRIMGSVGEPINPEAWEWYYK 400

Query: 312 KFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEG 367
             G E   I++ +  +ET  ++    P   A KPGS   P +GV+  LVD   N IE + 
Sbjct: 401 TIGNEKSPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVQPALVDNMGNVIEDQA 460

Query: 368 -----------PGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIID 416
                      PG++       + G H R E        G + TGD ARRDE+G+Y+I  
Sbjct: 461 AEGNLVILDSWPGQMR-----TVYGDHERFEQTYFSTFKGMYFTGDGARRDEDGYYWITG 515

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
           R  D++   G+ +   EIE  L+ HP+++ AA+VG+PHD  G+ I A+V    G   T +
Sbjct: 516 RVDDVLNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGEYPTAE 575

Query: 477 ---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              E+  W ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 576 LHKEVKDWVRKEIGPIATPDVLHWTDALPKTRSGKIMRRILR 617


>ACSA_VIBVU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  144 bits (362), Expect = 2e-36
 Identities = 139/522 (26%), Positives = 227/522 (43%), Gaps = 40/522 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  L Y  +     + +N L  +G+R GD V L  P VP          + GAV   +  
Sbjct: 105 DKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTIVFG 164

Query: 85  LLTPREIEYHLRDSGAKALF----AFTGTPELPLGERAWQAF--QEVAECELYIDLPAAA 138
             +P  +   + DS AK +        G   +PL +   +A    EV      + +    
Sbjct: 165 GFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVV-VFKRT 223

Query: 139 GATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLL 196
           G         + +W     +  +       + +D   I+YTSG+TG+PKG    T   L+
Sbjct: 224 GGNIDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLV 283

Query: 197 FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEA 253
           +  +    +FD  P   + F     +  I G T ++   L      +L   +P +     
Sbjct: 284 YATMTFKYVFDYQPG--ETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPNYPNTSR 341

Query: 254 LS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKE 311
           +S +++K +V I    PT    L+ A+G+  I+   + +L    S G  +  E      +
Sbjct: 342 MSEVVDKHQVNILYTAPTAIRALM-AKGNEAIEGTDRSSLRIMGSVGEPINPEAWEWYYK 400

Query: 312 KFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEG 367
             G E   I++ +  +ET  ++    P   A KPGS   P +GV+  LVD   N IE + 
Sbjct: 401 TIGNEKSPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVQPALVDNMGNVIEDQA 460

Query: 368 -----------PGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIID 416
                      PG++       + G H R E        G + TGD ARRDE+G+Y+I  
Sbjct: 461 AEGNLVILDSWPGQMR-----TVYGDHERFEQTYFSTFKGMYFTGDGARRDEDGYYWITG 515

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
           R  D++   G+ +   EIE  L+ HP+++ AA+VG+PHD  G+ I A+V    G   T +
Sbjct: 516 RVDDVLNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGEYPTAE 575

Query: 477 ---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              E+  W ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 576 LHKEVKDWVRKEIGPIATPDVLHWTDALPKTRSGKIMRRILR 617


>ACSA_CITK8 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  144 bits (362), Expect = 2e-36
 Identities = 140/546 (25%), Positives = 246/546 (45%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDATQSKHISYRELHRDVCRFANTLLELGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWA-ALNGQPGEFESVRT 167
            +PL +    A +   V   E  + L    G       G + +W+  +     + +    
Sbjct: 195 GIPLKKNVDDALKNPNVNSVEHVVVLKRTGGKVDWH-EGRDLWWSDVIEKSSADHQPEEM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A     +FD  PD  D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPD--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     ++ +++K +VTI    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVTILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KR 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGAT 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   +  EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L++HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH+  G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHNIKGQAIYAYVTLNHGEDPSPELYTEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>ACSA_CHRVO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  143 bits (360), Expect = 4e-36
 Identities = 145/530 (27%), Positives = 227/530 (42%), Gaps = 56/530 (10%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVAL-------------ACPNVPYFPFVYFGAL 73
           R+ Y+ ++    Q AN L S G++ GD+V +             AC  +     V FG  
Sbjct: 112 RVTYSELHRRVCQFANGLKSLGVKKGDRVVVYMPMGIEAVVTMQACARIGAIHSVVFGGF 171

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALF----AFTGTPELPLGERAWQAFQ-EVAEC 128
            AGAV                ++D+GA  +     +  G   +PL     +A   E AE 
Sbjct: 172 SAGAV-------------RDRIQDAGATVVVTANESVRGGKNVPLKATVDEALALEGAES 218

Query: 129 ELYIDLPAAAGATTSAIPGAETFWAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKG 187
             ++ +            G + +W  L  GQ    E      +D   I+YTSG+TG+PKG
Sbjct: 219 VRHVVVYQRTNGGADWTDGRDVWWHKLIEGQSEACEPEWMGAEDPLFILYTSGSTGKPKG 278

Query: 188 AQLTHTNLLFNAVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL-- 244
            Q +    L  A+ S   +FD  P+  DVF     +  I G + +    L    T V+  
Sbjct: 279 IQHSTAGYLLGALNSFRWVFDYKPN--DVFWCTADVGWITGHSYVCYGPLANGATQVIFE 336

Query: 245 -MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLP 302
            +P + D      ++E+ KV+IF   PT    L+    D   +    +L    + G  + 
Sbjct: 337 GVPTYPDAGRFWKMIEQHKVSIFYTAPTAIRSLIKLGSDLPKQYDLSSLRVLGTVGEPIN 396

Query: 303 AEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDE 358
            E      E  G     I++ +  +ET   +    P   A KPGS  LP+ GV   +VDE
Sbjct: 397 PEAWIWYYETVGGGRCPIVDTWWQTETGSTMIAPLPGAIATKPGSCTLPLPGVIADIVDE 456

Query: 359 NFNTIEGEGPGEIAVRGH--CVMKGYHNRPEANAQVMR----DG-WFRTGDIARRDEEGF 411
           +   +E    G + ++     +++   N PE   +       DG ++  GD A RDE G+
Sbjct: 457 SGAQVEPGRGGFLVIKKPFPSLVRTIWNDPERFKKTYFPDEFDGKYYLAGDSAHRDENGY 516

Query: 412 YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI----- 466
           ++I+ R  D++   G+ +   EIE  L+ +P V+ AAVVG PH+  GE + AFV+     
Sbjct: 517 FWIMGRIDDVLNVSGHRLGTMEIESALVANPLVAEAAVVGKPHEVKGEAVVAFVVLKGAR 576

Query: 467 -PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              + A     EL  W    +     P  + F   LP T +GKI++R LR
Sbjct: 577 PQGDAAKTVAAELKNWVAHEIGKIAQPDDIRFGENLPKTRSGKIMRRLLR 626


>ACSA_GEMAT RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  142 bits (359), Expect = 5e-36
 Identities = 152/554 (27%), Positives = 231/554 (41%), Gaps = 46/554 (8%)

Query: 2   LNLSVLLEDGARNRPERD--AIVF----GDMR-LNYALVNMIANQVANLLVSRGIRPGDK 54
           LN SV   D   + P R+  A+++    GD R   Y  +    N  AN+L   G+  GD+
Sbjct: 75  LNASVNCIDRHVHGPRRNKAALIWEGEPGDRRTFTYWDLYREVNLAANMLKKLGVGRGDR 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE--- 111
           VA+  P +P          + GA+   +     P  +   + D G K L    G      
Sbjct: 135 VAIYLPMIPEAVIAMLACARIGAIHTVVFGGFAPESLRDRINDCGCKLLITADGGSRRGQ 194

Query: 112 -LPLGERAWQAFQEVAECE---LYIDLPAAAGATTSAI--PGAETFWAALNGQ-PGEFES 164
            +PL   A  A +E    E   + +   +  G  T A    G + +W  L  Q P   E 
Sbjct: 195 MVPLKRNADVALKECPSIENVLVVMRRRSGVGDETFAEMQEGRDHWWHRLKRQVPRYCEP 254

Query: 165 VRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFH 224
              + +DV  ++YTSGTTG+PKG   T T      VA++  +       DV+     +  
Sbjct: 255 EAMDAEDVLFVLYTSGTTGKPKGIVHT-TGGFLTGVATTTKYTFDLKEEDVYWCTADIGW 313

Query: 225 IFGQTTMMNAALYRHGTMVLMPRF----DGDEALSLMEKEKVTIFAGVPT-----MYWGL 275
           I G + ++   L    T V+        D D    + E+  VTI    PT     M WG 
Sbjct: 314 ITGHSYLVYGPLANGATCVMYEGAPDWPDKDRFWQICERYGVTILYTAPTAIRAFMKWGT 373

Query: 276 LNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSF 332
              +  HD+ Q    L    S G  +  E      E  G     I++ +  +ET  ++  
Sbjct: 374 EYVK-KHDLSQ----LRVLGSVGEPINPEAWMWYHEHIGDFQCPIVDTWWQTETGAIMIT 428

Query: 333 NNPK-RKAKPGSIGLPIWGVEMKLVDENFNTIE-GEGPGEIAVRGHCVMKGYHNRPEANA 390
             P     KPGS  +P  G+   L+D N N +  G G   I      +++      +   
Sbjct: 429 PLPGVTTTKPGSATVPFPGIRTALLDANANELTVGGGLLAITHPWPSMLRTIWGDDQRYV 488

Query: 391 QVMRDGW------FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV 444
                 W      +  GD A+ DE+G+ +I+ R  D++   G+ +   E+E  L+ HP V
Sbjct: 489 DTYFSKWPGRPDLYFPGDGAKLDEDGYLWILGRVDDVLNVSGHRIGTMEVESALVDHPSV 548

Query: 445 SLAAVVGVPHDTHGEEIKAFVIPAEGATLT---EDELIAWAKERLAAYKYPRIVEFRTEL 501
           + AAVVG  HD  G+ I AFV    G T +    DEL     +++ A   P  + F  +L
Sbjct: 549 AEAAVVGKHHDLKGQAIAAFVTLRAGFTASGSLRDELRDHVAQKIGALARPDDILFSADL 608

Query: 502 PMTATGKILKRELR 515
           P T +GKI++R LR
Sbjct: 609 PKTRSGKIMRRLLR 622


>ENTE_ECO57 RecName: Full=Enterobactin synthetase component
           E;AltName: Full=Enterochelin synthase E;Includes:
           RecName: Full=2,3-dihydroxybenzoate-AMP ligase;
          Length = 536

 Score =  142 bits (358), Expect = 6e-36
 Identities = 126/507 (24%), Positives = 231/507 (45%), Gaps = 31/507 (6%)

Query: 20  AIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVV 79
           A++ G+ +L+Y  +N  A+ +A  L  +GI+PG+   +   NV      +F  LK G  V
Sbjct: 41  AVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLG--V 98

Query: 80  VPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAG 139
            P+  L + +  E +         +A    P L + +R    F      + +++   A  
Sbjct: 99  APVLALFSHQRSELNA--------YASQIEPALLIADRQHALFSG----DDFLNTFVAEH 146

Query: 140 ATTSAIP-----GAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN 194
           ++   +      G      A+N     F +  +  D+V     + GTTG PK    TH +
Sbjct: 147 SSIRVVQLLNDSGEHNLQDAINHPADGFTATPSPADEVVYFQLSGGTTGTPKLIPRTHND 206

Query: 195 LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY-RHGTMVLMPRFDGDEA 253
             ++   S  +      +   +L  +P  H +  ++  +  ++   GT+VL         
Sbjct: 207 YYYSVRRSVEICQFTQQTR--YLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLC 264

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
             L+EK ++ + A VP      L A  + + +    +L     GGA L A +A ++  + 
Sbjct: 265 FPLIEKHQINVTALVPPAVSLWLQALTEGESRAQLASLKLLQVGGARLSATLAARIPAEI 324

Query: 314 GIEILEGYGLSETSPVVSFNNPKRKAKP--GSIGLPIW-GVEMKLVDENFNTIEGEGPGE 370
           G ++ + +G++E   +V++      A+    + G P+    E+ + D   N +     G 
Sbjct: 325 GCQLQQVFGMAEG--LVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGR 382

Query: 371 IAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNV 429
           +  RG    +GY+  P+ NA     +G++ +GD+   D EG+  +  R KD I RGG  +
Sbjct: 383 LMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKI 442

Query: 430 YPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAA 488
              EIE +L+ HP V  AA+V +  +  GE+  A+++  E   L   ++  + +E+ +A 
Sbjct: 443 AAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKE--PLRAVQVRRFLREQGIAE 500

Query: 489 YKYPRIVEFRTELPMTATGKILKRELR 515
           +K P  VE    LP+TA GK+ K++LR
Sbjct: 501 FKLPDRVECVDSLPLTAVGKVDKKQLR 527


>MENE_STAES RecName: Full=2-succinylbenzoate--CoA ligase;       
           EC=6.2.1.26;AltName: Full=OSB-CoA synthetase;AltName:
           Full=o-succinylbenzoyl-CoA synthetase;
          Length = 474

 Score =  142 bits (357), Expect = 8e-36
 Identities = 103/349 (29%), Positives = 177/349 (50%), Gaps = 21/349 (6%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA--SSALFDQAPDSHDVFLTVLPLFHIFG 227
           + +A I++TSGTTG  K    T  N L +A     S  F+Q    + V+L+VLP++HI G
Sbjct: 132 ESIASIMFTSGTTGPQKAVPQTFNNHLASAKGCKQSLGFEQ----NTVWLSVLPIYHISG 187

Query: 228 QTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQI 287
            + ++ A +    T+ L+ +F  D+ L+ ++   +T  + VP     L++A         
Sbjct: 188 LSVILRAVIEGF-TVRLVKKFQTDDMLTQIKTYPITHMSLVPQTLKWLMDAGLTQPF--- 243

Query: 288 SQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGL 346
             +L   + GGA L  ++  +    + + +   +G++ET       +P+  K +  ++G 
Sbjct: 244 --SLEKILLGGAKLSPQLIEQAFA-YRLPVYNSFGMTETCSQFLTASPQMLKERFDTVGK 300

Query: 347 PIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARR 406
               VE+K+ + N       G GE+ ++G  VM GY            DG+F+TGDIA  
Sbjct: 301 TSENVEVKIKNPN-----AYGHGELLIKGENVMNGYLYPKYLKDTFDNDGYFQTGDIAEI 355

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           D+EG+  I DR KD+II GG N+YP +IE +      +  A  VG+  DT G+    + +
Sbjct: 356 DDEGYVIIYDRRKDLIISGGENIYPYQIETIAKDFEGIEDAVCVGISDDTWGQVPILYYV 415

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +   + ++ELI   +  LA YK P+       LP T+TGK+ +++++
Sbjct: 416 TNQ--DINQNELIEHFENHLARYKIPKKYYQVESLPYTSTGKLQRKKVK 462


>ACSA_PHOLL RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  141 bits (355), Expect = 1e-35
 Identities = 146/546 (26%), Positives = 239/546 (43%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNLS   L+   + R E+ AI++ GD       + Y  ++    Q AN+L + GI+ GD 
Sbjct: 75  LNLSANCLDRHLKERGEQTAIIWEGDDPTESKAITYRELHHDVCQFANVLKNMGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GA+   +    +P  +   + DS  K +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAIHSVIFAGFSPDAVSGRIIDSNTKLVITADEGLRAGR 194

Query: 111 ELPLGERAWQAFQEVAECELYIDLP-AAAGATTSAIPGAETFWAALNGQPGEFESVRT-E 168
            +PL +                 +     G       G + +W  L         V    
Sbjct: 195 TIPLKKXXXXXXXXXXXXXXXXXIVFKRTGNIGHWQSGRDLWWHELVADASADCPVEEIN 254

Query: 169 GDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFG 227
            +D   I+YTSG+TG+PKG    T   L++ ++    +FD  P   +V+     +  + G
Sbjct: 255 AEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYVFDYQPG--EVYWCTADVGWVTG 312

Query: 228 QTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDH 282
            + ++   L   G + LM    P +     LS +++K +V I    PT    L+ A+GD 
Sbjct: 313 HSYLLYGPL-SCGAITLMFEGVPNYPAVNRLSQIIDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNP-KR 337
            I+   +T L    S G  +  E      +K G     I++ +  +ET   +    P   
Sbjct: 371 AIEGTKRTSLRIMGSVGEPINPEAWEWYYQKIGNSKCPIVDTWWQTETGGFMITPLPGAT 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV-----MKGYHNRPEANAQV 392
           + K GS  LP +GV+  LVD     +EG   G + +          + G H+R E     
Sbjct: 431 ELKAGSATLPFFGVQPALVDNLGEQLEGVCEGNLVITDSWPGQARSLFGDHDRFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
              G + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L++HP+++ AAVVG 
Sbjct: 491 TFKGMYFSGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHPKIAEAAVVGT 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH+  G+ I A+V    G   + +   E+  W ++ +     P I+ +   LP T +GKI
Sbjct: 551 PHNIKGQAIYAYVTLNHGEEPSPELYTEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>DHBF_BACSU RecName: Full=Dimodular nonribosomal peptide synthetase;
          Length = 2378

 Score =  140 bits (354), Expect = 2e-35
 Identities = 141/525 (26%), Positives = 231/525 (44%), Gaps = 44/525 (8%)

Query: 1   MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACP 60
           +++L  + E  A   PER A++  D+++NY  +N  AN++A LL+ +GI P   VALA P
Sbjct: 457 LVSLQDMFEKQAVLTPERIALMCDDIQVNYRKLNEEANRLARLLIEKGIGPEQFVALALP 516

Query: 61  NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
             P       G LK GA  +PL+       I Y L D+    +        +   E A  
Sbjct: 517 RSPEMVASMLGVLKTGAAYLPLDPEFPADRISYMLEDAKPSCI--------ITTEEIAAS 568

Query: 121 AFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
              ++A  EL +D      A T  I         +     E + V    D  A IIYTSG
Sbjct: 569 LPDDLAVPELVLD-----QAVTQEI---------IKRYSPENQDVSVSLDHPAYIIYTSG 614

Query: 181 TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHG 240
           +TG+PKG  +T  +L    ++    F    +   + +T +  F I      +        
Sbjct: 615 STGRPKGVVVTQKSLSNFLLSMQEAFSLGEEDRLLAVTTV-AFDISALELYLPLISGAQI 673

Query: 241 TMVLMPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            +         +AL+ ++E   + I    PT++  L+ ++ +       + L   V GG 
Sbjct: 674 VIAKKETIREPQALAQMIENFDINIMQATPTLWHALVTSEPEK-----LRGLRVLV-GGE 727

Query: 300 SLPAEVARKVKEKFGIEILEGYGLSETS--PVVSFNNPKRKAKPGSIGLPIWGVEMKLVD 357
           +LP+ + +++++     +   YG +ET+     +F     K  P  IG PIW  ++ ++D
Sbjct: 728 ALPSGLLQELQD-LHCSVTNLYGPTETTIWSAAAFLEEGLKGVP-PIGKPIWNTQVYVLD 785

Query: 358 ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-VMRDGW-------FRTGDIARRDEE 409
                +     GE+ + G  + +GY +RP+  A+  + D +       +RTGD AR   +
Sbjct: 786 NGLQPVPPGVVGELYIAGTGLARGYFHRPDLTAERFVADPYGPPGTRMYRTGDQARWRAD 845

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           G    I R+   I   G+ +   EI+ VL  HP +  AAVV V  D  G++  A  + A+
Sbjct: 846 GSLDYIGRADHQIKIRGFRIELGEIDAVLANHPHIEQAAVV-VREDQPGDKRLAAYVVAD 904

Query: 470 GATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            A  T  EL  +    L  Y  P       ELP+T  GK+ ++ L
Sbjct: 905 AAIDTA-ELRRYMGASLPDYMVPSAFVEMDELPLTPNGKLDRKAL 948



 Score =  126 bits (317), Expect = 4e-31
 Identities = 138/532 (25%), Positives = 235/532 (44%), Gaps = 55/532 (10%)

Query: 9    EDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
            E  A  RP+  A+V+ +  L+YA +N  AN++A +++S G+ P   VALA P        
Sbjct: 1521 EKQAALRPDAIAVVYENQELSYAELNERANRLARMMISEGVGPEQFVALALPRSLEMXXX 1580

Query: 69   YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAEC 128
                        PL+       I + L+D  A+  F  T T          +A   +   
Sbjct: 1581 XXXXXXXXXXXXPLDPDYPADRIAFMLKD--AQPAFIMTNT----------KAANHIPPV 1628

Query: 129  ELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD-DVAVIIYTSGTTGQPKG 187
            E   ++P              T+ A   G P   +  +     + A +IYTSG+TG PKG
Sbjct: 1629 E---NVPKIVLDDPELAEKLNTYPA---GNPKNKDRTQPLSPLNTAYVIYTSGSTGVPKG 1682

Query: 188  AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFG---QTTMMNAALYRHGTMVL 244
              + H N+     A+   F  +  S D++     +FH +        +   L   G +V+
Sbjct: 1683 VMIPHQNVTRLFAATEHWFRFS--SGDIWT----MFHSYAFDFSVWEIWGPLLHGGRLVI 1736

Query: 245  MPRF---DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
            +P       +  L L+ KE VT+    P+ ++  + A+ +      + +L   + GG +L
Sbjct: 1737 VPHHVSRSPEAFLRLLVKEGVTVLNQTPSAFYQFMQAEREQPDLGQALSLRYVIFGGEAL 1796

Query: 302  PAEVARKVKEKFGI------EILEGYGLSETSPVVSFNNPKRKAKP----GSIGLPIWGV 351
              E++R +++ +        +++  YG++ET+  VS+    R          IG  I  +
Sbjct: 1797 --ELSR-LEDWYNRHPENRPQLINMYGITETTVHVSYIELDRSMAALRANSLIGCGIPDL 1853

Query: 352  EMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-VMRDGW-------FRTGDI 403
             + ++DE    +     GE+ V G  + +GY  RP   ++  + D +       +RTGD+
Sbjct: 1854 GVYVLDERLQPVPPGVAGELYVSGAGLARGYLGRPGLTSERFIADPFGPPGTRMYRTGDV 1913

Query: 404  ARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE-IK 462
            AR   +G    + R+   +   G+ +   EIE  L+ HPQ+  AAV+ V  D  G++ + 
Sbjct: 1914 ARLRADGSLDYVGRADHQVKIRGFRIELGEIEAALVQHPQLEDAAVI-VREDQPGDKRLA 1972

Query: 463  AFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            A+VIP+E  T    EL  +A ERL  Y  P       ELP+T  GK+ ++ L
Sbjct: 1973 AYVIPSE-ETFDTAELRRYAAERLPDYMVPAAFVTMKELPLTPNGKLDRKAL 2023


>ACSA_LEPBJ RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  140 bits (354), Expect = 2e-35
 Identities = 136/521 (26%), Positives = 229/521 (43%), Gaps = 40/521 (7%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  V    N+ AN+L   G++ GD+V +  P +P          + GA+   +    +
Sbjct: 107 LTYYDVYREVNRFANVLKKYGVKKGDRVLVYLPMIPELAITILACTRIGAIHSVVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  ++  + D   K +      F G   + L      A ++  E    + +    G  + 
Sbjct: 167 PEALQSRIDDCKPKLIVTADGGFRGGKPIELKRNVDIALEKSKEDVKTVIVVRRTGNESG 226

Query: 144 AI--PGAETFWAALNGQPGEFESVRTEG---DDVAVIIYTSGTTGQPKGA------QLTH 192
            +   G + ++  L G P      + E    +D   I+YTSG+TG+PKG        L  
Sbjct: 227 LVWKDGRDYWYHFLIGDPDLSPYCKPESMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLG 286

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF- 248
            NL F+ V     FD  P+  D +     +  + G + ++   L    + V+   +P + 
Sbjct: 287 VNLTFHYV-----FDIKPE--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMFEGVPSYP 339

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR- 307
           D      +++K  V IF   PT    L+     H  K+   +L    S G  +  E    
Sbjct: 340 DAGRFWDVIDKYGVNIFYTAPTAIRALMREGLTHVQKRNLSSLRLLGSVGEPINPEAWEW 399

Query: 308 --KVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTI- 363
             K+  K    I++ +  +ET  ++    P     KPGS  LP +GV+  LVD +   I 
Sbjct: 400 YFKIIGKEKCPIVDTWWQTETGSIMITALPGAIPQKPGSATLPFFGVQPVLVDNDGKEIN 459

Query: 364 -EGEGPGEIAVRGH--CVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDR 417
            +GE  G + ++     +M+G +   +           G++ TGD ARRD++G+Y+I  R
Sbjct: 460 DKGEVSGNLCIKSPWPSMMRGVYGDSKRFFDTYFSQFKGYYFTGDGARRDKDGYYWITGR 519

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE-- 475
             D+I   G+ +   E+E  L+ +  V+ AAVVG PHD  G+ I A+V   EG    +  
Sbjct: 520 VDDVINVSGHRIGSAEVESALVENRSVAEAAVVGFPHDIKGQGIYAYVTVKEGIATNDTL 579

Query: 476 -DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EL+A  ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 580 KKELVAIVEKVIGKIARPDVIHWAPSLPKTRSGKIMRRILR 620


>ACSA_BDEBA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  140 bits (354), Expect = 2e-35
 Identities = 130/512 (25%), Positives = 224/512 (43%), Gaps = 27/512 (5%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           ++ Y  +++   + AN+L   G++ GD V +  P +P          + GAV   +    
Sbjct: 106 KITYKELHLEVCRFANVLKKMGVKKGDVVTIYMPMIPDTAVAMLACARIGAVHSVVFAGF 165

Query: 87  TPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATT 142
           +P  I   + D   + +      F G+  + L E   +A  +  + +  + +   AG T 
Sbjct: 166 SPDSISDRILDGQCRFVITGDAGFRGSKVVALKENIDKALVKTPDVQKVL-VVKYAGTTV 224

Query: 143 SAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN-LLFNAV 200
              PG + ++   +     + E    + +D   I+YTSG+TG+PKG   T    L++ ++
Sbjct: 225 DMKPGRDLWYHEEVKTVSDQCEPEPMDAEDPLFILYTSGSTGKPKGVMHTTGGYLVYASM 284

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SL 256
               +FD   D  D++     +  + G + ++   L    T +    +P +        +
Sbjct: 285 THQYVFDYHED--DIYWCSADVGWVTGHSYIVYGPLANGATSLFFEGVPNYPTPSRFWEV 342

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG- 314
           ++K KVTIF   PT    L+  +GD  +K  S+ TL    S G  +  E      +  G 
Sbjct: 343 VDKHKVTIFYTSPTAIRSLMR-EGDAAVKTTSRKTLRLLGSVGEPINPEAWAWYHDVVGE 401

Query: 315 --IEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
               +++ +  +ET  ++    P   A KPGS  LP +GV+ KL+      I G G G +
Sbjct: 402 GRCPVVDTWWQTETGGILITPLPGAIAQKPGSATLPFFGVQPKLLTNEGQEIHGPGEGVL 461

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          +   H R E        G++ TGD  RRD++G+Y+I  R  D+I   G
Sbjct: 462 VIADSWPGQMRTVYRNHERFEDTYFSNYPGYYFTGDGCRRDQDGYYWITGRVDDVINVSG 521

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAK 483
           + +   EIE               G PHD  G+ I AFV    G T +E+   ELI   +
Sbjct: 522 HRLGTAEIESXXXXXXXXXXXXXXGYPHDIKGQGIYAFVTLKSGETASEELRKELIQTVR 581

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + +     P ++++   LP T +GKI++R LR
Sbjct: 582 KEIGPIATPDLIQWAPRLPKTRSGKIMRRILR 613


>ACSA_ALHEH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  140 bits (354), Expect = 2e-35
 Identities = 120/498 (24%), Positives = 215/498 (43%), Gaps = 23/498 (4%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN + +RG++ GD+V +  P +P          + GA+   +    +P  ++  ++++
Sbjct: 118 RLANAMKARGVKKGDRVCIYLPMIPEAAVAMLACARIGAIHSIVFGGFSPDALKDRIQNA 177

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
             + +        G   + L   A +A +   + +    +    G           +  A
Sbjct: 178 DCETVITADEGVRGGRNVALKSNADKALESCPDVKNVFVVKRTGGDIDWKEGRDIWYHEA 237

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA-LFDQAPDSH 213
           +     +  +   + +D   I+YTSG+TG+PKG Q      L  A  +   +FD      
Sbjct: 238 VADVSADCPAEELDAEDPLFILYTSGSTGKPKGVQHCSAGYLLGAAMTHKYVFDY--QEG 295

Query: 214 DVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVP 269
           +V+     +  + G + ++   L    T ++   +P +        +++K  V+IF   P
Sbjct: 296 EVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPSAARCWEVVDKHNVSIFYTAP 355

Query: 270 TMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSET 326
           T    L+    +H  K   ++L    + G  +  E         G     I++ +  +ET
Sbjct: 356 TAIRALMGQGNEHVTKTSRKSLRILGTVGEPINPEAWEWYYNVVGDGRCPIVDTWWQTET 415

Query: 327 SPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMK 380
             ++    P     KPGS  LP +GVE  LVD     +EG   G + ++         + 
Sbjct: 416 GSILIAPLPGATDLKPGSATLPFFGVEPALVDPEGKELEGAASGNLVIKRAWPSMMRTVY 475

Query: 381 GYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMT 440
           G H R          G + TGD ARRDE+G+Y+I  R  D+I   G+ +   E+E  L+ 
Sbjct: 476 GDHKRFMETYLAAYPGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVL 535

Query: 441 HPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEF 497
           H  V+ AAVVG PHD  G+ I A+V    G   +++   EL+      +     P ++++
Sbjct: 536 HDAVAEAAVVGYPHDIKGQGIYAYVTLMAGVEPSDELKKELVKLVSNEIGPIAKPDVIQW 595

Query: 498 RTELPMTATGKILKRELR 515
              LP T +GKI++R LR
Sbjct: 596 APGLPKTRSGKIMRRILR 613


>TYCB_BREPA RecName: Full=Tyrocidine synthetase 2;AltName:
            Full=Tyrocidine synthetase II;Includes:  RecName:
            Full=ATP-dependent proline adenylase;
          Length = 3587

 Score =  140 bits (353), Expect = 2e-35
 Identities = 136/523 (26%), Positives = 216/523 (41%), Gaps = 51/523 (9%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            LS L ED A+  PE+ A+VFGD RL Y  +N  ANQ+A+ L ++G++    V +      
Sbjct: 1509 LSQLFEDQAQKTPEQTAVVFGDKRLTYRELNERANQLAHTLRAKGVQAEQSVGIMAQRSL 1568

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                            VP++       I Y L D     L       +  L E+      
Sbjct: 1569 EMXXXXXXXXXXXXXYVPIDPDYPNERIAYMLEDCRRLVL------TQQQLAEK----MT 1618

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
               EC LY+D   +    T  I                 E + T  D +A IIYTSGTTG
Sbjct: 1619 ANVEC-LYLDEEGSYSPQTENI-----------------EPIHTAAD-LAYIIYTSGTTG 1659

Query: 184  QPKGAQLTHTNLLFNAVASSALFD-QAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            +PKG  + H  ++ +   +   F     DS                   + +      T+
Sbjct: 1660 RPKGVMVEHRGIVNSVTWNRDEFALSVRDSGXXXXXXXXXXXXXXXXXXIVSG----STV 1715

Query: 243  VLMPRFDGDEALSL---MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            VLMP  +  + ++L   +   + +    VP+M+  +L      DI+ I   +     GG 
Sbjct: 1716 VLMPDHEAKDPIALRNLIAAWECSYVVFVPSMFQAILECSTPADIRSIQAVM----LGGE 1771

Query: 300  SLPAEVARKVKEKFG-IEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDE 358
             L  ++ +  K     + ++  YG +E+S + ++    +  +P +IG PI    + +VD+
Sbjct: 1772 KLSPKLVQLCKAMHPQMSVMNAYGPTESSVMATYLRDTQPDQPITIGRPIANTAIYIVDQ 1831

Query: 359  NFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDEEGF 411
            +   +     GEI + GH + +GY  +PE       AN  V  +  ++TGD+ R   +G 
Sbjct: 1832 HHQLLPVGVVGEICIGGHGLARGYWKKPELTAEKFVANPAVPGERMYKTGDLGRWLHDGT 1891

Query: 412  YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA 471
               I R  D I   GY +   EIE VL+ + Q + A VV    D     + A+V      
Sbjct: 1892 IDFIGRVDDQIKVRGYRIEVGEIEAVLLAYDQTNEAIVVAYQDDRGDSYLAAYV--TGKT 1949

Query: 472  TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             + E EL A     L AY  P  +      P+T  GK+ ++ L
Sbjct: 1950 AIEESELRAHLLRELPAYMVPTYLIQLDAFPLTPNGKVDRKAL 1992



 Score =  125 bits (314), Expect = 8e-31
 Identities = 134/522 (25%), Positives = 215/522 (41%), Gaps = 59/522 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A   PE  A+VF + R+++  +N  ANQ+A +L  +G+ P   VAL         
Sbjct: 2549 LFEELAEKMPEHTALVFEEKRMSFRELNERANQLAAVLREKGVGPAQIVALLVERSAEMV 2608

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAG   +P++       I Y L DS AK +              A    +  +
Sbjct: 2609 IATLATLKAGGAFLPVDPDYPEERIRYMLEDSQAKLVVT-----------HAHLLHKVSS 2657

Query: 127  ECELYIDLPAAAGAT-TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
            + E        + AT T  +P A T                    D+A IIYTSGTTG+P
Sbjct: 2658 QSEXXXXXXPGSYATQTDNLPCANT------------------PSDLAYIIYTSGTTGKP 2699

Query: 186  KGAQLTHTNLL-FNAVASSALFDQAPDSHDVFLTV---LPLFHIFGQTTMMNAALYRHGT 241
            KG  L H  +    AV +  L     D    F ++     ++ +FG   +  A LY    
Sbjct: 2700 KGVMLEHKGVANLQAVFAHHLGVTPQDRAGHFASISFDASVWDMFG-PLLSGATLYVLSR 2758

Query: 242  MVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             V+    +  +  +   ++    F  +P  Y   L  +      Q+  +L T ++ G++ 
Sbjct: 2759 DVI----NDFQRFAEYVRDNAITFLTLPPTYAIYLEPE------QV-PSLRTLITAGSAS 2807

Query: 302  PAEVARKVKEKFGIEILEGYGLSETSPVVSF--NNPKRKAKPGSIGLPIWGVEMKLVDEN 359
               +  K KEK  +  + GYG +E++   +     P    +  +IG PI   ++ +VD+ 
Sbjct: 2808 SVALVDKWKEK--VTYVNGYGPTESTVCATLWKAKPDEPVETITIGKPIQNTKLYIVDDQ 2865

Query: 360  FNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WFRTGDIARRDEEGFY 412
                     GE+ + G  + +GY NRPE  A+   D         +RTGD+AR   +G  
Sbjct: 2866 LQLKAPGQMGELCISGLSLARGYWNRPELTAEKFVDNPFVPGTKMYRTGDLARWLPDGTI 2925

Query: 413  FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT 472
              + R    +   G+ V   E+E VL+ +  V  AA +    D  G+        AEG  
Sbjct: 2926 EYLGRIDHQVKIRGHRVELGEVESVLLRYDTVKEAAAI-THEDDRGQAYLCAYYVAEGEA 2984

Query: 473  LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             T  +L A+ +  L  Y  P       ++P+T   KI ++ L
Sbjct: 2985 -TPAQLRAYMENELPNYMVPAFFIQLEKMPLTPNDKIDRKAL 3025



 Score =  116 bits (291), Expect = 4e-28
 Identities = 132/523 (25%), Positives = 203/523 (38%), Gaps = 62/523 (11%)

Query: 12  ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
           A   PE+ A+VF D  L Y  ++  +NQ+A  L  +GI  G  V               G
Sbjct: 477 AEKTPEQVAVVFADQHLTYRELDEKSNQLARFLRKKGIGTGSLVGTLLDRSLDMIVGILG 536

Query: 72  ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
            LKAG   VP++  L    I Y L  S             +PL         +V      
Sbjct: 537 VLKAGGAFVPIDPELPAERIAYMLTHS------------RVPLVVTQNHLRAKVTTPTET 584

Query: 132 IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
           ID+  A     S  P                ES+  +  D+  IIYTSGTTGQPKG  L 
Sbjct: 585 IDINTAVIGEESRAP---------------IESLN-QPHDLFYIIYTSGTTGQPKGVMLE 628

Query: 192 HTNLL---------FNAVASSALFDQAPDSHDV-FLTVLPLFHIFGQTTMMNAALYRHGT 241
           H N+           N      +      S DV +  +       GQ  ++   L RH  
Sbjct: 629 HRNMANLMHFTFDQTNIAFHEKVLQYTTCSFDVCYQEIFSTLLSGGQLYLITNELRRH-- 686

Query: 242 MVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
                     E L    +EK      +P  +   +  + D+         H   +G   +
Sbjct: 687 ---------VEKLFAFIQEKQISILSLPVSFLKFIFNEQDYAQSFPRCVKHIITAGEQLV 737

Query: 302 PAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKP--GSIGLPIWGVEMKLVDEN 359
                +K   +  + +   YG SET  V +      +A P    IG PI    + ++DE 
Sbjct: 738 VTHELQKYLRQHRVFLHNHYGPSETHVVTTCTMDPGQAIPELPPIGKPISNTGIYILDEG 797

Query: 360 FNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WFRTGDIARRDEEGF 411
              ++ EG  GE+ + G  V +GY ++PE  A+   D         +RTGD+A    +G 
Sbjct: 798 LQ-LKPEGIVGELYISGANVGRGYLHQPELTAEKFLDNPYQPGERMYRTGDLALWLPDGQ 856

Query: 412 YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA 471
              + R    +   G+ +   EIE  L+ HP +  A V+    +T G+ + A+V+  +  
Sbjct: 857 LEFLGRIDHQVKIRGHRIELGEIESRLLNHPAIKEAVVIDRADETGGKFLCAYVVLQK-- 914

Query: 472 TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            L+++E+ A+  + L  Y  P        +P+T  GK  +R L
Sbjct: 915 ALSDEEMRAYLAQALPEYMIPSFFVTLERIPVTPNGKTDRRAL 957


>ACSA_ECO57 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  140 bits (353), Expect = 2e-35
 Identities = 139/546 (25%), Positives = 244/546 (44%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLKLGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGE-FESVRT 167
            +PL +    A +   V   E  + L    G       G + +W     Q  +  ++   
Sbjct: 195 SIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQ-EGRDLWWHDQVEQASDQHQAEEM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A+    +FD  P   D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPG--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     ++ +++K +V I    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KR 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGAT 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   N +EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+ +Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDSYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH+  G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>ACSA_BART1 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  140 bits (353), Expect = 2e-35
 Identities = 134/524 (25%), Positives = 226/524 (43%), Gaps = 39/524 (7%)

Query: 23  FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           + D ++ Y  +     + ANLL + G++ GDKV +  P +P   +      + GAV   +
Sbjct: 101 YHDKKITYNELYEHVCRFANLLKNHGVKKGDKVTIYLPMIPEAAYAMLACARIGAVHSVI 160

Query: 83  NVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAA 138
               +   I   + D  +  +        G   + L +    A +  A   + +D     
Sbjct: 161 FAGFSAEAIAGRIVDCESTFIITADHGLRGGKRINLKDNVDHAIEIAARQNVRVDQVMVI 220

Query: 139 GATTSAIPGAE--TFWA------ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-Q 189
             T   I   E   FW       A    P E        +D   I+YTSG+TG+PKG   
Sbjct: 221 RRTCGPIDWIEGRDFWYHEEITHAKTNCPAE----PMNAEDPLFILYTSGSTGKPKGVLH 276

Query: 190 LTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---P 246
            T   L++ A+    +FD  P   +++     +  I G + ++   L    T ++    P
Sbjct: 277 STGGYLVYAAITHKYVFDYHPG--EIYWCTADIGWITGHSYLVYGPLCNGATTLMFEGTP 334

Query: 247 RF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAE 304
            F D      +++K KV      PT    L+ A G+  ++   +T L    + G  +  E
Sbjct: 335 TFPDKGRFWEIVDKHKVNTLYTAPTAIRALMGA-GNSFVEHSKRTSLRLLGTVGEPINPE 393

Query: 305 VARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENF 360
                    G +   IL+ +  +ET   +    P     K GS   P +GV+++++DE  
Sbjct: 394 AWEWFYHTVGNDRCPILDTWWQTETGGHMITPLPGATPLKAGSATRPFFGVQLQIIDEQG 453

Query: 361 NTIEGEGPGEIAV------RGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFI 414
           N +EGE  G + +      +   + K +    E      +  +F TGD  RRD +G+Y+I
Sbjct: 454 NILEGEAEGNLCIIDSWPGQMRTLYKDHERFIETYFSTYKGKYF-TGDGCRRDSDGYYWI 512

Query: 415 IDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLT 474
             R  D++   G+ +   EIE  L+ HP VS AAVVG PH   G+ + +FV   EG   +
Sbjct: 513 TGRVDDILNVSGHRLGTAEIESALVLHPAVSEAAVVGYPHPIKGQGVYSFVTLMEGTAPS 572

Query: 475 ED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           E+   +LI   ++ + +      ++F  +LP T +GKI++R LR
Sbjct: 573 EELQKDLIKHVRKEIGSIAILDKIQFAPQLPKTRSGKIMRRILR 616


>GRSB_BREBE RecName: Full=Gramicidin S synthetase 2;AltName:
            Full=Gramicidin S synthetase II;Includes:  RecName:
            Full=ATP-dependent proline adenylase;
          Length = 4450

 Score =  140 bits (352), Expect = 3e-35
 Identities = 131/524 (25%), Positives = 216/524 (41%), Gaps = 58/524 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+  +  PE  AIV+    L Y  +N+ ANQ+A +L  +G+ P   VA+         
Sbjct: 3593 LFEEQVKKTPEHIAIVWEGQALTYHELNIKANQLARVLREKGVTPNHPVAIMTERSLEMI 3652

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               F  LKAG   VP++       I+Y L DSGA  L                   Q   
Sbjct: 3653 VGIFSILKAGGAYVPIDPAYPQERIQYLLEDSGATLLLT-----------------QSHV 3695

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFES-----VRTEGDDVAVIIYTSGT 181
              +L +D+                 W  L  +    E         +  D+A IIYTSGT
Sbjct: 3696 LNKLPVDIE----------------WLDLTDEQNYVEDGTNLPFMNQSTDLAYIIYTSGT 3739

Query: 182  TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
            TG+PKG  + H +++         ++  P   D  L V   F   G    + A +    T
Sbjct: 3740 TGKPKGVMIEHQSIINCLQWRKEEYEFGPG--DTALQVFS-FAFDGFVASLFAPILAGAT 3796

Query: 242  MVLMPRFDGDEALS---LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             VL    +  + ++   L+  E++T + GVP+++  +L+     D+    Q L     GG
Sbjct: 3797 SVLPKEEEAKDPVALKKLIASEEITHYYGVPSLFSAILDVSSSKDL----QNLRCVTLGG 3852

Query: 299  ASLPAE-VARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD 357
              LPA+                 YG +E S V +     +  +  +IG P+  V++ +V+
Sbjct: 3853 EKLPAQXXXXXXXXXXXXXXXXXYGPTENSVVTTIMRDIQVEQEITIGCPLSNVDVYIVN 3912

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDEEG 410
             N         GE+ + G  + +GY N+PE  A        V  +  ++TGD+A+   +G
Sbjct: 3913 CNHQLQPVGVVGELCIGGQGLARGYLNKPELTADKFVVNPFVPGERMYKTGDLAKWRSDG 3972

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R  + +   GY +   EIE  ++ + ++  A V+ V   T  E++    I  E 
Sbjct: 3973 MIEYVGRVDEQVKVRGYRIELGEIESAILEYEKIKEAVVI-VSEHTASEQMLCAYIVGEE 4031

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              LT D L ++  + L +Y  P        +P+T  GK+ ++ L
Sbjct: 4032 DVLTLD-LRSYLAKLLPSYMIPNYFIQLDSIPLTPNGKVDRKAL 4074



 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/529 (23%), Positives = 224/529 (42%), Gaps = 57/529 (10%)

Query: 1    MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACP 60
            M  +  L E+     P+  A+ + D  L Y  +N  ANQVA +L  +G++P + V L   
Sbjct: 1505 MQTIQGLFEEQVEKTPDHVAVGWKDQALTYRELNERANQVARVLRQKGVQPDNIVGLLVE 1564

Query: 61   NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
              P       G LKAG   +PL+       I Y ++D G + +            +    
Sbjct: 1565 RSPEMLVGIMGILKAGGAYLPLDPEYPADRISYMIQDCGVRIMLT---------QQHLLS 1615

Query: 121  AFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
               +  +C +  +     G +++  P                     +  D+A I+YTSG
Sbjct: 1616 LVHDEFDCVILDEDSLYKGDSSNLAPV-------------------NQAGDLAYIMYTSG 1656

Query: 181  TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP-----LFHIFGQTTMMNAA 235
            +TG+PKG  + H N++   +  +  + Q  +   +  T         F +FG + +  A 
Sbjct: 1657 STGKPKGVMVEHRNVI--RLVKNTNYVQVREDDRIIQTGAIGFDALTFEVFG-SLLHGAE 1713

Query: 236  LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            LY     VL+   D ++    ++  ++TI      ++  L  +QG    +++   L + +
Sbjct: 1714 LYPVTKDVLL---DAEKLHKFLQANQITIMWLTSPLFNQL--SQGT---EEMFAGLRSLI 1765

Query: 296  SGGASLPAEVARKVKEKF-GIEILEGYGLSE-TSPVVSFNNPKRKAKPGSIGLPIWGVEM 353
             GG +L  +    VK K   + +  GYG +E T+    F   K       IG  I    +
Sbjct: 1766 VGGDALSPKHINNVKRKCPNLTMWNGYGPTENTTFSTCFLIDKEYDDNIPIGKAISNSTV 1825

Query: 354  KLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEA-------NAQVMRDGWFRTGDIAR 405
             ++D  +  ++  G PGE+ V G  V +GY N+P         N     +  +RTGD+AR
Sbjct: 1826 YIMDR-YGQLQPVGVPGELCVGGDGVARGYMNQPALTEEKFVPNPFAPGERMYRTGDLAR 1884

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
               +G    + R    +   GY + P EIE +L+ H +V  + ++ V  +   + + A+ 
Sbjct: 1885 WLPDGTIEYLGRIDQQVKIRGYRIEPGEIETLLVKHKKVKESVIMVVEDNNGQKALCAYY 1944

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +P E  T++  EL  +  + L  Y  P       ++P+T  GK+ +  L
Sbjct: 1945 VPEEEVTVS--ELREYIAKELPVYMVPAYFVQIEQMPLTQNGKVNRSAL 1991



 Score =  112 bits (279), Expect = 9e-27
 Identities = 129/533 (24%), Positives = 213/533 (39%), Gaps = 68/533 (12%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+     P+  A++    +L+Y  +N  ANQ+A +L  +G++P   V +         
Sbjct: 2547 LFEEQVEKTPDHIAVIDEREKLSYQELNAKANQLARVLRQKGVQPNSMVGIMVDRSLDMI 2606

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL---------FAFTGTPELPLGER 117
                G LKAG   VP+++      I Y + DSGA             AF+G         
Sbjct: 2607 VGMLGVLKAGGAYVPIDIDYPQERISYMMEDSGAAXXXXXXXXXXXIAFSGDI------- 2659

Query: 118  AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIY 177
                        LY+D               +  W  L+ +    E +     D+A IIY
Sbjct: 2660 ------------LYLD---------------QEEW--LHEEASNLEPI-ARPQDIAYIIY 2689

Query: 178  TSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY 237
            TSGTTG+PKG  + H + +  A+A    +    D+  V L  +  F           AL 
Sbjct: 2690 TSGTTGKPKGVMIEHQSYVNVAMAWKDAY--RLDTFPVRLLQMASFAFDVSAGDFARALL 2747

Query: 238  RHGTMVLMP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTA 294
              G +++ P   + D     ++++K  +TIF   P +   L+    +  +  ISQ L   
Sbjct: 2748 TGGQLIVCPNEVKMDPASLYAIIKKYDITIFEATPALVIPLMEYIYEQKL-DISQ-LQIL 2805

Query: 295  VSGGASLPAEVARKVKEKFG--IEILEGYGLSETSPVVSFNNPKRKAKPGS----IGLPI 348
            + G  S   E  + +  +FG  I I+  YG++E     S+      +   +    IG P 
Sbjct: 2806 IVGSDSCSMEDFKTLVSRFGSTIRIVNSYGVTEACIDSSYYEQPLSSLHVTGTVPIGKPY 2865

Query: 349  WGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTG 401
              ++M ++++          GE+ + G  V +GY NRP+  A+       V  +  +RTG
Sbjct: 2866 ANMKMYIMNQYLQIQPVGVIGELCIGGAGVARGYLNRPDLTAEKFVPNPFVPGEKLYRTG 2925

Query: 402  DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEI 461
            D+AR   +G    + R+   +               L  H  +  A V+        + +
Sbjct: 2926 DLARWMPDGNVEFLGRNDHQVKXXXXXXXXXXXXAQLRKHDSIKEATVIAREDHMKEKYL 2985

Query: 462  KAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             A+++  EG  +   EL A+    L A   P        +P+TA GKI KR L
Sbjct: 2986 CAYMV-TEG-EVNVAELRAYLATDLPAAMIPSYFVSLEAMPLTANGKIDKRSL 3036



 Score = 96.7 bits (239), Expect = 4e-22
 Identities = 116/528 (21%), Positives = 209/528 (39%), Gaps = 64/528 (12%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L  +     PE  A+VF D ++ Y  ++  +NQ+A  L  +G++    + +         
Sbjct: 473 LFTEQVEKTPEHVAVVFEDEKVTYRELHERSNQLARFLREKGVKKESIIGIMMERSVEMI 532

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G LKAG   VP++       I Y L             +  L L +R  +      
Sbjct: 533 VGILGILKAGGAFVPIDPEYPKERIGYML------------DSVRLVLTQRHLKDKFAFT 580

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
           +  + I+ P+ +   T  I                      E +D+  IIYTSGTTG+PK
Sbjct: 581 KETIVIEDPSISHELTEEI------------------DYINESEDLFYIIYTSGTTGKPK 622

Query: 187 GAQLTHTNLL---------FNAVASSALFDQAPDSHDV-FLTVLPLFHIFGQTTMMNAAL 236
           G  L H N++          N   S  +      S DV +  +       GQ  ++    
Sbjct: 623 GVMLEHKNIVNLLHFTFEKTNINFSDKVLQYTTCSFDVCYQEIFSTLLSGGQLYLIRKET 682

Query: 237 YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
            R          D ++   L+++E + + +  P  +   +  + +   +  +   H   +
Sbjct: 683 QR----------DVEQLFDLVKRENIEVLS-FPVAFLKFIFNEREFINRFPTCVKHIITA 731

Query: 297 GGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN-NPKRK-AKPGSIGLPIWGVEMK 354
           G   +     ++   +  + +   YG SET  V ++  NP+ +  +   IG PI    + 
Sbjct: 732 GEQLVVNNEFKRYLHEHNVHLHNHYGPSETHVVTTYTINPEAEIPELPPIGKPISNTWIY 791

Query: 355 LVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVM-------RDGWFRTGDIARR 406
           ++D+    ++ +G  GE+ + G  V +GY N  E  A+          +  +RTGD+AR 
Sbjct: 792 ILDQE-QQLQPQGIVGELYISGANVGRGYLNNQELTAEKFFADPFRPNERMYRTGDLARW 850

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
             +G    + R+   +   G+ +   EIE  L+    V  A V+    D  G+ + A+V+
Sbjct: 851 LPDGNIEFLGRADHQVKIRGHRIELGEIEAQLLNCKGVKEAVVIDKADDKGGKYLCAYVV 910

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                 + + EL  +  + L  Y  P       +LP+T  GKI ++ L
Sbjct: 911 ME--VEVNDSELREYLGKALPDYMIPSFFVPLDQLPLTPNGKIDRKSL 956


>BACA_BACLI RecName: Full=Bacitracin synthetase 1;       
            Short=BA1;Includes:  RecName: Full=ATP-dependent
            isoleucine adenylase;           Short=IleA;
          Length = 5255

 Score =  140 bits (352), Expect = 3e-35
 Identities = 129/516 (25%), Positives = 225/516 (43%), Gaps = 52/516 (10%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A+  P+  A+VF D +L Y  +N  ANQVA LL  +G++P   V +         
Sbjct: 2130 LFEEQAKRIPDHTAVVFEDQKLTYRQLNEKANQVARLLREKGVKPDTLVGIMMERSSDMI 2189

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                G LKAG   +P++    P  + Y   DS  K + +     ++PL E       E+ 
Sbjct: 2190 AAILGVLKAGGAYLPIDPEYPPERMRYMAFDSEVKVIIS-----DVPLAEELTAESIEL- 2243

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
               +++D    AG   S                 + ++V   G D+A +IYTSG+TG+PK
Sbjct: 2244 ---IHMDDERIAGQDRS-----------------DIDNVNQSG-DLAYVIYTSGSTGKPK 2282

Query: 187  GAQLTHTNLLFNAVASSALFDQAP-DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM 245
            G  + H +L+       + F+    D+  ++ ++     ++     + A    H  +   
Sbjct: 2283 GVMIEHQSLINLCSWHQSCFEVGQNDNSSIYASISFDAFVWELFPYITAGATVH-VLNQE 2341

Query: 246  PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
             R D ++         +TI + +PT       A  +H       +L T ++GG  L    
Sbjct: 2342 TRLDVEKLNRYFHDHHITI-SFLPTPVCEQFTALDNH-------SLRTLLTGGDKL---- 2389

Query: 306  ARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEG 365
                KEK   +I+  YG +E + V +     +  +   IG PI  V++ +++++      
Sbjct: 2390 -NVFKEK-SYQIVNNYGPTENTVVATSFPIDKSHQNIPIGKPIDNVKVYILNKDLQLCPL 2447

Query: 366  EGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDEEGFYFIIDRS 418
               GE+ + G  + +GY NRPE        N  V  +  +RTGD+A+   +G    + R 
Sbjct: 2448 GASGELCIAGEGLARGYVNRPELTREKFIGNPFVPGERMYRTGDLAKMLPDGNIQFLGRV 2507

Query: 419  KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDEL 478
               +   GY + P EIE  L+ + ++  AAV+      H   + A+V   +   +  +++
Sbjct: 2508 DQQVKIRGYRIEPGEIENRLLKYEKIEEAAVIAREDGDHDPYLCAYVTVKK--EVEPEKI 2565

Query: 479  IAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             A+ K+ L  Y  P+       LP+T  GK+ K+ L
Sbjct: 2566 RAFLKKSLPDYMIPQYFVQLDGLPLTVNGKVDKKSL 2601



 Score =  115 bits (289), Expect = 7e-28
 Identities = 123/529 (23%), Positives = 209/529 (39%), Gaps = 61/529 (11%)

Query: 2    LNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
            + +  L E  A   P+  A+ FGD  ++Y  +N  AN +A  L  +G+ P     +    
Sbjct: 3149 MTIPELFEKQAEKTPDHPAVAFGDETISYRELNERANSLAFTLRQKGVGPDVIAGILTER 3208

Query: 62   VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
                     G LKAG   +P++       I Y ++DS    L A                
Sbjct: 3209 SIEMIVGIMGILKAGGAYLPIDPAYPQERISYIVKDSDVSVLCAAG-------------- 3254

Query: 122  FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTE--GDDVAVIIYTS 179
                       D+      T   I   +T      GQ    E+++ +     +A +IYTS
Sbjct: 3255 -----------DVDPGEAYTGDIIRIDQT------GQNDHVENLKHDIKPQHLAYVIYTS 3297

Query: 180  GTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
            G+TG+PKG  + H ++       +    Q  D+H     V P         +  A L+ H
Sbjct: 3298 GSTGKPKGVMIEHHSVNNLVHGLNERIYQHLDAHLNVALVAPYIFDASVKQIFAALLFGH 3357

Query: 240  GTMVLMPRFDGDEALSLME---KEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
             T+ ++PR    +A+SL+E   K  + +    P      LN     D  ++   +   + 
Sbjct: 3358 -TLCIVPRETAWDAMSLIEYYSKNNINVSDMTPAH----LNMLAYVDKTELEFDVKELIV 3412

Query: 297  GGASLPAEVARKVKEKF---GIEILEGYGLSE------TSPVVSFNNPKRKAKPGSIGLP 347
            GG +L  +V   +  KF      I   YG +E      +  + S   P+  + P  IG P
Sbjct: 3413 GGDALTPDVIGGLFHKFPNLSCNITNVYGPTECCVDAASHQIESGKVPQTPSIP--IGRP 3470

Query: 348  IWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRD-------GWFRT 400
            +    + +VD+    +     GE+ + G  V +GY NRPE  A+   D         ++T
Sbjct: 3471 LLNTSIYIVDKELRPLPVGIAGELCIAGEGVARGYVNRPELTAEKFVDHPFEPGKKMYKT 3530

Query: 401  GDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE 460
            GD+A    +G    + R+   +   GY +   E+E+ L+TH ++  AAV+          
Sbjct: 3531 GDLAMWLPDGQIEFLGRADHQVKIRGYRIELGEVEQQLLTHEKIKEAAVIAGKDQNGNSY 3590

Query: 461  IKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
            + A++  A    L   ++  + +  +  Y  P        LP T +GK+
Sbjct: 3591 LCAYI--ASDKELPAADVRQFLEREMPDYMIPSYFVKLDRLPRTPSGKV 3637



 Score =  114 bits (284), Expect = 2e-27
 Identities = 132/526 (25%), Positives = 217/526 (41%), Gaps = 57/526 (10%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L  L E+ A   P+  A+VFG  R+ Y  +N  ANQ A LL  +GI  G           
Sbjct: 4668 LHELFEEQAMKTPDHTALVFGAQRMTYRELNEKANQTARLLREKGIGRGSXXXXXXDRSF 4727

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPRE-IEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
                     LKAG   +P++   TPR+ I+Y L++SGA AL   T +   P   +     
Sbjct: 4728 EMXXXXXXXLKAGGTYLPIDPE-TPRDRIDYMLKNSGA-ALLVTTDSLLKPFDIKTVDLC 4785

Query: 123  QEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
             +        +LP                                   D A I+YTSG+T
Sbjct: 4786 SDELHLLSEENLPRV-----------------------------NRSSDTAYIVYTSGST 4816

Query: 183  GQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            G PKG  + H +     V ++   D     +DV L  L  +   G    +  AL    ++
Sbjct: 4817 GTPKGVVIPHYSAA-RVVKNTNYIDIT--GNDVILQ-LSNYSFDGSVFDIFGALLNGASL 4872

Query: 243  VLMPR---FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            VL+ +    +  E   +++KE+V++      +   L N   D +I  +++ L   + GG 
Sbjct: 4873 VLIEKETVLNTHELAEVIKKEQVSVM----FITTALFNTLADINIGCLAK-LRKILFGGE 4927

Query: 300  SLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSF---NNPKRKAKPGSIGLPIWGVEMKL 355
                   RKV +  G + ++  YG +E++   ++   N    +A+   IG P+    + +
Sbjct: 4928 RASIPHVRKVLDHVGRDKLIHVYGPTESTVYATYYFINEIDDEAETIPIGSPLANTSVLI 4987

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDE 408
            +DE    +    PGE+ + G  + KGY NR E  A+       +  +  ++TGD+A+   
Sbjct: 4988 MDEAGKLLPIGVPGELCIAGDGLSKGYLNREELTAEKFIPHPFIPGERLYKTGDLAKWLP 5047

Query: 409  EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
            +G    I R    +   G+ +   EIE  L  H  ++   +V V  D          I A
Sbjct: 5048 DGNIEFIGRIDHQVKIRGFRIELGEIESRLEMHEDIN-ETIVTVREDEESRPYICAYITA 5106

Query: 469  EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                ++ DEL  +  E+L  Y  P       +LP+T  GK+ ++ L
Sbjct: 5107 -NREISLDELKGFLGEKLPDYMIPAYFVKMDKLPLTKNGKVDRKAL 5151



 Score =  110 bits (276), Expect = 2e-26
 Identities = 134/532 (25%), Positives = 217/532 (40%), Gaps = 67/532 (12%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
           L  L E+ A   P+  A+VFG  R+ Y  +N  ANQ A LL  +GI  G           
Sbjct: 39  LHELFEEQAMKTPDHTALVFGAQRMTYRELNEKANQTARLLREKGIGRGSXXXXXXDRSF 98

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                    LKAG   +P++       I + L D+ A  L        L  G+ A     
Sbjct: 99  EMXXXXXXXLKAGGAYLPIDPETPKDRIAFMLSDTKAAVL--------LTQGKAA----- 145

Query: 124 EVAECE---LYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
           +  +CE   + +D  A+ G +   +                  SV   GD  A IIYTSG
Sbjct: 146 DGIDCEADIVQLDREASDGFSKEPL-----------------SSVNDSGD-TAYIIYTSG 187

Query: 181 TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHG 240
           +TG PKG    H +++   V ++   D   D+    +  L  +   G    +  AL    
Sbjct: 188 STGTPKGVITPHYSVI-RVVQNTNYIDITEDN---VILQLSNYSFDGSVFDIFGALLNGA 243

Query: 241 TMVLMPRFDGDEAL-------SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHT 293
           ++V++ +    EAL       S + +EKV++      +   L N   D  +  +S  L  
Sbjct: 244 SLVMIEK----EALLNINRLGSAINEEKVSVM----FITTALFNMIADIHVDCLS-NLRK 294

Query: 294 AVSGGASLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSF---NNPKRKAKPGSIGLPIW 349
            + GG        RKV    G + ++  YG +E++   ++   N    +A+   IG P+ 
Sbjct: 295 ILFGGERASIPHVRKVLNHVGRDKLIHVYGPTESTVYATYYFINEIDDEAETIPIGSPLA 354

Query: 350 GVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGD 402
              + ++DE    +    PGE+ + G  + KGY NR E  A+       +  +  ++TGD
Sbjct: 355 NTSVLIMDEAGKLVPIGVPGELCIAGDGLSKGYLNREELTAEKFIPHPFIPGERLYKTGD 414

Query: 403 IARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIK 462
           +A+   +G    I R    +   G+ +   EIE  L  H  ++   +V V  D       
Sbjct: 415 LAKWLPDGNIEFIGRIDHQVKIRGFRIELGEIESRLEMHEDIN-ETIVTVREDEESRPYI 473

Query: 463 AFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              I A    ++ DEL  +  E+L  Y  P       +LP+T  GK+ ++ L
Sbjct: 474 CAYITA-NREISLDELKGFLGEKLPEYMIPAYFVKLDKLPLTKNGKVDRKAL 524



 Score =  102 bits (253), Expect = 1e-23
 Identities = 121/533 (22%), Positives = 222/533 (41%), Gaps = 83/533 (15%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L  L     ++ P+R A+   D  + Y  ++  +NQVA  L+ +G+  GD + +      
Sbjct: 1090 LHELFTGQVKHGPDRMALKHHDEVMTYQELDEKSNQVARFLIGKGVEKGDYIGVIGKRSL 1149

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                     LK GA  +PL+                          P+ P   +A+   Q
Sbjct: 1150 GTIVNLLAVLKTGAAYIPLD--------------------------PDYPEERKAY--IQ 1181

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
              + C+ +I               A                 + + DD+A +I+TSG+TG
Sbjct: 1182 SKSNCKFFISHDVYDKEHIERFSKAPV-------------DRKVDLDDMAYVIFTSGSTG 1228

Query: 184  QPKGAQLTHT---------NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
            +PKG Q+TH          N  FN      +   +    D     L ++ +FG       
Sbjct: 1229 KPKGVQITHVPQRNTILDINEKFNVTEQDNIMGISSLCFD-----LSVYDVFG------- 1276

Query: 235  ALYRHGTMVLMPRFDGDEALSL---MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTL 291
            AL    ++V++   D  +  SL    EKE++TI+  VP +     +   D+   +++  L
Sbjct: 1277 ALSSGASLVIID--DQRDVFSLKETAEKERITIWNSVPAIMGMTADVYPDN---ELNHHL 1331

Query: 292  HTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNNPKRKA----KPGSIGL 346
               +  G  +P ++   +K+ F   E++   G +E S + S   P +K     K    G 
Sbjct: 1332 RLILLSGDWIPLQLPATIKKTFKNAEVISLGGATEGS-IWSIYYPIQKVEEDWKSIPYGK 1390

Query: 347  PIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY-HNRPEANAQVMRD---GW-FRTG 401
            P+   ++ ++++N         GE+ + G  V  GY H++ +     ++    G+ ++TG
Sbjct: 1391 PLANQKIYVLNQNKQLCPVGVEGELYIGGAGVASGYIHDQEKTEHSFIQHQELGYIYKTG 1450

Query: 402  DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEI 461
            D     E+G+   + R    +   GY V   EIE  L++H +++ A+V+        + +
Sbjct: 1451 DYGVLKEDGYVEFLGRKDSQVKIRGYRVEMGEIENTLVSHQEITKASVIDYTSPDGIKNL 1510

Query: 462  KAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             AFV+ AE A +++ ++  + ++ L  Y  P       E+P+T  GK+ KR L
Sbjct: 1511 YAFVV-AENA-ISQLDVKEFLQKTLPDYMIPAKFVQIEEIPLTVNGKVDKRTL 1561


>ACSA_LARHH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 653

 Score =  140 bits (352), Expect = 3e-35
 Identities = 137/505 (27%), Positives = 217/505 (42%), Gaps = 31/505 (6%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           Q AN L S G+  GD+V +  P VP          + GA+   +    +   +   ++D+
Sbjct: 124 QFANGLKSLGVGKGDRVVIYMPMVPQAIVAMQACARIGAIHSVVFGGFSAGALRDRIQDA 183

Query: 99  GAKALF----AFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETF-WA 153
            AK +     +  G   +PL     +A   +  C+    +       T    GA    W 
Sbjct: 184 AAKVVITANESVRGGKLVPLKATVDEALA-MDGCDSIEKVVVLQRTYTPCSMGARDITWD 242

Query: 154 ALN-GQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA-LFDQAPD 211
           AL  GQP E E      +D   I+YTSG+TG+PKG Q +    L  A  S    FD  P+
Sbjct: 243 ALTAGQPLECEPEWMSAEDPLFILYTSGSTGKPKGIQHSSAGYLLGAANSFRWAFDYKPN 302

Query: 212 SHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAG 267
             D++     +  I G + +    L    T V+   +P + D      ++E+ KV IF  
Sbjct: 303 --DIYWCTADVGWITGHSYICYGPLAMGATQVVFEGIPTYPDAGRFWRMIEQHKVNIFYT 360

Query: 268 VPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLS 324
            PT    L+    D   +    +L    + G  +  E      E  G     I++ +  +
Sbjct: 361 APTAIRSLIKLGADLPKQFDLSSLRVLGTVGEPINPEAWMWYYEVVGGGRCPIVDTWWQT 420

Query: 325 ETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH--CVMKG 381
           ET   +    P   A KPGS  LP+ G+   +VDE+   +E    G + ++     +++ 
Sbjct: 421 ETGSAMIAPMPGAVATKPGSCTLPLPGIMADIVDESGAQVEPGRGGFLVIKKPFPSLVRT 480

Query: 382 YHNRPEANAQV-----MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEE 436
             N P+   +          ++  GD A RDE G+++I+ R  D++   G+ +   EIE 
Sbjct: 481 IWNDPDRFKKTYFPEEFNGQYYLAGDSANRDESGYFWIMGRIDDVLNVSGHRLGTMEIES 540

Query: 437 VLMTHPQVSLAAVVGVPHDTHGEEIKAFVI------PAEGATLTEDELIAWAKERLAAYK 490
            L+ +P V+ AAVVG PHD  GE + AFV+        + A     EL +W    +    
Sbjct: 541 ALVANPLVAEAAVVGKPHDVKGEAVVAFVVLKGIRPEGDEAKKVAAELKSWVAHEIGKIA 600

Query: 491 YPRIVEFRTELPMTATGKILKRELR 515
            P  + F   LP T +GKI++R LR
Sbjct: 601 QPDDIRFGENLPKTRSGKIMRRLLR 625


>ACSA_SHESW RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (351), Expect = 4e-35
 Identities = 139/531 (26%), Positives = 223/531 (41%), Gaps = 44/531 (8%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++  +         + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A    +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGGRAIPLKRNIDDALNHPDVTS 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E       G +D   ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKI-DWVEGRDVWWHSLLETASEHCQPEEMGAEDPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD    + +V+     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYK--AGEVYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV I    PT+   L+     H  +    TL    S G  +
Sbjct: 331 EGVPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQHFDQFDGSTLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 E----------NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRD 407
                               PG++       + G H R          G + TGD ARRD
Sbjct: 451 NMXXXXXXXXXXXXXXXDSWPGQMRT-----VYGDHERFVLTYFKTFRGMYFTGDGARRD 505

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
           E+G+Y+I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V  
Sbjct: 506 EDGYYWITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTL 565

Query: 468 AEGA---TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             G             W ++ + A   P ++++ + LP T +GKI++R LR
Sbjct: 566 TRGTXXXXXXXXXXXXWVRKEIGALATPDLIQWASGLPKTRSGKIMRRFLR 616


>ACSA_SHEPC RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (351), Expect = 4e-35
 Identities = 139/531 (26%), Positives = 223/531 (41%), Gaps = 44/531 (8%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++  +         + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A    +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGGRAIPLKRNIDDALNHPDVTS 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E       G +D   ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKI-DWVEGRDVWWHSLLETASEHCQPEEMGAEDPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD    + +V+     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYK--AGEVYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV I    PT+   L+     H  +    TL    S G  +
Sbjct: 331 EGVPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQHFDQFDGSTLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 E----------NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRD 407
                               PG++       + G H R          G + TGD ARRD
Sbjct: 451 NMXXXXXXXXXXXXXXXDSWPGQMRT-----VYGDHERFVLTYFKTFRGMYFTGDGARRD 505

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
           E+G+Y+I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V  
Sbjct: 506 EDGYYWITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVTL 565

Query: 468 AEGA---TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             G             W ++ + A   P ++++ + LP T +GKI++R LR
Sbjct: 566 TRGTXXXXXXXXXXXXWVRKEIGALATPDLIQWASGLPKTRSGKIMRRFLR 616


>ACSA_PHOPR RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  139 bits (351), Expect = 4e-35
 Identities = 135/499 (27%), Positives = 214/499 (42%), Gaps = 27/499 (5%)

Query: 41  ANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGA 100
           +N L S+G+R GD V L  P V           + GAV   +    +P  +   + DS A
Sbjct: 121 SNALKSQGVRKGDVVCLYMPMVAEAAIAMLACTRIGAVHTIVFGGFSPEALAGRIVDSNA 180

Query: 101 KALFA----FTGTPELPLGERAWQAF--QEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
           K +            +PL +    A   + V   E  I L    G           +  A
Sbjct: 181 KLVITADEGVRAGRAVPLKKNVDDALANKNVTSIEKVIVLKRTGGNVEWHSERDVWWHEA 240

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSH 213
                   E      +D   I+YTSG+TG+PKG    T   L++  +    +FD      
Sbjct: 241 TAVASSHCEPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDY--QEG 298

Query: 214 DVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVP 269
           DV+     +  I G + ++   L    T VL   +P +     +S +++K  V+I    P
Sbjct: 299 DVYWCTADVGWITGHSYLVYGPLANGATTVLFEGVPNYPSTSRMSEVVDKHNVSILYTAP 358

Query: 270 TMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSE 325
           T    L+ A+G   IK  S++ L    S G  +  E         G     I++ +  +E
Sbjct: 359 TAIRALM-AKGTEAIKGTSRSSLRIMGSVGEPINPEAWEWYHHTIGDSRCPIVDTWWQTE 417

Query: 326 TSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VM 379
           T  ++    P   A KPGS   P +GV+  +VD   N +EG   G + +          +
Sbjct: 418 TGGILITPLPGATALKPGSATRPFFGVQPAIVDNMGNILEGVAEGNLVMVDSWPGQMRTL 477

Query: 380 KGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLM 439
            G H R E        G + TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+
Sbjct: 478 WGDHERFEQTYFSTFQGMYFTGDGARRDEDGYYWITGRVDDVLNISGHRMGTAEIESALV 537

Query: 440 THPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVE 496
              +++ AA+VGVPHD  G+ I A++   +G   + +   E+  W ++ +     P  + 
Sbjct: 538 AFDKIAEAAIVGVPHDIKGQAIYAYITLNDGEIPSAELHKEVKDWVRKEIGPIATPDFLH 597

Query: 497 FRTELPMTATGKILKRELR 515
           +   LP T +GKI++R LR
Sbjct: 598 WTDALPKTRSGKIMRRILR 616


>VIBE_VIBCH RecName: Full=Vibriobactin-specific
           2,3-dihydroxybenzoate-AMP ligase;       
           EC=6.3.2.-;AltName: Full=Dihydroxybenzoic
           acid-activating enzyme;
          Length = 543

 Score =  139 bits (350), Expect = 5e-35
 Identities = 135/518 (26%), Positives = 222/518 (42%), Gaps = 27/518 (5%)

Query: 8   LEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           L+  A   P   A+V  + +  Y  +     Q+A      G+  GD V L   NV  F  
Sbjct: 31  LQQSAERTPNALALVGDNQQWRYQAMLERIEQLAAGFTELGLGCGDNVVLQLGNVAEFYL 90

Query: 68  VYFGALKAGAVVVPLNVLLTPR--EIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
            +F  L+ G  + P+  L   R  EI Y  + S AKA +   G  + P   +A    QE+
Sbjct: 91  CFFALLRQG--IRPILALPAHRLAEIRYFCQHSQAKA-YLIDGA-QRPFDYQALA--QEL 144

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
             C   +      G T    P    F    +           + + +A    + GTTG P
Sbjct: 145 LACCPTLQTVIVRGQTRVTDP---KFIELASCYSASSCQANADPNQIAFFQLSGGTTGTP 201

Query: 186 KGAQLTHTNLLFNAVASSAL--FDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY-RHGTM 242
           K    TH +  ++  AS  +  FDQ    H  +L VLP  H F  ++     ++   G +
Sbjct: 202 KLIPRTHNDYAYSVTASVEICRFDQ----HTRYLCVLPAAHNFPLSSPGALGVFWAGGCV 257

Query: 243 VLMPRFDGDEALSLMEKEKVTIFAGVP--TMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
           VL        A  L+E+ K+T+ A VP   + W     +  +D+     +LH    GGA 
Sbjct: 258 VLSQDASPQHAFKLIEQHKITVTALVPPLALLWMDHAEKSTYDLS----SLHFVQVGGAK 313

Query: 301 LPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLV-DEN 359
                AR++ +  G ++ + +G++E     +  +   +    + G PI   +  LV DE 
Sbjct: 314 FSEAAARRLPKALGCQLQQVFGMAEGLVNYTRLDDSAELIATTQGRPISAHDQLLVVDEQ 373

Query: 360 FNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRS 418
              +     G +  +G   ++GY+   + N +     G++ TGD  +   EG+  +  R+
Sbjct: 374 GQPVASGEEGYLLTQGPYTIRGYYRADQHNQRAFNAQGFYITGDKVKLSSEGYVIVTGRA 433

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDEL 478
           KD I RGG  +   E+E  L+ HP V  AA++ +  +  GE   A ++     ++   +L
Sbjct: 434 KDQINRGGEKIAAEEVENQLLHHPAVHDAALIAISDEYLGERSCAVIVLKPEQSVNTIQL 493

Query: 479 IAWAKER-LAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +  +  LA YK P  ++F  +LP T+ GKI K  LR
Sbjct: 494 KRFLHQAGLADYKIPDQIQFIDQLPKTSVGKIDKNALR 531


>ACSA_SHEB8 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (350), Expect = 5e-35
 Identities = 137/531 (25%), Positives = 225/531 (42%), Gaps = 44/531 (8%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++  +         + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNIDDALKNPDVTT 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E+ +    + +    ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKV-DWVEGRDVWWHSLMETASEYCQPEEMDAEAPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD    + +V+     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYK--AGEVYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV+I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQHFDKFDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 E----------NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRD 407
                               PG++       + G H R          G + TGD ARRD
Sbjct: 451 NMXXXXXXXXXXXXXXXDSWPGQMRT-----VYGDHERFVLTYFKTFRGMYFTGDGARRD 505

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV-- 465
           E+G+Y+I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V  
Sbjct: 506 EDGYYWITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVXX 565

Query: 466 -IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                           W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 566 XXXXXXXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_SHEB5 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (350), Expect = 5e-35
 Identities = 137/531 (25%), Positives = 225/531 (42%), Gaps = 44/531 (8%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++  +         + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHADVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNIDDALKNPDVTT 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPK 186
            E  I L    G     + G + +W +L     E+ +    + +    ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGKV-DWVEGRDVWWHSLMETASEYCQPEEMDAEAPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD    + +V+     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYK--AGEVYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV+I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQHFDKFDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 E----------NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRD 407
                               PG++       + G H R          G + TGD ARRD
Sbjct: 451 NMXXXXXXXXXXXXXXXDSWPGQMRT-----VYGDHERFVLTYFKTFRGMYFTGDGARRD 505

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV-- 465
           E+G+Y+I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V  
Sbjct: 506 EDGYYWITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVXX 565

Query: 466 -IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                           W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 566 XXXXXXXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_BARBK RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  139 bits (350), Expect = 5e-35
 Identities = 134/521 (25%), Positives = 231/521 (44%), Gaps = 33/521 (6%)

Query: 23  FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           + D ++ Y  +     + AN+L + G++ GD+V++  P +P   +      + GA+   +
Sbjct: 101 YSDKKITYNELYEHVCRFANILKNHGVKKGDRVSIYLPMIPEAAYAMLACARIGAIHSVI 160

Query: 83  NVLLTPREIEYHLRDSGAKALF----AFTGTPELPLGERAWQAFQEVAECELYIDLPAAA 138
               +   I   L D  +  +     A  G   +PL +   +A   +A C+         
Sbjct: 161 FAGFSSEAIAGRLIDGQSTFIITADHALRGDKTIPLKDNVDRAIH-IAACQNVNVTQVMV 219

Query: 139 GATTSAI---PGAETFW--AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTH 192
              TS I        FW    +     +        +D   I+YTSG+TG+PKG    T 
Sbjct: 220 IRRTSKIIHWVNGRDFWYHEEMPHATPDCPPEHMNAEDPLFILYTSGSTGKPKGVLHTTG 279

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRF- 248
             L++ ++    +FD  P   +++     +  I G + ++   L    T ++    P F 
Sbjct: 280 GYLVYASMTHQYVFDYHPG--EIYWCTADIGWITGHSYLVYGPLCNGATTLMFEGSPTFP 337

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVAR 307
           D      +++K KV IF   PT    L+ A GD  +K+  +T L    + G  +  E  +
Sbjct: 338 DEGRFWEIVDKHKVNIFYTAPTAIRALMGA-GDSFVKRSQRTSLRLLGTVGEPINPEAWK 396

Query: 308 KVKEKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTI 363
                 G     IL+ +  +ET   +    P   K K GS   P +G++++LVD   N +
Sbjct: 397 WFYHTVGDSRCPILDTWWQTETGGHIITPLPGATKLKAGSATHPFFGIQVQLVDPQGNIL 456

Query: 364 EGEGPGEIAVRGHCV--MKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRS 418
           +GE  G + +       M+  +N  +   +       G + TGD  +RD++ +Y+I  R 
Sbjct: 457 KGEAEGNLCIVDSWPGQMRTLYNNHQRFVETYFSTYKGKYFTGDGCKRDKDSYYWITGRV 516

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG----ATLT 474
            D++   G+ +   EIE  L++HP VS AAVVG PH   G+ I +FV    G    ATL 
Sbjct: 517 DDILNISGHRLGTAEIESALISHPAVSEAAVVGYPHPIKGQGIYSFVTLMAGTQPSATLH 576

Query: 475 EDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           ++ LI   ++ + +      ++F   LP T +GKI++R LR
Sbjct: 577 QN-LIQHVRQEIGSIATLDKIQFAPHLPKTRSGKIMRRILR 616


>4CLL8_ORYSJ RecName: Full=Putative 4-coumarate--CoA ligase-like 8; 
                  EC=6.2.1.-;
          Length = 609

 Score =  139 bits (350), Expect = 5e-35
 Identities = 116/411 (28%), Positives = 180/411 (43%), Gaps = 65/411 (15%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFD---------QAPDSHD-VFLTV 219
           DD A++ Y+SGTTG+ KG   TH N +  A +    +          Q  D HD  +  V
Sbjct: 186 DDAALLFYSSGTTGRSKGVVSTHGNAIAMAASLERAWXXXXXXXEKPQQYDDHDEAYGCV 245

Query: 220 LPLFHIFGQTTMMNAALYRHGTMVLMP-RFDGDEALSLMEKEKVT-IFAGVPTMYWGLLN 277
           LP+FH+FG ++               P RF  ++ ++ +E+  VT +             
Sbjct: 246 LPMFHMFGFSSFXXXXXXXXXXXXXXPGRFSVEKTMAAVEEYGVTRLLXXXXXXXXXXXX 305

Query: 278 AQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNN-- 334
             GD +           VS GA L  E   + +  F  + + + YGL+ET+ +V+  +  
Sbjct: 306 XXGDGEPSXXXXXXXQVVSSGAPLQREHMARFRSCFPAVNLGQCYGLTETTGIVTMCDLQ 365

Query: 335 ------PKRKAKPGS------------------------------IGLPIWGVEMKLVD- 357
                  K +  P S                              IG  +  VE K+VD 
Sbjct: 366 HNDNGIDKVEMPPSSTDMTFXXXXXXXXXXKERSTXXXXXXXXVSIGRLMPDVEAKIVDP 425

Query: 358 ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMR------------DGWFRTGDIAR 405
           ++   +     GE+ VRG   M+GY N  EA                  + W RTGD+  
Sbjct: 426 DSGELLPPRRTGELWVRGPSTMRGYLNNEEATXXXXXXXXXXXXXXXXXERWLRTGDLCY 485

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
            D  G  +++DR K++I    Y V P E+E+VL THP +  AAV   P    GE   A+V
Sbjct: 486 VDSRGLVYVVDRVKELIKCNAYQVAPAELEDVLATHPDIHDAAVAPYPDKEAGEIPMAYV 545

Query: 466 IPAEGA-TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           +  +G+  L EDE+I++ + ++A YK  R V F   +P + +GKIL+R+L+
Sbjct: 546 VKKQGSGHLQEDEVISFVQNKVAPYKKIRKVVFVDSIPRSPSGKILRRQLK 596


>ACVS_NOCLA RecName:
            Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine
            synthase;         EC=6.3.2.26;AltName:
            Full=Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine
            synthetase;
          Length = 3649

 Score =  139 bits (349), Expect = 7e-35
 Identities = 139/525 (26%), Positives = 216/525 (41%), Gaps = 60/525 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDK-VALACPNVPYF 65
            L E+ A   P+R A+V GD+RL Y  +N  AN++A+ L S      D+ +AL        
Sbjct: 2404 LFEEVAATWPDRVAVVHGDVRLTYRELNERANRLAHHLRSVAEPRADELIALVLDKSELT 2463

Query: 66   PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEV 125
                    KAGA  +P++       I + L D+GAK + A         GE      +  
Sbjct: 2464 LVAILAVWKAGAAYMPIDPSYPDDRIAFMLSDTGAKLVLA---------GEAHGSRVR-- 2512

Query: 126  AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
                         G T+  +   E     L G+P E     T   ++A  IYTSGTTG+P
Sbjct: 2513 -------------GLTSGDVLDLEQL--DLTGEPAENPVTETTSTELAYAIYTSGTTGKP 2557

Query: 186  KGAQLTHTNL-LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL 244
            K   ++H ++  F A  S   F    +S +  L +      F    +  + L  H  +V 
Sbjct: 2558 KAVLVSHGSVDSFRAQLSGRYFGSPDESAEAVLFLANYVFDFSVEQLALSVLGGHKLLVP 2617

Query: 245  MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPA 303
             P    D A   L  +E ++  +G PT            D+ ++S      V+G A  P 
Sbjct: 2618 PPSAADDPAFYELANREGLSYLSGTPTQV-------ERFDLARLSHLRCVLVAGEAFQPQ 2670

Query: 304  EVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPG-----SIGLPIWGVEMKLVDE 358
                K++ +F   IL  YG +ET    +  N   + +PG     ++G P+    + ++ +
Sbjct: 2671 HF-EKMRGEFAGPILNAYGTTET----TVYNTVHRFEPGDAYRNTLGAPLGNTRLYVLGD 2725

Query: 359  NFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWF----RTGDIARRD 407
                +     GE+ + G CV +GY +RPE        N      G F    RTGD+ RR 
Sbjct: 2726 GMKLLPTGAVGELYLAGDCVTEGYLHRPELTRERFLPNPFAAESGRFPMIYRTGDVVRRG 2785

Query: 408  EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV--GVPHDTHGEEIKAFV 465
             +G    + R+   +   G  + P E+E  L     V   AVV    P     + +  + 
Sbjct: 2786 PDGELQYLGRNDAQVKINGLRIEPGEVEAALAGCSGVRQCAVVAGADPQAPERKRLVGYY 2845

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPR-IVEFRTELPMTATGKI 509
            +P  GA + E +L A  + +L     P  +V     LPMT TGK+
Sbjct: 2846 LPEPGAAVDEADLFAALRAQLMPSMVPSLLVRLDRPLPMTITGKL 2890



 Score =  134 bits (338), Expect = 1e-33
 Identities = 142/539 (26%), Positives = 226/539 (41%), Gaps = 60/539 (11%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIR--PGDKVALACPN 61
           L+ L ED  R  P+R+A+V GD+RL Y  VN  ANQ A+ L+   +R  PG  + L    
Sbjct: 252 LNELFEDVVRRAPDREAVVCGDVRLTYREVNERANQFAHWLIQGPVRVRPGALIGLYLDK 311

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
                   FG  K+GA  VP++       I + + D+G   +             R  + 
Sbjct: 312 SDLGVVATFGIWKSGAAYVPIDPAYPAERIRFLVGDTGLSGIVT---------NRRHAER 362

Query: 122 FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGT 181
            +EV   E +  +         A P  E        Q  E   +     D A + YTSGT
Sbjct: 363 LREVLGDE-HASVHVIEVEAVVAGPHPE--------QARENPGLALSSRDRAYVTYTSGT 413

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFD-QAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHG 240
           TG PKG    H +++ +    S  +D + P +  V L    +F    + T++  AL    
Sbjct: 414 TGVPKGVPKYHYSVVNSITDLSERYDMRRPGTERVALFASYVFEPHLRQTLI--ALINEQ 471

Query: 241 TMVLMP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGD----HDIKQISQTLHT 293
           T+V++P   R D D     +E+  VT            LNA G      D+++ + +L  
Sbjct: 472 TLVIVPDDVRLDPDLFPEYIERHGVTY-----------LNATGSVLQHFDLRRCA-SLKR 519

Query: 294 AVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS---FNNPKRKAKPGSIGLPIWG 350
            +  G  L A   R+++EKF   ++  Y  +E + V +   F     + +  SIG P+  
Sbjct: 520 LLLVGEELTASGLRQLREKFAGRVVNEYAFTEAAFVTAVKEFGPGVTERRDRSIGRPLRN 579

Query: 351 VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM--------------RDG 396
           V+  ++ +    +     GE+ + G  V  GY NR +  A+                R+G
Sbjct: 580 VKWYVLSQGLKQLPIGAIGELYIGGCGVAPGYLNRDDLTAERFTANPFQTEEEKARGRNG 639

Query: 397 -WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHD 455
             +RTGD+AR    G    + R+   +   G  V P EIE      P V    VV   + 
Sbjct: 640 RLYRTGDLARVLLNGEVEFMGRADFQLKLNGVRVEPGEIEAQATEFPGVKKCVVVAKENA 699

Query: 456 THGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           T    +  + +  +GA + E +LIA+ ++RL     P  +   T +P+   GK+  R L
Sbjct: 700 TGDRHLVGYYLVEDGAEVAEADLIAFLEQRLIRIMVPARMVRLTSIPVNVNGKVDWRAL 758



 Score =  105 bits (263), Expect = 7e-25
 Identities = 129/536 (24%), Positives = 206/536 (38%), Gaps = 63/536 (11%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNV 62
            L  + E+ A   P+  A+V+ + RL Y  +N  AN++A+ L S   +RP D VAL     
Sbjct: 1347 LHAVFEEMAERWPDEIAVVYRENRLTYRELNERANRLAHYLRSVVELRPDDLVALVLDKS 1406

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
                     A K GA  VP++       I + L D+ A+                     
Sbjct: 1407 ELMITAIIAAWKTGAAYVPIDSGYPDDRISFMLSDTAARV-------------------- 1446

Query: 123  QEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
              V   E++ D   +   T +  P  E     L+ QP       T   D+A  IYTSGTT
Sbjct: 1447 --VVTNEIHSDRLRSLAETGT--PVLEIELLHLDDQPAVNPVTETTSTDLAYAIYTSGTT 1502

Query: 183  GQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
            G+PK   + H  ++   V+ + LF       D  L     +        M  AL     +
Sbjct: 1503 GKPKAVLVEHRGVVNLQVSLAKLFGLDKAHRDEALLSFSNYIFDHFVEQMTDALLNGQKL 1562

Query: 243  VLMP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            V++    R D       M  E+VT  +G P++   L +      + +I          G 
Sbjct: 1563 VVLDDSMRTDPGRLCRYMNDEQVTYLSGTPSVL-SLYDYSSATSLTRIDAI-------GE 1614

Query: 300  SLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPG------SIGLPIWGVEM 353
                 V  K++  F   I+ GYG +E    +S  + KR   P       SIG P+   + 
Sbjct: 1615 DFTEPVFAKIRGTFPGLIINGYGPTE----ISITSHKRPYPPDVHRVNKSIGFPVANTKC 1670

Query: 354  KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNR-----------PEANAQVMRDG----WF 398
             ++++    +              V +GY NR           P   A+  R G     +
Sbjct: 1671 HVLNKAMKPVPVXXXXXXXXXXXXVTRGYLNREDLTADRFVENPFQTAEERRLGENGRLY 1730

Query: 399  RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            +TGD+ R    G    + R+   +   G  V   E+E  L ++P V  + VV   H    
Sbjct: 1731 KTGDLVRWLPNGEVEYLGRTDLQVKIRGQRVELGEVEAALSSYPGVVRSLVVAREHAVGQ 1790

Query: 459  EEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            + +  F +  +     E +L  W +++L     P  V   T++P+T +GK+  R L
Sbjct: 1791 KYLVGFYVGEQ--EFDEQDLKQWMRKKLPESVVPARVLRITDIPVTPSGKLDARRL 1844


>ACSA_VIBPA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (349), Expect = 7e-35
 Identities = 138/524 (26%), Positives = 229/524 (43%), Gaps = 44/524 (8%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  L +  ++    + +N L  +G+R GD V L  P VP          + GAV   +  
Sbjct: 105 DKTLTFNELHKEVCKFSNALKDQGVRKGDVVCLYMPMVPEAAIAMLACTRIGAVHTVVFG 164

Query: 85  LLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAECELYIDLPAAA 138
             +P  +   + DS AK +        G   +PL +   +A    EV      + L    
Sbjct: 165 GFSPEALSGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVLKRTG 224

Query: 139 GATTSAIPGAETFWAALNGQPGEF---ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTN 194
           G         + +W     +  +    E ++ E  D   I+YTSG+TG+PKG    T   
Sbjct: 225 G-NVDWHGHRDVWWHEATAKVSDVCPPEEMKAE--DPLFILYTSGSTGKPKGVLHTTGGY 281

Query: 195 LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGD 251
           L++ A+    +FD  P   + F     +  I G T ++   L      +L   +P +   
Sbjct: 282 LVYAAMTFKYVFDYQPG--ETFWCTADVGWITGHTYLIYGPLANGAKTILFEGVPNYPNT 339

Query: 252 EALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVARKV 309
             +S +++K +V I    PT    L+ A+G+  +   S++ L    S G  +  E     
Sbjct: 340 SRMSEVVDKHQVNILYTAPTAIRALM-AKGNEAVAGTSRSSLRIMGSVGEPINPEAWEWY 398

Query: 310 KEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIE- 364
            +  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N +E 
Sbjct: 399 YKTIGNENSPIVDTWWQTETGGILIAPLPGATDLKPGSATRPFFGVQPALVDNMGNILED 458

Query: 365 --GEG--------PGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFI 414
              EG        PG++       + G H R E        G + T D ARRDE+G+Y+I
Sbjct: 459 TVAEGNLVILDSWPGQMRT-----VYGDHERFEQTYFSTFKGMYFTSDGARRDEDGYYWI 513

Query: 415 IDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG---A 471
             R  D++   G+ +   EIE  L+ H +++ AA+VG+PHD  G+ I A++   +G   +
Sbjct: 514 TGRVDDVLNVSGHRMGTAEIESALVAHHKIAEAAIVGIPHDIKGQAIYAYITLNDGEFPS 573

Query: 472 TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                E+  W ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 574 AELHKEVKDWVRKEIGPIATPDVLHWTDSLPKTRSGKIMRRILR 617


>ACSA_SHEHH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  139 bits (349), Expect = 7e-35
 Identities = 131/512 (25%), Positives = 221/512 (43%), Gaps = 27/512 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++    + AN L S+G+R GD V +  P VP          + GA+   +    +
Sbjct: 108 LTYGQLHTQVCKFANALRSQGVRRGDVVTIYMPMVPEAAVAMLACARIGAIHSVVFGGFS 167

Query: 88  PREIEYHLRDSGAKALF-AFTGTPE---LPLGERAWQAFQEV-AECELYIDLPAAAGATT 142
           P  I   + D  +K +  A  G      +PL     +A       C   + +    G   
Sbjct: 168 PDSIASRVIDGNSKVVITADEGVRAGRIIPLKANIDEALSHPDVNCVEKVIVMKRTGGDI 227

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAV 200
           + + G + +W +L     E       G +D   ++YTSG+TG PKG    T   +++ A+
Sbjct: 228 NWVEGRDIWWDSLMDTASEHCIAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAM 287

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-L 256
               +FD     ++V+     +  I G + M+   L    T+++   +P +     L  +
Sbjct: 288 THEYVFDYK--ENEVYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPSPARLGEM 345

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +++ KV I    PT+   L+ A+G          +L    S G  +  E  R   +  G 
Sbjct: 346 VDRHKVNILYTAPTLIRALM-AEGKEQFAGFDGSSLRIMGSVGEPINPEAWRWYNDVIGH 404

Query: 316 E---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N ++G   G +
Sbjct: 405 EKCPIVDTWWQTETGGILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIVDGASEGNL 464

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H+R          G + TGD A+RDE+G+Y+I  R  D+I   G
Sbjct: 465 VILDSWPGQMRTVFGDHDRFVLTYFKTFRGMYFTGDGAKRDEDGYYWITGRVDDVINVSG 524

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAK 483
           + +   E+E               G PHD  G+ I A+V   +G+  TE+   EL  W +
Sbjct: 525 HRLGTAEVESXXXXXXXXXXXXXXGYPHDIKGQGIYAYVTLTKGSVETEELRQELRQWVR 584

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + + A   P ++++   LP T +GKI++R LR
Sbjct: 585 KEIGALATPDLIQWAGGLPKTRSGKIMRRFLR 616


>GRSB_ANEMI RecName: Full=Gramicidin S synthetase 2;AltName:
            Full=Gramicidin S synthetase II;Includes:  RecName:
            Full=ATP-dependent proline adenylase;
          Length = 4451

 Score =  138 bits (348), Expect = 9e-35
 Identities = 132/524 (25%), Positives = 216/524 (41%), Gaps = 58/524 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+  +  PE  AIV+    L Y  +N+ ANQ+A +L  +G+ P   VA+         
Sbjct: 3594 LFEEQVKKTPEHIAIVWEGQALIYHELNIKANQLARVLREKGVTPNHPVAIMTERSLEMI 3653

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               F  LKAG   VP++       I+Y L DSGA  L                   Q   
Sbjct: 3654 VGIFSILKAGGAYVPIDPAYPQERIQYLLEDSGAALLLT-----------------QSHV 3696

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFES-----VRTEGDDVAVIIYTSGT 181
              +L +D+                 W  L  +    E         +  D+A IIYTSGT
Sbjct: 3697 LNKLPVDIE----------------WLDLTDEQNYVEDGTNLPFMNQSTDLAYIIYTSGT 3740

Query: 182  TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
            TG+PKG  + H +++         ++  P   D  L V   F   G    + A +    T
Sbjct: 3741 TGKPKGVMIEHQSIINCLQWRKEEYEFGPG--DTALQVFS-FAFDGFVASLFAPILAGAT 3797

Query: 242  MVLMPRFDGDEALS---LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             VL    +  + ++   L+  E++T + GVP+++  +L+     D+    Q L     GG
Sbjct: 3798 SVLPKEEEAKDPVALKKLIASEEITHYYGVPSLFSAILDVSSSKDL----QNLRCVTLGG 3853

Query: 299  ASLPAE-VARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD 357
              LPA+                 YG +E S V +     +  +  +IG P+  V++ +V+
Sbjct: 3854 EKLPAQXXXXXXXXXXXXXXXXXYGPTENSVVTTIMRDIQVEQEITIGRPLSNVDVYIVN 3913

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDEEG 410
             N         GE+ + G  + +GY N+PE  A        V  +  ++TGD+A+   +G
Sbjct: 3914 CNHQLQPVGVVGELCIGGQGLARGYLNKPELTADKFVVNPFVPGERMYKTGDLAKWRSDG 3973

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R  + +   GY +   EIE  ++ + ++   AVV V   T  E++    I  E 
Sbjct: 3974 MIEYVGRVDEQVKVRGYRIELGEIESAILEYEKIK-EAVVMVSEHTASEQMLCAYIVGEE 4032

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              LT D L ++  + L +Y  P        +P+T  GK+ ++ L
Sbjct: 4033 DVLTLD-LRSYLAKLLPSYMIPNYFIQLDSIPLTPNGKVDRKAL 4075



 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/529 (23%), Positives = 224/529 (42%), Gaps = 57/529 (10%)

Query: 1    MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACP 60
            M  +  L E+     P+  A+ + D  L Y  +N  ANQVA +L  +G++P + V L   
Sbjct: 1505 MQTIQGLFEEQVEKTPDHVAVGWKDQTLTYRELNERANQVARVLRQKGVQPDNIVGLLVE 1564

Query: 61   NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
              P       G LKAG   +PL+       I Y ++D G + +            +    
Sbjct: 1565 RSPEMLVGIMGILKAGGAYLPLDPEYPADRISYMIQDCGVRIMLT---------QQHLLS 1615

Query: 121  AFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
               +  +C +  +     G +++  P                     +  D+A I+YTSG
Sbjct: 1616 LVHDEFDCVILDEDSLYKGDSSNLAPV-------------------NQAGDLAYIMYTSG 1656

Query: 181  TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP-----LFHIFGQTTMMNAA 235
            +TG+PKG  + H N++   +  +  + Q  +   +  T         F +FG + +  A 
Sbjct: 1657 STGKPKGVMVEHRNVI--RLVKNTNYVQVREDDRIIQTGAIGFDALTFEVFG-SLLHGAE 1713

Query: 236  LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            LY     VL+   D ++    ++  ++TI      ++  L  +QG    +++   L + +
Sbjct: 1714 LYPVTKDVLL---DAEKLHKFLQANQITIMWLTSPLFNQL--SQGT---EEMFAGLRSLI 1765

Query: 296  SGGASLPAEVARKVKEKF-GIEILEGYGLSE-TSPVVSFNNPKRKAKPGSIGLPIWGVEM 353
             GG +L  +    VK K   + +  GYG +E T+    F   K       IG  I    +
Sbjct: 1766 VGGDALSPKHINNVKRKCPNLTMWNGYGPTENTTFSTCFLIDKEYDDNIPIGKAISNSTV 1825

Query: 354  KLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEA-------NAQVMRDGWFRTGDIAR 405
             ++D  +  ++  G PGE+ V G  V +GY N+P         N     +  +RTGD+AR
Sbjct: 1826 YIMDR-YGQLQPVGVPGELCVGGDGVARGYMNQPALTEEKFVPNPFAPGERMYRTGDLAR 1884

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
               +G    + R    +   GY + P EIE +L+ H +V  + ++ V  +   + + A+ 
Sbjct: 1885 WLPDGTIEYLGRIDQQVKIRGYRIEPGEIETLLVKHKKVKESVIMVVEDNNGQKALCAYY 1944

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +P E  T++  EL  +  + L  Y  P       ++P+T  GK+ +  L
Sbjct: 1945 VPEEEVTVS--ELREYIAKELPVYMVPAYFVQIEQMPLTQNGKVNRSAL 1991



 Score =  102 bits (254), Expect = 7e-24
 Identities = 126/535 (23%), Positives = 211/535 (39%), Gaps = 71/535 (13%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+     P+  A++    +L+Y  +N  ANQ+A +L  +G++P   V +         
Sbjct: 2547 LFEEQVEKTPDHIAVIDEREKLSYQELNAKANQLARVLRQKGVQPNSMVGIMVDRSLDMI 2606

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL---------FAFTGTPELPLGER 117
                G LKAG   VP+++      I Y + DSGA             AF+G         
Sbjct: 2607 VGMLGVLKAGGAYVPIDIDYPQERISYMMEDSGAAXXXXXXXXXXXIAFSGDI------- 2659

Query: 118  AWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIY 177
                        LY+D               +  W  L+ +    E +      +A IIY
Sbjct: 2660 ------------LYLD---------------QEEW--LHEEASNLEPI-ARPHYIAYIIY 2689

Query: 178  TSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM--MNAA 235
            TSGTTG+PKG  + H + +  A+A    +    D+  V L  +  F      +      A
Sbjct: 2690 TSGTTGKPKGVMIEHQSYVNVAMAWKDAY--RLDTFPVRLLQMASFAFAFDVSAGDFARA 2747

Query: 236  LYRHGTMVLMP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLH 292
            L   G +++ P   + D     ++++K  +TIF   P +   L+    +  +  ISQ L 
Sbjct: 2748 LLTGGQLIVCPNEVKMDPASLYAIIKKYDITIFEATPALVIPLMEYIYEQKL-DISQ-LQ 2805

Query: 293  TAVSGGASLPAEVARKVKEKFG--IEILEGYGLSETSPVVSFNNPKRKAKPGS----IGL 346
              + G  S   E  + +  +FG  I I+  YG++E     S+      +   +    IG 
Sbjct: 2806 ILIVGSDSCSMEDFKTLVSRFGSTIRIVNSYGVTEACIDSSYYEQPLSSLHVTGTVPIGK 2865

Query: 347  PIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFR 399
            P   ++M ++++          GE+ + G  V +GY NRP+  A+       V  +  +R
Sbjct: 2866 PYANMKMYIMNQYLQIQPVGVIGELCIGGAGVARGYLNRPDLTAEKFVPNPFVPGEKLYR 2925

Query: 400  TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
            TGD+AR   +G    + R+   +               L  H  +  A V+        +
Sbjct: 2926 TGDLARWMPDGNVEFLGRNDHQVKXXXXXXXXXXXXAQLRKHDSIKEATVIAREDHMKEK 2985

Query: 460  EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             + A+++  EG     +     A +R A    P        +P+TA GKI KR L
Sbjct: 2986 YLCAYMV-TEGEVNVAELRAYLANDRAA--MIPSYFVSLEAMPLTANGKIDKRSL 3037



 Score = 96.7 bits (239), Expect = 4e-22
 Identities = 116/528 (21%), Positives = 209/528 (39%), Gaps = 64/528 (12%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L  +     PE  A+VF D ++ Y  ++  +NQ+A  L  +G++    + +         
Sbjct: 473 LFTEQVEKTPEHVAVVFEDEKVTYRELHERSNQLARFLREKGVKKESIIGIMMERSVEMI 532

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G LKAG   VP++       I Y L             +  L L +R  +      
Sbjct: 533 VGILGILKAGGAFVPIDPEYPKERIGYML------------DSVRLVLTQRHLKDKFAFT 580

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
           +  + I+ P+ +   T  I                      E +D+  IIYTSGTTG+PK
Sbjct: 581 KETIVIEDPSISHELTEEI------------------DYINESEDLFYIIYTSGTTGKPK 622

Query: 187 GAQLTHTNLL---------FNAVASSALFDQAPDSHDV-FLTVLPLFHIFGQTTMMNAAL 236
           G  L H N++          N   S  +      S DV +  +       GQ  ++    
Sbjct: 623 GVMLEHKNIVNLLHFTFEKTNINFSDKVLQYTTCSFDVCYQEIFSTLLSGGQLYLIRKET 682

Query: 237 YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
            R          D ++   L+++E + + +  P  +   +  + +   +  +   H   +
Sbjct: 683 QR----------DVEQLFDLVKRENIEVLS-FPVAFLKFIFNEREFINRFPTCVKHIITA 731

Query: 297 GGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN-NPKRK-AKPGSIGLPIWGVEMK 354
           G   +     ++   +  + +   YG SET  V ++  NP+ +  +   IG PI    + 
Sbjct: 732 GEQLVVNNEFKRYLHEHNVHLHNHYGPSETHVVTTYTINPEAEIPELPPIGKPISNTWIY 791

Query: 355 LVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVM-------RDGWFRTGDIARR 406
           ++D+    ++ +G  GE+ + G  V +GY N  E  A+          +  +RTGD+AR 
Sbjct: 792 ILDQE-QQLQPQGIVGELYISGANVGRGYLNNQELTAEKFFADPFRPNERMYRTGDLARW 850

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
             +G    + R+   +   G+ +   EIE  L+    V  A V+    D  G+ + A+V+
Sbjct: 851 LPDGNIEFLGRADHQVKIRGHRIELGEIEAQLLNCKGVKEAVVIDKADDKGGKYLCAYVV 910

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                 + + EL  +  + L  Y  P       +LP+T  GKI ++ L
Sbjct: 911 ME--VEVNDSELREYLGKALPDYMIPSFFVPLDQLPLTPNGKIDRKSL 956


>ACSA_METFK RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  138 bits (348), Expect = 9e-35
 Identities = 139/534 (26%), Positives = 232/534 (43%), Gaps = 36/534 (6%)

Query: 15  RPERDAIVF----GDM-RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVY 69
           R  + A++F    GD+  + Y  ++    + AN L  +G+  GD+V +  P         
Sbjct: 95  RANKIALIFEADNGDVANITYRELHQRVCRFANALKKQGVGLGDRVIIYLPMSIEAIVAM 154

Query: 70  FGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEV 125
               + GA+   +    + + +   + D GAK +        G  ++ L     +A  E+
Sbjct: 155 QACARIGAIHSVVFGGFSAKSLHERIVDVGAKLVITADAGIRGGKQVALKASVDEAL-EL 213

Query: 126 AECELY--IDLPAAAGATTSAIPGAETFWAALNGQPGE-FESVRTEGDDVAVIIYTSGTT 182
             CE    + +    G   +  P  + +W  +     +  E V  + +    I+YTSG+T
Sbjct: 214 GGCESVEKVIVYQRTGVDIAWNPHRDAWWHEVEAAENDNCEPVWVDAEHPLFILYTSGST 273

Query: 183 GQPKGAQLTHTNLLFNAVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGT 241
           G PKG Q +    L  A+ S   +FD    + D+F     +  I G + +    L    T
Sbjct: 274 GTPKGVQHSTGGYLLGAIMSMKWVFDHK--ATDIFWCTADVGWITGHSYVAYGPLALGST 331

Query: 242 MVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
            V+   +P + D      ++E+ KV+IF   PT    L+   GD   K    +L    + 
Sbjct: 332 QVVFEGVPTYPDAGRFWQMIERHKVSIFYTAPTAIRSLIKLGGDLPHKYDLSSLRLLGTV 391

Query: 298 GASLPAEVAR---KVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEM 353
           G  +  E      KV  K    I + +  +ET   +    P     KPGS   P+ G+ M
Sbjct: 392 GEPINPEAWMWYYKVVGKERCPIADTWWQTETGAHMIAPLPGAIDLKPGSCTRPLPGIIM 451

Query: 354 KLVDENFNTIEGEGPGEIAVRGH--CVMKGYHNRPEANAQVM----RDGWFRTGDIARRD 407
            +V+E+   IEG G G + V+     +++     PE   +       +G +  GD A RD
Sbjct: 452 DIVEEDGTHIEGTGGGLLVVKKPWPSMIRNIWGNPERFRKAYFPEELNGLYLAGDSAHRD 511

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI- 466
           E+G+++I+ R  D++   G+ +   EIE  L+ +P V+ AA+VG PHD  GE I A+V+ 
Sbjct: 512 EDGYFWIMGRIDDVLNVSGHRLGTMEIESALVANPLVAEAAIVGKPHDIKGESIVAYVVL 571

Query: 467 -----PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                  E A     +L  W  + +     P  + F   LP T +GKI++R LR
Sbjct: 572 KGERPEGEAAKTIAGQLREWVGKEIGPIAKPDEIRFGENLPKTRSGKIMRRLLR 625


>ACSA_MARMS RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  138 bits (348), Expect = 9e-35
 Identities = 139/527 (26%), Positives = 230/527 (43%), Gaps = 53/527 (10%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++    ++ANLL  +G++ GD+VA+  P +P   +      + GA+   +    +
Sbjct: 108 ITYQTLHDEVGRLANLLKRQGVKKGDRVAIYMPMIPQAVYAMLACARIGAIHSVIFGGFS 167

Query: 88  PREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA------- 140
              I   L D   K +           G RA          ++ +D  A           
Sbjct: 168 AHAIADRLNDCEVKLVITADE------GRRAGNTIPLKHNVDMALDNNACPTVENVIVYR 221

Query: 141 -TTSAIP---GAETFWAA-LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN- 194
            T   +P   G +  WA  +  +  E  + R   +D   I+YTSG+TG+PKG  + HT  
Sbjct: 222 YTEKDVPWFEGRDLDWAVEVENESTECPAERMNAEDPLFILYTSGSTGKPKG--VVHTTG 279

Query: 195 --LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF- 248
             L++ ++    +FD  PD  DV+     +  I G + M+   L    T +L   +P + 
Sbjct: 280 GYLVYASLTHELVFDLKPD--DVYWCAADVGWITGHSYMVYGPLANGTTSILFEGVPTYP 337

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVAR 307
           D      +++K  VTI    PT    L+ A+GD   +   + +L    S G  +  E   
Sbjct: 338 DSGRIGRVVDKFDVTILYTAPTAIRALM-AKGDEATRSSKRDSLRVLGSVGEPINPEAWS 396

Query: 308 KVKEKFG---IEILEGYGLSETSPVVSFNN-PKRKAKPGSIGLPIWGVEMKLVDENFNTI 363
               + G     I++ +  +ET  ++      +   KPGS   P++GV+  LVD      
Sbjct: 397 WYYSEIGNSSCPIVDTWWQTETGGMMMTPRIVQGDVKPGSCTGPLYGVQPALVDAQGVLQ 456

Query: 364 EGEGPGEIAVRGHCVMK-----------GYHNRPEANAQVMRDGWFRTGDIARRDEEGFY 412
           E +G   + V G  V+            G H R E       DG + TGD A RD +G Y
Sbjct: 457 EEQG---VLVEGGLVITDSWPGQARTVYGDHERFEQTYFSTFDGMYFTGDGASRDADGHY 513

Query: 413 FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT 472
           +I  R  D++   G+ +   EIE  L+ HP V+ AA+VG PHD  G+ I  +V    G  
Sbjct: 514 WITGRMDDVLNVSGHRLGTAEIESALVAHPSVAEAAIVGFPHDIKGQGIYVYVSAIAGVI 573

Query: 473 LTED---ELIAWAKERLAAYKYPRIVEFRTE-LPMTATGKILKRELR 515
             E+    L  + ++ +     P ++++ ++ LP T +GKI++R LR
Sbjct: 574 PDEELTKSLKLFVRQEIGPIATPDLIQWTSKGLPKTRSGKIMRRILR 620


>ACSA_LEPBL RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  138 bits (348), Expect = 9e-35
 Identities = 135/521 (25%), Positives = 228/521 (43%), Gaps = 40/521 (7%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  V    N+ AN+L   G++ GD+V +  P +P          + GA+   +    +
Sbjct: 107 LTYYDVYREVNRFANVLKKYGVKKGDRVLVYLPMIPELAITILACTRIGAIHSVVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  ++  + D   K +      F G   + L      A ++  E    + +    G  + 
Sbjct: 167 PEALQSRIDDCKPKLIVTADGGFRGGKPIELKRNVDIALEKSKEDVKTVIVVRRTGNESG 226

Query: 144 AI--PGAETFWAALNGQPGEFESVRTEG---DDVAVIIYTSGTTGQPKGA------QLTH 192
            +   G + ++  L   P      + E    +D   I+YTSG+TG+PKG        L  
Sbjct: 227 LVWKDGRDYWYHFLISDPDLSPYCKPESMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLG 286

Query: 193 TNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF- 248
            NL F+ V     FD  P+  D +     +  + G + ++   L    + V+   +P + 
Sbjct: 287 VNLTFHYV-----FDIKPE--DTYWCTADIGWVTGHSYLVYGPLSNGASSVMFEGVPSYP 339

Query: 249 DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR- 307
           D      +++K  V IF   PT    L+     H  K+   +L    S G  +  E    
Sbjct: 340 DAGRFWDVIDKYGVNIFYTAPTAIRALMREGLTHVQKRNLSSLRLLGSVGEPINPEAWEW 399

Query: 308 --KVKEKFGIEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTI- 363
             K+  K    I++ +  +ET  ++    P     KPGS  LP +GV+  LVD +   I 
Sbjct: 400 YFKIIGKEKCPIVDTWWQTETGSIMITALPGAIPQKPGSATLPFFGVQPVLVDNDGKEIN 459

Query: 364 -EGEGPGEIAVRGH--CVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDR 417
            +GE  G + ++     +M+G +   +           G++ TGD ARRD++G+Y+I  R
Sbjct: 460 DKGEVSGNLCIKSPWPSMMRGVYGDSKRFFDTYFSQFKGYYFTGDGARRDKDGYYWITGR 519

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE-- 475
             D+I   G+ +   E+E  L+ +  V+ AAVVG PHD  G+ I A+V   EG    +  
Sbjct: 520 VDDVINVSGHRIGSAEVESALVENRSVAEAAVVGFPHDIKGQGIYAYVTVKEGIATNDTL 579

Query: 476 -DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             EL+A  ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 580 KKELVAIVEKVIGKIARPDVIHWAPSLPKTRSGKIMRRILR 620


>AAS_SALTI RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (348), Expect = 9e-35
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSAEKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>ACSA_SALTY RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  138 bits (347), Expect = 1e-34
 Identities = 141/546 (25%), Positives = 242/546 (44%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  +   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPG-EFESVRT 167
            +PL +    A +   V   E  I L    G+      G + +W  L  +   E +    
Sbjct: 195 SIPLKKNVDDALKNPNVTSVEHVIVLKRT-GSDIDWQEGRDLWWRDLIEKASPEHQPEAM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A     +FD  P   D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPG--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     +  +++K +V I    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKR- 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAI 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   +  EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH   G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>ACSA_PRB01 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 641

 Score =  138 bits (347), Expect = 1e-34
 Identities = 134/530 (25%), Positives = 231/530 (43%), Gaps = 31/530 (5%)

Query: 14  NRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPF 67
           N P + A+++ GD       L Y  ++    + AN+L   G++ G +V +  P +    F
Sbjct: 83  NDPNKIALIWEGDDPADSKELTYKELHDEVCKFANVLKDLGVQKGSRVCIYMPMIIETAF 142

Query: 68  VYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ 123
                 + GAV   +    +P  ++  + D+  K +        G  ++PL     +A  
Sbjct: 143 AMLACTRIGAVHSVVFGGFSPESLKDRILDADCKIVITADEGLRGGKKVPLKSNVDEALL 202

Query: 124 EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
              + +  + +    G           +   +     +      + +D   I+YTSG+TG
Sbjct: 203 GCPDVKNTLVIKRTGGEINWDDKKDVWYEDLVKDVSNKCAPEPMDSEDPLFILYTSGSTG 262

Query: 184 QPKGAQLTHTNLLFNA-VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTM 242
           +PKG   T    L  A ++   LF   P+  D +     +  I G T ++   L    T 
Sbjct: 263 KPKGVLHTTAGYLLGAHISFKYLFGIRPE--DKYWCTADVGWITGHTYILYGPLSNGATT 320

Query: 243 VL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSG 297
           ++   +P +        + +K  ++IF   PT    L+ AQGD  +K+  + +L    + 
Sbjct: 321 LMFEGVPTYPSASRCWEICDKHDISIFYTAPTAIRALM-AQGDDPVKKTKRDSLRILGTV 379

Query: 298 GASLPAEV---ARKVKEKFGIEILEGYGLSETSPV-VSFNNPKRKAKPGSIGLPIWGVEM 353
           G  +  E       V  K   E+++ +  +ET  V +S        KPGS  LP +GV+ 
Sbjct: 380 GEPINPEAWDWYYSVVGKSNCEVIDTWWQTETGSVLISPIAGITPTKPGSATLPFFGVKP 439

Query: 354 KLVDENFNTIEGEGPGEIAVRGHCVMK-----GYHNRPEANAQVMRDGWFRTGDIARRDE 408
            L DE+ NT+EG   G + +      +     G H R       M    + TGD ARRDE
Sbjct: 440 SLYDEHGNTLEGSNAGNLVIEQSWPSQIRSIYGDHQRMIDTYFGMYKDIYFTGDGARRDE 499

Query: 409 EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
           +G+++I  R  D++   G+ +   EIE  L+ HP+++ AAVVG  H   G+ I AFV   
Sbjct: 500 DGYFWITGRVDDVLNVSGHRLGTAEIESALVLHPKIAEAAVVGFDHPIKGQGIYAFVTLM 559

Query: 469 EGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              +  ++   EL  +  + + A   P +++    LP T +GKI++R LR
Sbjct: 560 INESFDDNFSYELKQFVAKEIGAIAKPDLIQNAPGLPKTRSGKIMRRILR 609


>AAS_SALSV RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALPB RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALHS RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALG2 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALEP RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALA4 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  138 bits (347), Expect = 1e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>ACSA_PASMU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 653

 Score =  137 bits (346), Expect = 2e-34
 Identities = 137/523 (26%), Positives = 227/523 (43%), Gaps = 34/523 (6%)

Query: 23  FGDMRL-NYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVP 81
           FG ++L  YA ++    + AN L   GI+ GD+V +  P +           + GAV   
Sbjct: 106 FGQVQLYTYAKLHNRVCRFANALRELGIKKGDRVIIYLPMLVEAVIAMQACARIGAVHSV 165

Query: 82  LNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAA 137
           +    +   +   + D+ AK +        G   +PL E   +A +   +    + +   
Sbjct: 166 VFGGFSASALRDRIEDAEAKLVITANAGLRGGKIIPLKETVDEALEMGCKTIENVIVFHR 225

Query: 138 AGATTSAIPGAETFWAALNG-QPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLL 196
               T    G + +W  L   QP   E      +D   I+YTSG+TG+PKG   +    L
Sbjct: 226 VNIDTPWKKGRDLWWNELTANQPAFCEPEWMNAEDPLFILYTSGSTGKPKGIVHSTGGYL 285

Query: 197 FNAVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGD 251
             A+ S   +FD  P+  D+F     +  I G + +    L    T V+   +P + D  
Sbjct: 286 LGALNSFRNVFDNKPN--DIFWCTADVGWITGHSYVCYGPLANGATQVIFEGVPTYPDPG 343

Query: 252 EALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR---- 307
               ++++ K+ +F   PT+   L    GDH I          + G    P   +     
Sbjct: 344 RIWRMIQRHKINVFYTSPTLIRSLTRL-GDH-IPNKYDLSSLRLLGSVGEPINPSAWMWF 401

Query: 308 -KVKEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEG 365
            +V  K    I++ +  +ET  ++    P   A KPGS  LP+ G+  +++DEN      
Sbjct: 402 YEVVGKSRCPIVDTWWQTETGSIMLAPIPGVTATKPGSCTLPLPGIMAEVLDENGQKCAV 461

Query: 366 EGPGEIAVRGH--CVMKGYHNRPEANAQVMRDG-----WFRTGDIARRDEEGFYFIIDRS 418
           E  G +A++     +++   N PE              ++  GD A RD++G+++I+ R+
Sbjct: 462 EQGGALAIKRPFPSMLRTIWNDPERYKSTYFPAEYGGKYYIAGDNAHRDKDGYFWILGRT 521

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI------PAEGAT 472
            D++   G+ +   EIE  L+  P+V+ AAVVG P +  GE I AFV+        E A 
Sbjct: 522 DDVLNVSGHRLGTMEIESALVASPKVAEAAVVGKPDEIKGEAIVAFVVLNDFRPEGEEAR 581

Query: 473 LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              +EL AW    +     P  + F   LP T +GKI++R LR
Sbjct: 582 QLAEELKAWVSNEIGKIARPEDIRFADNLPKTRSGKIMRRLLR 624


>AAS_SALPC RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (346), Expect = 2e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSAEKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALCH RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (346), Expect = 2e-34
 Identities = 124/473 (26%), Positives = 207/473 (43%), Gaps = 42/473 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDG 396
            G++ +L+      + G E  G + ++G  +M GY            +   A  +  R G
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-G 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI R DE GF  I  R+K      G  V    +E++ +      + A       +
Sbjct: 592 WYDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSAEKMHATAIKSDAS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 652 KGEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>ACSA_SHEDO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  137 bits (345), Expect = 2e-34
 Identities = 138/519 (26%), Positives = 219/519 (42%), Gaps = 39/519 (7%)

Query: 27  RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLL 86
           +L+Y  ++    Q AN+L ++G+  GD V L  P VP          + GAV   +    
Sbjct: 109 QLSYRELHTQVCQFANVLKAQGVVKGDIVTLYMPMVPEAAVAMLACARIGAVHSVIFGGF 168

Query: 87  TPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVA-ECELYIDLPAAAGAT 141
           +P  I   + D  +K +            +PL     +A    +  C   + +    GA 
Sbjct: 169 SPDSIASRVIDGKSKVIITADEGIRAGRTIPLKHNVDEALARPSVTCVNNVIVLKRTGAN 228

Query: 142 TSAIPGAETFWAALN-GQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNA 199
                G +  W  L  G   +  +     +D   ++YTSG+TG PKG    T   L++ A
Sbjct: 229 VDWQQGRDLDWDELMAGVSSDCPAEEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAA 288

Query: 200 VASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS 255
           +    +FD     ++V+     +  I G + M+    + +G  VLM    P +     L 
Sbjct: 289 MTHEYVFDYK--ENEVYWCTADVGWITGHSYMVYGP-FANGATVLMHEGVPNYPTPARLG 345

Query: 256 -LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            ++++ KV I    PT+   L+    +H      ++L    S G  +  E  R   E  G
Sbjct: 346 EIVDRHKVNILYTAPTLIRALMAEGKEHFNGFSGESLRIMGSVGEPINPEAWRWYHEVIG 405

Query: 315 IE---ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
            E   I++ +  +ET  ++    P   A KPGS   P +GV+  +VD     +EG     
Sbjct: 406 HEHCPIVDTWWQTETGGILISPLPGAIATKPGSATRPFFGVKPAIVDSTGQILEG----- 460

Query: 371 IAVRGHCVMK-----------GYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSK 419
            AV G+ VM            G H R          G + TGD ARRDE+G+Y+I  R  
Sbjct: 461 -AVEGNLVMLDSWPGQMRTVYGDHARFALTYFSTFKGMYFTGDGARRDEDGYYWITGRVD 519

Query: 420 DMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI---PAEGATLTED 476
           D+I   G+ +   E+E               G PHD  G+ I A+V     AE +     
Sbjct: 520 DVINVSGHRLGTAEVESXXXXXXXXXXXXXXGYPHDIKGQGIYAYVTLVHDAEPSEALRQ 579

Query: 477 ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           EL  W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 580 ELRQWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 618


>ACSA_SALTI RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  137 bits (345), Expect = 2e-34
 Identities = 142/546 (26%), Positives = 241/546 (44%), Gaps = 36/546 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+   +   +R AI++ GD       ++Y  ++    + AN L+  GI+ GD 
Sbjct: 75  LNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYRELHRDVCRFANTLLDLGIKKGDV 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           VA+  P VP          + GAV   +    +P  I   + DS ++ +           
Sbjct: 135 VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAIAGRIIDSSSRLVITADEGVRAGR 194

Query: 111 ELPLGERAWQAFQE--VAECELYIDLPAAAGATTSAIPGAETFWAALNGQPG-EFESVRT 167
            +PL +    A +   V   E  I L    G       G + +W  L  +   E +    
Sbjct: 195 SIPLKKNVDDALKNPNVTSVEHVIVLKRT-GNDIDWQEGRDLWWRDLIEKASPEHQPEAM 253

Query: 168 EGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
             +D   I+YTSG+TG+PKG    T   L++ A     +FD  P   D++     +  + 
Sbjct: 254 NAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPG--DIYWCTADVGWVT 311

Query: 227 GQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T ++   +P +     +  +++K +V I    PT    L+ A+GD 
Sbjct: 312 GHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALM-AEGDK 370

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKR- 337
            I+   ++ L    S G  +  E      +K G E   +++ +  +ET   +    P   
Sbjct: 371 AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAI 430

Query: 338 KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQV 392
           + K GS   P +GV+  LVD   +  EG   G + +          + G H R E     
Sbjct: 431 ELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFS 490

Query: 393 MRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV 452
                + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L+ HP+++ AAVVG+
Sbjct: 491 TFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGI 550

Query: 453 PHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           PH   G+ I A+V    G   + +   E+  W ++ +     P ++ +   LP T +GKI
Sbjct: 551 PHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKI 610

Query: 510 LKRELR 515
           ++R LR
Sbjct: 611 MRRILR 616


>ACSA_SACD2 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 645

 Score =  137 bits (345), Expect = 2e-34
 Identities = 137/522 (26%), Positives = 219/522 (41%), Gaps = 43/522 (8%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D  + Y  ++    + AN+L +RG+  GD+V +  P +P   +      + GAV   +  
Sbjct: 104 DASITYQQLHDAVCKFANVLKARGVAKGDRVCIYMPMIPEAAYAMLACARIGAVHSIVFG 163

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAW----QAFQEVAECELYIDLPAAAGA 140
             +P  ++  + DS  K L       E   G RA      A + VA C      P     
Sbjct: 164 GFSPEALKDRIVDSDCKVLIT---ADEGLRGGRAVALKANADKAVAHC------PQVHSV 214

Query: 141 TTSAIPGAETFW---------AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QL 190
                 GA+  W          A        E    + +D   I+YTSG+TG+PKG    
Sbjct: 215 IVVKRTGADVAWNTERDIWLHEAQQSVDTVCEPESMDSEDPLFILYTSGSTGKPKGVLHT 274

Query: 191 THTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPR 247
           T   LL  A+    +FD  P   +V+     +  + G T ++   L    T ++   +P 
Sbjct: 275 TGGYLLQAAMTHKYVFDYQPG--EVYWCTADVGWVTGHTYIVYGPLTNGATTLMFEGVPT 332

Query: 248 FD-GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEV 305
           +        + +K  V IF   PT    L+  QGD  +    + +L    + G  +  E 
Sbjct: 333 YPTAARCWEVCDKHNVNIFYTAPTAIRALMG-QGDEFVASTQRKSLRILGTVGEPINPEA 391

Query: 306 ARKVKEKFG---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFN 361
                   G     I++ +  +ET   +    P     KPGS  LP +GVE  L+D    
Sbjct: 392 WEWYYNVVGDRRCPIMDTWWQTETGGHMLTPLPGAIDLKPGSATLPFFGVEPVLLDXXXX 451

Query: 362 TIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIID 416
                    +A++         + G H+R          G++ TGD ARRD +G+Y+I  
Sbjct: 452 XXXXXXXXSLAIKSSWPGQIRTVYGDHDRLIQTYFSTYPGYYFTGDGARRDADGYYWITG 511

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE- 475
           R  D++   G+ +   E+E  L+ HP+V+ AAVVG PHD  G+ I A+V    G    + 
Sbjct: 512 RVDDVLNVSGHRMGTAEVESALVLHPKVAEAAVVGYPHDVKGQGIYAYVTLMTGVEPDDG 571

Query: 476 --DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              EL+A   + +     P ++++   LP T +GKI++R LR
Sbjct: 572 LRKELVAMCTQEIGPIAKPDLIQWAPGLPKTRSGKIMRRILR 613


>ACSA_RHISN RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  137 bits (345), Expect = 2e-34
 Identities = 129/518 (24%), Positives = 218/518 (42%), Gaps = 31/518 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D R+ Y  +     ++AN+L   G+  GD+V +  P VP   +      + GA+   +  
Sbjct: 103 DKRITYNELYDKVCRLANVLKKHGVEKGDRVTIYMPMVPEAAYAMLACARIGAIHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYIDLPAAA 138
             +P  +   + D   ++ F  T      G   +PL E   +A    A   + ++     
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDEGLRGGKPVPLKENTEKAIDIAARQHVMVNKVLVV 220

Query: 139 GATTSAIPGAETFWAALNGQPGEFES----VRTEGDDVAVIIYTSGTTGQPKGA-QLTHT 193
             T   +P A       + +    E      +   +D   I+YTSG+TG+PKG    T  
Sbjct: 221 RRTGGKVPWAPGRDVWYHQEIATVEPHCPPEKMRAEDPLFILYTSGSTGKPKGVLHTTGG 280

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-D 249
            L++ ++    +FD      D++     +  + G + ++   L    T ++   +P F D
Sbjct: 281 YLVYASMTHQYVFDY--HDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMFEGVPNFPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV 309
                 +++K KV IF   PT    L+ A  D              + G  +  E     
Sbjct: 339 AGRFWEVIDKHKVNIFYTAPTAIRSLMGAGDDFVNXXXXXXXXXXGTVGEPINPEAWEWY 398

Query: 310 KEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEG 365
               G E   I++ +  +ET  ++    P     KPGS   P +GV+ ++VD   N I+G
Sbjct: 399 YHVVGAERSPIVDTWWQTETGGILITPLPGATDLKPGSATRPFFGVKPQIVDNEGNVIDG 458

Query: 366 EGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
              G + +          + G H R          G + TGD  RRDE+G+Y+I  R  D
Sbjct: 459 PADGNLCITDSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDD 518

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---E 477
           ++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V    G   +++   E
Sbjct: 519 VLNVSGHRLGTAEVESALVSHHLVSEAAVVGYPHPIKGQGIYCYVSLMAGEVGSDELRQE 578

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 579 LVKHVRSEIGPIATPDKIQFAPGLPKTRSGKIMRRILR 616


>AAS_SALTY RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (345), Expect = 2e-34
 Identities = 123/472 (26%), Positives = 205/472 (43%), Gaps = 40/472 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGW 397
            G++ +L+      + G E  G + ++G  +M GY              E +      GW
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENSRGETERGW 592

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           + TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + 
Sbjct: 593 YDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 653 GEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALPK RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (345), Expect = 2e-34
 Identities = 122/471 (25%), Positives = 202/471 (42%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAIAAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  T      A+  W   +        V+ + +D
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTL-----ADKLWIFAHLLAPRLAQVKQQPED 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 AAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+      + G E  G + ++G  +M GY            +   A  +  R GW+
Sbjct: 540 MDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-GWY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 654 EALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALPA RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (345), Expect = 2e-34
 Identities = 122/471 (25%), Positives = 202/471 (42%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAIAAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  T      A+  W   +        V+ + +D
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTL-----ADKLWIFAHLLAPRLAQVKQQPED 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 AAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+      + G E  G + ++G  +M GY            +   A  +  R GW+
Sbjct: 540 MDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-GWY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 654 EALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_SALNS RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (345), Expect = 2e-34
 Identities = 123/472 (26%), Positives = 205/472 (43%), Gaps = 40/472 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKAD-------VTPADKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGW 397
            G++ +L+      + G E  G + ++G  +M GY              E +      GW
Sbjct: 538 PGMDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENSRGETERGW 592

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           + TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + 
Sbjct: 593 YDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 653 GEALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_ENT38 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  137 bits (345), Expect = 2e-34
 Identities = 122/470 (25%), Positives = 201/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+  G +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAGISAAVIFGAVSRGRIPAMMNYTAGVKGLTSAITAAEIKTVF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + +D
Sbjct: 313 LDKG-KLWHLPEQLKQVRWVFLEDLKAEVTT-----ADKLWIFAHLLVPHLAQVKQQPED 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    + D F++ LPLFH FG T  
Sbjct: 367 AAMILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--AKDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L+    + L P          L+     T+  G  T           +D  ++   
Sbjct: 425 LFTPLFTGAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGHYARFANPYDFFRVRYV 484

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
               V+G   L        ++KFG+ ILEGYG++E +PVVS N P   A+PG++G  + G
Sbjct: 485 ----VAGAEKLQDSTREIWQDKFGLRILEGYGVTECAPVVSINVP-MAARPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+      + G E  G + ++G  VM GY              E  A  +  GW+ 
Sbjct: 540 MDARLL-----AVPGIEEGGRLQLKGPNVMNGYLRVENPGVLEAPTAENAAGEVETGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE GF  I  R+K      G  V    +E++        + A       + GE
Sbjct: 595 TGDIVRFDEHGFVQIQGRAKRFAKIAGEMVSLEMVEQLANALSPEKMHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F   +E   L  ++L+ +A+E  +     PR + +  +LP+  +GK
Sbjct: 655 ALVLFTTDSE---LKREQLLHYAREHGVPELAVPRDIRYLKQLPVLGSGK 701


>LGRB_BREPA RecName: Full=Linear gramicidin synthetase subunit
            B;Includes:  RecName: Full=ATP-dependent alanine
            adenylase;           Short=AlaA;
          Length = 5162

 Score =  137 bits (344), Expect = 3e-34
 Identities = 138/529 (26%), Positives = 214/529 (40%), Gaps = 62/529 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L  + A   PER A+V G+  L YA +   ANQ AN L  +G+RPG  V L         
Sbjct: 4098 LFRETALLYPERLAVVAGNQTLTYAELERRANQTANYLQQKGVRPGALVGLCVKRSLEML 4157

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGT-PELPLGERAWQAFQEV 125
                G LKAG   VPL+       + Y + D+G   L       P LP GER        
Sbjct: 4158 IGMLGILKAGGAYVPLDPDYPEERLAYMMGDAGITVLLTQEQLMPGLPSGER-------- 4209

Query: 126  AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
                           TT A+   +  W  +  +  +   V T  + +A +IYTSG+TG P
Sbjct: 4210 ---------------TTIAL---DRDWPLIAKESEQAPDVDTTAESLAYVIYTSGSTGLP 4251

Query: 186  KGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL------FHIFGQTTMMNAALYRH 239
            KG  + H  ++     +  +        DVFL    +      F I+G  +++N A    
Sbjct: 4252 KGTLVVHRGIVRLVKETDYV---TITEQDVFLQASTVSFDAATFEIWG--SLLNGA---- 4302

Query: 240  GTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYW--GLLNAQGDHDIKQISQTLHTAVSG 297
              +VL+P     E  SL E  +      V T++   GL     DH  + +S      V G
Sbjct: 4303 -KLVLLP----PELPSLAEIGQAIQSHHVTTLWLTAGLFTLMVDHHKEYLSGVRQLLV-G 4356

Query: 298  GASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPK---RKAKPGSIGLPIWGVEMK 354
            G  +     +K  E  G+ ++ GYG +E +     N        A    IG PI      
Sbjct: 4357 GDIVSVPHVKKALEIAGLTVINGYGPTENTTFTCCNPVTVMPESAHTFPIGRPIKNTTAY 4416

Query: 355  LVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF---------RTGDIAR 405
            ++D +   +     GE+ + G  + +GY NRP+  A+      F         RTGD+ R
Sbjct: 4417 VLDRHMQPVPIGVTGELYIGGDGLAEGYLNRPDLTAERFVPNPFATDQAARLYRTGDLVR 4476

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
               +G    I R  + +   G+ +   E+E VL  HP ++ + V+   ++   +++ A+ 
Sbjct: 4477 YLPDGLIEFIGRLDNQVKIRGFRIELSEVEAVLAKHPAITASVVIVHENEAGMKQLVAYA 4536

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +      L   EL    K  +  Y  P        LP+T  GK+ ++ L
Sbjct: 4537 VKDAEQELGTAELRQHFKAHVPDYMVPAAFVMLDALPLTPNGKVDRKAL 4585



 Score =  117 bits (293), Expect = 2e-28
 Identities = 126/520 (24%), Positives = 206/520 (39%), Gaps = 55/520 (10%)

Query: 12   ARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
            A+  PE+ A++     L YA ++  ANQ+A+ L+ RGI   D V +              
Sbjct: 1530 AQELPEQFAVIGEQGALTYAQLDAKANQLAHALLKRGIGSEDLVGICVERSSEMQIGQLA 1589

Query: 72   ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELY 131
             LKAGA  VP++       + + ++D+G   +            ER   A  + A   L 
Sbjct: 1590 ILKAGAAYVPMDPAYPRERLAFMIKDAGMSLVLT---------QERLLDALPQEAAALLC 1640

Query: 132  IDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLT 191
            +D                  W  +  +     +++T  D +A +IYTSG+TG PKG ++ 
Sbjct: 1641 LDRD----------------WQEIAAESTAAPAIKTNADQLAYVIYTSGSTGTPKGVEIE 1684

Query: 192  HTNLLFNAVA--SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFD 249
            H + L N V     A    A D              F  +          G  +  PR  
Sbjct: 1685 HGS-LLNLVNWHQRAYSVSAEDRASQIAGTA-----FDASVWETWPYLTAGATICQPR-- 1736

Query: 250  GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIK-QISQTLHTAVSGGASLPAEVARK 308
             +  LS  +     +  G+   +     A+    +       L   ++GG +L       
Sbjct: 1737 EEIRLSPEKLRDWLVETGITISFLPTPLAENLLPLPWPTGAALRYMLTGGDTLHQYPTAD 1796

Query: 309  VKEKFGIEILEGYGLSETSPVVSFNNP----KRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
            V       ++  YG +E + V +        +R++ P +IG PI  V + ++DEN   + 
Sbjct: 1797 VP----FTLVNQYGPTENTVVATAGAVPVLGERESAP-TIGRPIDNVSVYVLDENRQPVP 1851

Query: 365  GEGPGEIAVRGHCVMKGYHNRPEAN---------AQVMRDGWFRTGDIARRDEEGFYFII 415
                GE+ + G  + +GY NRP+           + +     +RTGD+ R   +G    I
Sbjct: 1852 VGVVGELYIGGKSLARGYRNRPDLTEASFVPNPFSPIEGARMYRTGDLVRYAADGSIEFI 1911

Query: 416  DRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG-EEIKAFVIPAEGATLT 474
             R+ D +   G+ V   EIE  L  HP V+ + V+     T G + + A+ +  EG    
Sbjct: 1912 GRADDQVSIRGFRVELGEIESALYAHPAVAESVVIVREDVTPGVKRLVAYAVLHEGEERQ 1971

Query: 475  EDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              EL    KE L  Y  P  +     LP+T  GK+ +R L
Sbjct: 1972 TSELRQSLKEMLPDYMVPSAIVLMEALPLTPNGKVDRRAL 2011



 Score =  114 bits (284), Expect = 2e-27
 Identities = 125/526 (23%), Positives = 209/526 (39%), Gaps = 61/526 (11%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E      P+  A+V G  RL YA +N  ANQ+A+ L ++G+ P   VA+         
Sbjct: 3043 LFEAQVEATPDAQALVVGTERLTYAELNKRANQLAHYLRAQGVGPEVLVAVLMERTTEMI 3102

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                G +KAG   VP++       I Y L DS  +A    T    LP+            
Sbjct: 3103 VALLGIIKAGGAYVPIDPAYPQDRIGYTLDDS--QAAIVLTQERLLPM------------ 3148

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
                   LP      T+ +   +  WA +  QP           +++ +IYTSG+TG PK
Sbjct: 3149 -------LPEH----TAQVICLDRDWACMAVQPEANVPNLAAPTNLSYVIYTSGSTGLPK 3197

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTV----LPLFHIFGQTTMMNAALYRHGTM 242
            G  + H++++     +  +F     S  +  T     L ++ IF         L   G +
Sbjct: 3198 GVAIQHSSVIAFIFWAKTVFSAEEMSGVLASTSICFDLSVYEIF-------VTLSCGGKV 3250

Query: 243  VLMPRFDGDEAL---SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGA 299
            +L      D AL   SL   ++VT+   VP+    L+       +  I  ++      G 
Sbjct: 3251 IL-----ADNALHLPSLPAAKEVTLINTVPSAAKELVR------MNAIPPSVRVVNLAGE 3299

Query: 300  SLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSFNNPKRKAKPG-SIGLPIWGVEMKLVD 357
             LP  +A+ +     ++ +   YG SE +   ++    + AK   +IG P+   +  ++D
Sbjct: 3300 PLPNTLAQSLYALGHVQKVFNLYGPSEDTTYSTYVQVTKGAKTEPTIGRPLANTQAYVLD 3359

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFR---------TGDIARRDE 408
                 +                +GY  RP+  A+      F          TGD+ R   
Sbjct: 3360 AKLQPVPXXXXXXXXXXXXXXARGYLKRPKMTAERFLPNPFHPDPDARMYSTGDLVRYLP 3419

Query: 409  EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
            +G    + R    +   GY +   E+E VL +HPQ+  A VV        + + A++   
Sbjct: 3420 DGQLEYLGRIDHQVKIRGYRIELGELEAVLRSHPQIKEAVVVAKEDKLGEKRLVAYITTK 3479

Query: 469  EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +G       L +WAK +L  +  P    +   +P+T  GKI +++L
Sbjct: 3480 DGECGDRAVLTSWAKAKLPEFMVPSFFVWLDAMPLTPNGKIDRKQL 3525



 Score =  101 bits (252), Expect = 1e-23
 Identities = 126/514 (24%), Positives = 206/514 (40%), Gaps = 61/514 (11%)

Query: 20  AIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVV 79
           A+V G+  L Y  +N  ANQ+A LL +RGI P   V+L                KAG   
Sbjct: 477 ALVMGEQVLTYRELNEKANQLAKLLRARGIGPESMVSLLTERSAEMMIAILAIFKAGGAY 536

Query: 80  VPLNVLLTPREIEYHLRDSGAKALFA---FTGTPELPLGERAWQAFQEVAECELYIDLPA 136
           +P++       IEY L+DS ++ L     F G  +                 +  IDL A
Sbjct: 537 LPIDPSHPKERIEYILQDSRSELLLVNHRFLGAVDF---------------ADRIIDLEA 581

Query: 137 AAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLL 196
           A                   G     E V +  + +A +IYTSG+TG+PKG  + H +LL
Sbjct: 582 AE---------------IYQGAADNLECV-SHANHLAYVIYTSGSTGKPKGVMIEHASLL 625

Query: 197 FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEA--L 254
               A   L+      +D +L             +    L     ++L P  + + A   
Sbjct: 626 NIIFALQELYPLL--ENDAYLLKTTYTFDVSVAEIFGWILGSGRLVILDPGAEKEPAHIW 683

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
             M    VT    VP+M    ++   D   +Q    L    + G ++P+E+  KV E   
Sbjct: 684 ETMVNHGVTHVNFVPSMLIPFVDYVRD---QQQESPLRYIFAAGEAMPSELVGKVYEALP 740

Query: 315 IEILEG-YGLSETSPVVSFNNPKRKAKP--GSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
             ILE  YG +E++   +  +  + ++     IG P+  ++  +V+++        PGE+
Sbjct: 741 GVILENIYGPTESTIYATKYSLAKDSQDVLVPIGKPLANIQTHIVNKHGQLQPVGVPGEL 800

Query: 372 AVRGHCVMKGYHN-----------RPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
            + G  + +GY N            P A  Q M    +RTGD+AR  ++G    + R   
Sbjct: 801 CIAGASLARGYWNNEALTNEKFVPHPFAAGQRM----YRTGDLARYRQDGNIEYLGRIDH 856

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIA 480
            +   GY +   EI   L+    +  A V+          + A+ I  +  T+  + L  
Sbjct: 857 QVKIRGYRIELDEIRAQLIQEASIRDAVVIARTDHNGQAYLCAYFIADKQWTV--NALRE 914

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             ++ L  Y  P       E P+T++GKI ++ L
Sbjct: 915 ALRQTLPDYMVPSHFIQMEEFPLTSSGKIDRKAL 948


>ACSA_RHIE6 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  137 bits (344), Expect = 3e-34
 Identities = 128/518 (24%), Positives = 220/518 (42%), Gaps = 31/518 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +      + GAV   +  
Sbjct: 103 DKKITYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYID---LP 135
             +P  +   + D   ++ F  T      G   +PL +    A    A   +++    + 
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDEGLRGGKPVPLKDNTDTAIHIAARQHVHVSKVLVV 220

Query: 136 AAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHT 193
              G  T   PG + ++   +     E   V+ + +D   I+YTSG+TG+PKG    T  
Sbjct: 221 RRTGGKTGWAPGRDLWYHQEVATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGG 280

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-D 249
            L++ ++    +FD      D++     +  + G + ++   L    T ++   +P F D
Sbjct: 281 YLVYASMTHEYVFDY--HHGDIYWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV 309
                 +++K KV IF   PT    L+ A  D              + G  +  E     
Sbjct: 339 QGRFWEVIDKHKVNIFYTAPTAIRSLMGAGDDFVTXXXXXXXXXXGTVGEPINPEAWEWY 398

Query: 310 KEKFGIE---ILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEG 365
               G +   +++ +  +ET   +    P     KPGS  +P +GV+ +LVD     +EG
Sbjct: 399 YNVVGDKRCPVIDTWWQTETGGHMITPLPGAIDLKPGSATVPFFGVKPQLVDNEGKVLEG 458

Query: 366 EGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
              G + +          + G H R          G + TGD  RRDE+G+Y+I  R  D
Sbjct: 459 AADGNLCITDSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDD 518

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTEDE 477
           ++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V      EG      E
Sbjct: 519 VLNVSGHRLGTAEVESALVSHNLVSEAAVVGYPHAIKGQGIYCYVTLMAGHEGTDTLRQE 578

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 579 LVKHVRAEIGPIASPDKIQFAPGLPKTRSGKIMRRILR 616


>ACSA_SHEB9 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  136 bits (342), Expect = 5e-34
 Identities = 136/531 (25%), Positives = 223/531 (41%), Gaps = 44/531 (8%)

Query: 14  NRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGAL 73
           N  E+  I +G++            + AN L S+G+R GD V +  P VP          
Sbjct: 101 NASEQRKITYGELHAEVC-------KFANALRSQGVRRGDIVTIYMPMVPEAAVAMLACA 153

Query: 74  KAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQ--EVAE 127
           + GAV   +    +P  I   + D  +K +        G   +PL      A +  +V  
Sbjct: 154 RIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNIDDALKNPDVTT 213

Query: 128 CELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-ESVRTEGDDVAVIIYTSGTTGQPK 186
            E  I L    G     +   + +W +L     E+ +    + +    ++YTSG+TG PK
Sbjct: 214 VEKVIVLKRTGGIV-DWVEDRDVWWHSLMETASEYCQPEEMDAEAPLFLLYTSGSTGNPK 272

Query: 187 GA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL- 244
           G    T   +++ ++    +FD    + +V+     +  I G + M+   L    T+++ 
Sbjct: 273 GVLHTTGGYMVYASMTHEYVFDYK--AGEVYWCTADVGWITGHSYMVYGPLANGATVLIH 330

Query: 245 --MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
             +P       L  ++++ KV+I    PT+   L+     H  K    +L    S G  +
Sbjct: 331 EGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQHFDKFDGSSLRIMGSVGEPI 390

Query: 302 PAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVD 357
             E  R   E  G E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD
Sbjct: 391 NPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPGATDTKPGSATRPFFGVQPALVD 450

Query: 358 E----------NFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRD 407
                               PG++       + G H R          G + TGD ARRD
Sbjct: 451 NMXXXXXXXXXXXXXXXDSWPGQMRT-----VYGDHERFVLTYFKTFRGMYFTGDGARRD 505

Query: 408 EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV-- 465
           E+G+Y+I  R  D+I   G+ +   E+E  L++H  V+ AAVVG PHD  G+ I A+V  
Sbjct: 506 EDGYYWITGRVDDVINVSGHRLGTAEVESALVSHELVAEAAVVGYPHDIKGQGIYAYVXX 565

Query: 466 -IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                           W ++ + A   P ++++ T LP T +GKI++R LR
Sbjct: 566 XXXXXXXXXXXXXXXXWVRKEIGALATPDLIQWATGLPKTRSGKIMRRFLR 616


>ACSA_PSEHT RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 646

 Score =  135 bits (341), Expect = 6e-34
 Identities = 130/500 (26%), Positives = 214/500 (42%), Gaps = 30/500 (6%)

Query: 41  ANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGA 100
           AN L   G++ GD+VA+  P  P   +   G  + GA+   +    +P  I   ++DSGA
Sbjct: 120 ANGLKKLGVQKGDRVAIYMPMSPQAIYAMQGCARIGAIHSVIFGGFSPSAIADRIKDSGA 179

Query: 101 KALFAFTGTPE----LPLGERAWQA-FQEVAECELYIDLPAAAGATTSAIPGAETFWAAL 155
           K +            +PL     +A  QE      ++ +    G               +
Sbjct: 180 KVVITSDEGRRAGNCVPLKANVDEAVLQESVTSIEHVIVHQLTGGXXXXXXXXXXXXXLV 239

Query: 156 NGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQAPDS 212
             +    E      +D   I+YTSG+TGQPKG  + HT    L++ ++    +FD   D 
Sbjct: 240 ADEEPVCEPEVMNAEDPLFILYTSGSTGQPKG--VVHTTGGYLVYASMTHEYIFDVKED- 296

Query: 213 HDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-SLMEKEKVTIFAGV 268
            DVF     +  I G + +    L    T V+   +P +     +  +++K  VTI    
Sbjct: 297 -DVFWCSADVGWITGHSYIAYGPLVNGCTQVVFEGVPTYPTAGRMGEVVDKHGVTILYTA 355

Query: 269 PTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLS 324
           PT    L+ A+GD  +    + +L    S G  +  E      E+ G     I++ +  +
Sbjct: 356 PTAIRALM-AKGDEPVASSHRNSLRILGSVGEPINPEAWNWYYEQIGKSNCPIVDTWWQT 414

Query: 325 ETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----V 378
           ET  ++    P     KPGS   P +G+   + D   NT+EGE  G + +          
Sbjct: 415 ETGGIMITPLPGATDLKPGSATRPFFGIAPAIFDAEGNTLEGEADGNLVILDSWPSQART 474

Query: 379 MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVL 438
           + G H R E        G +  GD  RRDE+G+Y+I  R  D++   G+ +   EIE   
Sbjct: 475 IYGDHERFEQTYFSTYPGVYFCGDGCRRDEDGYYWITGRVDDVLNISGHRLGTAEIESXX 534

Query: 439 MTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIV 495
                       G PHD  G+ I  ++ P EG T++++   E+  W ++ L+    P ++
Sbjct: 535 XXXXXXXXXXXXGYPHDIKGQGIYVYITPNEGITVSDELTKEIRNWVRKELSPIASPDMI 594

Query: 496 EFRTELPMTATGKILKRELR 515
           ++   LP T +GKI++R LR
Sbjct: 595 QWSPGLPKTRSGKIMRRILR 614


>ACSA_BARQU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  135 bits (341), Expect = 6e-34
 Identities = 129/521 (24%), Positives = 232/521 (44%), Gaps = 33/521 (6%)

Query: 23  FGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           + D ++ Y  +     + AN+L + G++ GD+V +  P +P   +      + GA+   +
Sbjct: 101 YHDKKITYNELYEHVCRFANILKNHGVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVI 160

Query: 83  NVLLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYIDLPA 136
               +   I   + D   K+ F  T      G   + L      A    A   ++++   
Sbjct: 161 FAGFSSEAIADRIVD--CKSTFIITADQGLRGGKLIKLKNNIDHAIDIAARRGVHVNQVL 218

Query: 137 AAGATTSAIPGAE--TFW--AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH 192
               T+  I   +   FW    ++    +  +     +D   I+YTSG+TG+PKG   T 
Sbjct: 219 VIRRTSGTIDWVKGRDFWYHEEISHAKTDCPAEMMNAEDPLFILYTSGSTGKPKGVLHTT 278

Query: 193 TN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF 248
              L++ ++    +FD  P   +++     +  I G + ++   L    T ++   +P F
Sbjct: 279 AGYLVYVSMTHQYVFDYHPG--EIYWCTADIGWISGHSYLIYGPLCNGATTLMFEGIPTF 336

Query: 249 -DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT-LHTAVSGGASLPAEVA 306
            D      +++K KV      PT    L+ A G+  ++   +T L    + G  +  E  
Sbjct: 337 PDQGRFWEIVDKHKVNTLYTAPTAIRALMGA-GNSFVEHSKRTSLRLLGTVGEPINPEAW 395

Query: 307 RKVKEKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNT 362
           +      G     IL+ +  +ET   +    P   + K GS   P +GV+++++D   N 
Sbjct: 396 KWFYHTVGDNRCPILDTWWQTETGGHMITPLPGATQLKAGSATHPFFGVQLQIIDGEGNV 455

Query: 363 IEGEGPGEIAVRGHCV--MKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDR 417
           +EGE  G + +       M+  +N  E   +       G + TGD  +RD +G+Y+I  R
Sbjct: 456 LEGEAEGNLCIIDSWPGQMRTLYNDHERFIETYFSTYKGKYFTGDGCKRDNDGYYWITGR 515

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED- 476
             D++   G+ +   EIE  L++HP +S AAVVG PH   G+ I +FV   EG T +E+ 
Sbjct: 516 IDDILNVSGHRLGTAEIESALVSHPAISEAAVVGYPHPIKGQGIYSFVTLMEGITPSEEL 575

Query: 477 --ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +LI   K+ + +      ++F  +LP T +GKI++R LR
Sbjct: 576 YKDLIQHVKKEIGSIALLDKIQFTPQLPKTRSGKIMRRILR 616


>ACSA_AGRVS RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  135 bits (341), Expect = 6e-34
 Identities = 138/532 (25%), Positives = 227/532 (42%), Gaps = 37/532 (6%)

Query: 17  ERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF 70
           ER AI++       D R+ Y  +     ++AN+L + G++ GD+V +  P VP   +   
Sbjct: 89  ERTAIIWEGDNPYIDKRITYNQLYDNVCRLANVLKAHGVKKGDRVTIYMPMVPEATYAML 148

Query: 71  GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQE 124
              + GAV   +    +P  +   + D   ++ F  T      G   + L E    A   
Sbjct: 149 ACSRIGAVHSVVFGGFSPEALAGRIVD--CESTFVITCDEGVRGGKPVALKENTDVAIDI 206

Query: 125 VAECELYID---LPAAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSG 180
            A+  + ++   +    G      PG + ++   +     +   V+ + +D   I+YTSG
Sbjct: 207 AAKQYVIVNKVLVVRRTGGKVGWAPGRDLWYHQEIAKVKPDCPPVKMKAEDPLFILYTSG 266

Query: 181 TTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           +TG+PKG    T   L++ A+    +FD      ++F     +  + G + ++   L   
Sbjct: 267 STGKPKGVLHTTGGYLVYAAMTHEYVFDYKDG--EIFWCSADVGWVTGHSYIVYGPLANC 324

Query: 240 GTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            T V+   +P F D      +++K KV IF   PT    L+ A  D              
Sbjct: 325 ATTVMFEGVPNFPDQGRFWEIIDKHKVNIFYTAPTAIRSLMGAGDDFVKXXXXXXXXXXG 384

Query: 296 SGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGV 351
           S G  +  E         G +   I++ +  +ET  ++    P     KPGS   P +GV
Sbjct: 385 SVGEPINPEAWEWYYNVVGDQRCPIVDTWWQTETGGILISPLPGATDLKPGSATRPFFGV 444

Query: 352 EMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARR 406
           + +LVD     +EG   G + +          + G HNR          G + TGD  RR
Sbjct: 445 KPELVDNEGKVLEGAADGNLCLIDSWPGQARTIYGDHNRFVQTYFSTYKGKYFTGDGCRR 504

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
           DE+G+Y+I  R  D++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V 
Sbjct: 505 DEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHHLVSEAAVVGYPHGIKGQGIYCYVT 564

Query: 467 PAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              G    E+    LI   +  +     P  V+F   LP T +GKI++R LR
Sbjct: 565 LMAGHEGNEELRQTLIKHVRSEIGPIASPDKVQFAPGLPKTRSGKIMRRILR 616


>ACSA2_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 2;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 2;AltName:
           Full=Acyl-activating enzyme 2;
          Length = 644

 Score =  135 bits (341), Expect = 6e-34
 Identities = 127/508 (25%), Positives = 221/508 (43%), Gaps = 43/508 (8%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           ++AN + +RG++ GD+V++  P +P   F      + GA+   +    +P  +   + D+
Sbjct: 117 RLANAMKARGVKKGDRVSIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDA 176

Query: 99  GAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWA- 153
             + +        G   +PL +   +A   +A C      PA +        G +  W  
Sbjct: 177 DCRTVITADEGVRGGKRIPLKQNVDKA---LASC------PAVSSVLVVRRTGGDVAWTE 227

Query: 154 --------ALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSAL 205
                   A      +      E +D   I+YTSG+TG+PKG   T    L  A  +  +
Sbjct: 228 GRDLWYHEATKDAGDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKV 287

Query: 206 FDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM----PRF-DGDEALSLMEKE 260
                D  +VF     +  + G + ++   L  +G + LM    P + D      +++K 
Sbjct: 288 VFDYRDG-EVFWCTADVGWVTGHSYIVYGPL-ANGAISLMFEGVPNYPDTSRFWQVVDKH 345

Query: 261 KVTIFAGVPTMYWGLLNAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFGIE--- 316
           +V IF   PT    L+  +G   ++  S+ +L    S G  +  E      E+ G +   
Sbjct: 346 QVNIFYTAPTALRALMR-EGSAPLQSTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCP 404

Query: 317 ILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRG 375
           I++ +  +ET  ++    P  ++ KPG    P++GV+  L+DE    IEG G G +A++ 
Sbjct: 405 IVDTWWQTETGGIMLTPLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKA 464

Query: 376 HCV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVY 430
                   + G H R          G++ T           Y+I  R  D+I   G+ + 
Sbjct: 465 SWPGQIRSVYGDHQRMVDTYFKPLPGYYFTXXXXXXXXXXXYWITGRIDDVINVSGHRIG 524

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELIAWAKERLA 487
             E+E  L+ H  V+ AAVVG PHD  G+ + AFV    G T     + EL+A   + + 
Sbjct: 525 TAEVESALVLHDSVAEAAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIG 584

Query: 488 AYKYPRIVEFRTELPMTATGKILKRELR 515
           ++  P ++++   LP T +GKI++R LR
Sbjct: 585 SFAKPELIQWAPALPKTRSGKIMRRILR 612


>ACSA_RHIEC RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  135 bits (340), Expect = 8e-34
 Identities = 128/518 (24%), Positives = 219/518 (42%), Gaps = 31/518 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +      + GAV   +  
Sbjct: 103 DKKITYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYID---LP 135
             +P  +   + D   ++ F  T      G   +PL +    A    A   + +    + 
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDEGVRGGKPVPLKDNTDTAIHIAARQHVNVSKVLVV 220

Query: 136 AAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHT 193
              G  T   PG + ++   +     E   V+ + +D   I+YTSG+TG+PKG    T  
Sbjct: 221 RRTGGKTGWAPGRDLWYHQEVATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGG 280

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-D 249
            L++ ++    +FD      D++     +  + G + ++   L    T ++   +P F D
Sbjct: 281 YLVYASMTHEYVFDY--HHGDIYWCTADVGWVTGHSYIVYGPLSNCATTLMFEGVPNFPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV 309
                 +++K KV IF   PT    L+ A  D              + G  +  E     
Sbjct: 339 QGRFWEVIDKHKVNIFYTAPTAIRSLMGAGDDFVTXXXXXXXXXXGTVGEPINPEAWEWY 398

Query: 310 KEKFGIE---ILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEG 365
               G +   +++ +  +ET   +    P     KPGS  +P +GV+ +LVD     +EG
Sbjct: 399 YNVVGDKRCPVIDTWWQTETGGHMITPLPGAIDLKPGSATVPFFGVKPELVDNEGKVLEG 458

Query: 366 EGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
              G + +          + G H R          G + TGD  RRDE+G+Y+I  R  D
Sbjct: 459 AADGNLCIADSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDD 518

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTEDE 477
           ++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V      EG      E
Sbjct: 519 VLNVSGHRLGTAEVESALVSHNLVSEAAVVGYPHAIKGQGIYCYVTLMAGHEGTDTLRQE 578

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 579 LVKHVRAEIGPIASPDKIQFAPGLPKTRSGKIMRRILR 616


>ACSA_PYRAE RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 670

 Score =  135 bits (340), Expect = 8e-34
 Identities = 140/522 (26%), Positives = 226/522 (43%), Gaps = 41/522 (7%)

Query: 27  RLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVL 85
           +L Y  +    N+VA +L    G++ GDK+ L  P VP  P     A + GA+   +   
Sbjct: 120 KLTYYDLYREVNRVAYMLKQNFGVKKGDKITLYLPMVPELPITMLAAWRIGAITSVVFSG 179

Query: 86  LTPREIEYHLRDSGAKALFAFTGTPE----LPLGERAWQAFQEVAECELYIDLPAAAGAT 141
            +   +   + DS ++ +    G       + L E    A ++    E  I LP      
Sbjct: 180 FSADALAERINDSQSRIVITADGFWRRGRVVRLKEVVDAALEKATGVESVIVLPRLGLKD 239

Query: 142 TSAIPGAETFWAAL-NGQPGE--FESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
                G + +W  L  G P     E    E +  + I+YTSGTTG+PKG          +
Sbjct: 240 VPMTEGRDYWWNKLMQGIPPNAYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVH 299

Query: 199 AVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRF-DGDEA 253
             A+   +FD   D  D+F     +  + G + ++   L    T V+    P +   D  
Sbjct: 300 VYATMKWVFDIRDD--DIFWCTADIGWVTGHSYVVLGPLLMGATEVIYEGAPDYPQPDRW 357

Query: 254 LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
            S++E+  VTIF   PT     +    +   K    TL    S G  +  E  R      
Sbjct: 358 WSIIERYGVTIFYTSPTAIRMFMRYGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVL 417

Query: 314 GIEIL---EGYGLSETSPVVSFNNPKR---KAKPGSIGLPIWGVEMKLVDENFNTIEGEG 367
           G E +     + ++ET  +V  + P       KPG+ G P+ G E+ +VDEN N      
Sbjct: 418 GNEKVAFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFEVDVVDENGN------ 471

Query: 368 PGEIAVRGHCVMK--------GYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIID 416
           P    V+G+ V+K        G    PE   +       G F  GD A +D++G+ +++ 
Sbjct: 472 PAPPGVKGYLVIKKPWPGMLHGIWGDPERYIKTYWSRFPGMFYAGDYAIKDKDGYIWVLG 531

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
           R+ ++I   G+ +   E+E  L++HP V+ +AVVGVP    GE   AFV+  +G   +++
Sbjct: 532 RADEVIKVAGHRLGTYELESALISHPAVAESAVVGVPDAIKGEVPIAFVVLKQGVAPSDE 591

Query: 477 ---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              EL    +  +     P  + F T+LP T +GKI++R L+
Sbjct: 592 LRKELREHVRRTIGPIAEPAQIFFVTKLPKTRSGKIMRRLLK 633


>LGRD_BREPA RecName: Full=Linear gramicidin synthetase subunit
           D;Includes:  RecName: Full=ATP-dependent tryptophan
           adenylase;           Short=TrpA;
          Length = 5085

 Score =  135 bits (339), Expect = 1e-33
 Identities = 120/517 (23%), Positives = 203/517 (39%), Gaps = 51/517 (9%)

Query: 9   EDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
           E  A   P+  A+ + +  L YA +N  ANQ+A+ L+ +G++P   V +     P     
Sbjct: 470 EQQAEKTPDAVAVAYKNRELTYAQLNERANQLAHRLIRKGVKPDTLVGICLERSPEMIIG 529

Query: 69  YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAEC 128
             G +KAGA  VP++       I Y +               E+                
Sbjct: 530 ILGVMKAGAAYVPIDPAHPQERIAYMVXXXXXXXXXXXXXXXEI---------------- 573

Query: 129 ELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA 188
                LP  A                L  +P +  S      ++A +IYTSG+TG PKG 
Sbjct: 574 -----LPVTAAHVICLDSDL------LADEPVDNASSEVTEQNLAYVIYTSGSTGLPKGV 622

Query: 189 QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR- 247
            + H + +  A A    FD  P S  +               M   AL    T+V+  R 
Sbjct: 623 MIEHHSAINLAYALIDAFDIQPTSRVLQXXXXXXXXXXXXXXM---ALLAGATLVIEDRE 679

Query: 248 --FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
               G E + +++++++T  +        ++++             HT + GG +   E+
Sbjct: 680 SLLPGPELIQVLQEQRITTVS--------MVSSVXXXXXXXXXXXXHTLIVGGEAPSREL 731

Query: 306 ARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEG 365
             +     G +    YG +E +   +    +       IG PI    + ++D N N +  
Sbjct: 732 VARYAP--GRQFFNCYGPTEATVCSTMMLCQAGMNNPPIGRPIANATVYVLDANLNPVPV 789

Query: 366 EGPGEIAVRGHCVMKGYHNRPEANAQ--------VMRDGWFRTGDIARRDEEGFYFIIDR 417
             PGE+ + G  + +GY NRPE  A+           +  +RTGD+ R  ++G    + R
Sbjct: 790 GVPGELYIGGKGLARGYWNRPELTAESFIPHPFGTAGERLYRTGDLVRYRQDGNLEFLGR 849

Query: 418 SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
               +   GY +   EIE  +  HP V  A V+        + + A+++ A  A    +E
Sbjct: 850 IDHQVKIRGYRIELGEIENAIRQHPAVQEAVVIAREEKAGDKRLAAYLVAAGKAQPPAEE 909

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           +  + KE L  Y  P  V +   +P+T  GK+ +R L
Sbjct: 910 IALFLKETLPEYMVPAGVVWLDAIPLTVNGKVDRRAL 946



 Score =  134 bits (337), Expect = 2e-33
 Identities = 126/517 (24%), Positives = 208/517 (40%), Gaps = 48/517 (9%)

Query: 9    EDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFV 68
            E  A   PE  A+ + +  L+YA +N  ANQ+A+LL+++G++P   VA+           
Sbjct: 3051 EQQAAKTPENIALEYKEQSLSYAGLNERANQLAHLLIAQGVKPDTTVAICVERSMEMIIG 3110

Query: 69   YFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAEC 128
              G LKAGA  VP++       I Y L DS A  +    G  +          F + A  
Sbjct: 3111 ILGVLKAGAAYVPIDPAHPEERIAYMLDDSQAVVVLTQAGLAD---------KFTQAAAP 3161

Query: 129  ELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA 188
             + +     A      +   +T  A+ N               +A +IYTSGTTG PKG 
Sbjct: 3162 VICLGEKLFADRAHVDVDNIQTDVASTN---------------LAYVIYTSGTTGLPKGV 3206

Query: 189  QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR- 247
             + H + +    A  A F     S  +  T    F      + +  AL   GT+V+  R 
Sbjct: 3207 AVEHRSAMNMVQAYIAYFGLDESSRVLQFTS---FSFDVSVSEIWQALLSGGTLVIEDRE 3263

Query: 248  --FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
                G + +  + + +++  +   ++   L        + +        V G A     V
Sbjct: 3264 SLLPGPDLVRTLRERRISKVSMASSLLASL-------PVAEYPDLAVLEVGGDACSRELV 3316

Query: 306  ARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEG 365
            AR      G +    YG +E +               +IG P    ++ ++D+N   +  
Sbjct: 3317 ARYAT---GRKFFNCYGPTEATVGTVIKQLTLDDDTPTIGRPFPNTKLYVLDQNRKPVPV 3373

Query: 366  EGPGEIAVRGHCVMKGYHNRPEANAQVM--------RDGWFRTGDIARRDEEGFYFIIDR 417
              PGE+ + G C+ +GY NRPE  A+           +  +RTGD+ R   +G    + R
Sbjct: 3374 GVPGELYIGGECLARGYWNRPELTAERFVANPFGQPGERLYRTGDLVRYLPDGNVDYLGR 3433

Query: 418  SKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDE 477
              D +   GY +   EI E L  H  +  A V+        + + A++  A    L+ DE
Sbjct: 3434 FDDQVKIRGYRIELGEIAEALRQHAAIREAVVLAREVRPGDKRLAAYLTSAAEQELSVDE 3493

Query: 478  LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +  W KE+L  Y  P    +   +P+   GK+ ++ L
Sbjct: 3494 IKQWLKEKLPDYMVPASYTWLPAIPLNVNGKVDRKAL 3530



 Score =  109 bits (273), Expect = 5e-26
 Identities = 122/530 (23%), Positives = 213/530 (40%), Gaps = 66/530 (12%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L+   AR+ P++ A+V  D  L Y  +   ANQ+A+ L  +G+  G  V +         
Sbjct: 1522 LVAQVARDMPDQPAVVTRDQLLTYGQLEAKANQLAHYLQKQGVGRGSLVGICVERSVEMV 1581

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  +KAGA  +P++       + + + D+    +                     + 
Sbjct: 1582 IGQLAIMKAGAAYIPMDPAYPKERLAFMMHDASMAIV---------------------LT 1620

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
            + +L   LPA     TS +   +  W  +  +P       T   D+A +IYTSG+TG PK
Sbjct: 1621 QAKLRQKLPA----DTSRLICLDADWETIAQEPTAALVNTTAASDLAYVIYTSGSTGTPK 1676

Query: 187  GAQLTHTNLL---------FNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY 237
            G ++ H  LL         ++  A+      A  + D  +  +  +   G T  +     
Sbjct: 1677 GVEIEHAALLNLIFWHQRAYDVTATDRASQIAGTAFDASVWEIWPYVTKGATLYLPEEEI 1736

Query: 238  RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
            R     L+P    ++    +    +T+      +   +L  +   D       L   ++G
Sbjct: 1737 R-----LVP----EKLRDWLVASNITVSFLPTPLTESMLALEWPGDT-----ALRYMLTG 1782

Query: 298  GASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKA---KPGSIGLPIWGVEMK 354
            G  L         EK    ++  YG +E + V +     ++A      +IG PI  V++ 
Sbjct: 1783 GDKLH----HYPSEKIPFTLVNQYGPTENTVVATAGIVPKEAGQTAAPTIGRPIDNVQVY 1838

Query: 355  LVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDG--WFRTGDIAR 405
            ++D +   +     GE+ + G  + +GY NRP+       A+    + G   +RTGD+ R
Sbjct: 1839 ILDAHRQPVPVGVSGELYIGGSSLARGYLNRPDLTQERFVAHPFTEKAGARLYRTGDLVR 1898

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG-EEIKAF 464
               +G    I R+ D     G+ V   E+E  ++  P V   AVV V  D  G + + A+
Sbjct: 1899 SLPDGSIEFIGRADDQTSIRGFRVELGEVETAIVALPAVK-EAVVTVCTDKQGTKRLAAY 1957

Query: 465  VIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            ++  EGA L   ++    KE L  Y  P        LP+T  GK+ ++ L
Sbjct: 1958 LVLEEGAALATGDIRKALKETLPDYMVPAFFTQLAYLPLTPNGKVDRKNL 2007



 Score = 95.1 bits (235), Expect = 1e-21
 Identities = 116/527 (22%), Positives = 205/527 (38%), Gaps = 64/527 (12%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            ++E+     P+  A++ G+ R+ Y  +N  ANQ+A+ L  +G+ P   V +         
Sbjct: 4104 MIEEMVSKAPDSIALIVGEQRVTYGELNRQANQLAHYLRKQGVGPEVLVGICAERTVEMM 4163

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAG   VP++       I Y         +   +  P L   E       E  
Sbjct: 4164 IGLLAILKAGGAYVPIDPAYPAERIAY---------IIGHSQIPVLLTQEHLLPTLPEHQ 4214

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
               + +D                  WA +  +  E        D++  +IYTSG+TG PK
Sbjct: 4215 AKVICLDRD----------------WATVAVESEENPGKLATSDNLIYVIYTSGSTGNPK 4258

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTV----LPLFHIFGQTTMMNAALYRHGTM 242
            G  L H ++++    +   +     S  +F T     L ++ +F   TM        G  
Sbjct: 4259 GVALEHRSVIYFLSWAHDTYTPEEMSGVLFSTSICFDLSVYEMFATLTM--------GGK 4310

Query: 243  VLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLP 302
            V+M   +          ++VT+   VP+    L+  +G      I  ++      G  L 
Sbjct: 4311 VIMAE-NXXXXXXXXXXDQVTLVNTVPSAATELVRMKG------IPASVRVINLCGEPLS 4363

Query: 303  AEVARKVKEKFGIE-ILEGYGLSE-----TSPVVSFNNPKRKAKPGSIGLPIWGVEMKLV 356
              +A+++     +E +   YG +E     T  +V+    K       IG P +   + ++
Sbjct: 4364 NRLAQELYAFPHVEKVFNLYGPTEDTVYSTHAIVT----KGATNEPLIGRPQFNTHVFVL 4419

Query: 357  DENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDG--------WFRTGDIARRDE 408
            D +   +    PGE+ + G  + +GY +RP+  A+              +RTGD+ R   
Sbjct: 4420 DSHRKPVPVGVPGELYLSGSGLARGYLHRPDLTAERFVQNPFREPGARMYRTGDLVRYLP 4479

Query: 409  EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE-IKAFVIP 467
            +G    + R    +   GY +   EIE VL   P V    V+    D  G++ + A+++ 
Sbjct: 4480 DGNLQFVGRVDYQVKIRGYRIELGEIESVLNRFPGVK-EVVLLAREDREGDKCLVAYIVF 4538

Query: 468  AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                T    +L  +  ++L AY  P+       LP T  GK+ ++ L
Sbjct: 4539 EADCTSKIHDLNHFLADKLPAYMIPQHYMILDSLPKTPNGKLDRKAL 4585


>AAS_SALDC RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  135 bits (339), Expect = 1e-33
 Identities = 121/471 (25%), Positives = 201/471 (42%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  T      A+  W   +        V+ + +D
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTL-----ADKMWIFAHLLAPRLAQVKQQPED 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 AAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--ANDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVV  N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVLINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+      + G E  G + ++G  +M GY            +   A  +  R GW+
Sbjct: 540 MDARLL-----AVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETER-GWY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F   +E   LT ++L  +A+E  +     PR + +  +LP+  +GK
Sbjct: 654 EALVLFTTDSE---LTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGK 701


>AAS_ENTS8 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  135 bits (339), Expect = 1e-33
 Identities = 128/472 (27%), Positives = 202/472 (42%), Gaps = 38/472 (8%)

Query: 51  PGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTP 110
           P + + L  PN      V FGA+  G +   +N     + +   +  +  K +F  T   
Sbjct: 254 PREAIGLMLPNASISAAVIFGAVMRGRIPAMMNYTAGVQGLTSAITAAQIKTIF--TSRQ 311

Query: 111 ELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD 170
            L  G + W   +++     ++ L    G  T+     +  W   +        V  + +
Sbjct: 312 FLDKG-KLWHLSEQITSVR-WVFLEDLKGEVTAK----DKAWIFAHLLMPRLAQVEQQPE 365

Query: 171 DVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTT 230
           D A+I++TSG+ G PKG   +H +LL N      + D   D  D F++ LPLFH FG T 
Sbjct: 366 DAALILFTSGSEGNPKGVVHSHKSLLANVEQIRTIADFTAD--DKFMSALPLFHSFGLTV 423

Query: 231 MMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ 289
            +   L     + L P          L+     T+  G  T           +D   +  
Sbjct: 424 GLFTPLLTGAEVFLYPSPLHYRVVPELVYDRNCTVIFGTSTFLGHYARFAHPYDFHLVRY 483

Query: 290 TLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW 349
                V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + 
Sbjct: 484 V----VAGAEKLQESTKQIWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILP 538

Query: 350 GVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEA-NAQ-VMRDGWF 398
            ++ +LV+     + G E  G + ++G  +MKGY           P A N Q V   GW+
Sbjct: 539 AMDARLVE-----VPGIEQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENPQGVSEPGWY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHD-TH 457
            TGDI   DE+GF  I  R+K      G  V    +E + +      + A   + HD   
Sbjct: 594 DTGDIVAFDEQGFVQIQGRAKRFAKIAGEMVSLEMVESLALAVSPEKMHA-TAIKHDAAK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F    E   LT ++L   A+ + +     PR + F  +LP+  +GK
Sbjct: 653 GEALVLFTTDPE---LTREKLAQQARSKGVPELAVPRDIRFLKQLPLLGSGK 701


>ACSA_MARAV RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  134 bits (338), Expect = 1e-33
 Identities = 138/551 (25%), Positives = 237/551 (43%), Gaps = 43/551 (7%)

Query: 1   MLNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGD 53
           +LN S   L+     R ++ AI+F GD       + Y  +     + AN+L  +G++ GD
Sbjct: 74  VLNASANCLDRHLEQRGDQTAIIFEGDDPSVSRNVTYRELYEETCKFANVLKDQGVKKGD 133

Query: 54  KVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT------ 107
            V +  P +           + GA+   +    +P  +    R    K+ F  T      
Sbjct: 134 VVTIYMPMIVETAVAMLACARIGAIHSVVFGGFSPEALA--ARIVNGKSRFVITADEGLR 191

Query: 108 GTPELPLGERAWQAFQEVAECELYIDLPAAAGAT-TSAIPGAE----TFWAALNGQPGEF 162
           G   +PL +    A +   E +  +D       T    +P  E     +   +     E 
Sbjct: 192 GGRAIPLKKNVDSALKH--EDDAKVDKVIVVSRTGNDQVPWTEGRDLRYEDLMKNASAEC 249

Query: 163 ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP 221
           +      +D   ++YTSG+TG PKG    T   +++ ++    +FD      DV+     
Sbjct: 250 QPEPMNAEDPLFMLYTSGSTGAPKGVLHTTGGYMVYASMTHQYVFDY--HDGDVYWCTAD 307

Query: 222 LFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLN 277
              + G + ++   L      +L   +P + D      +++K KV I    PT    L+ 
Sbjct: 308 FGWVTGHSYILYGPLANGAITLLFEGVPNYPDSSRMGQVVDKHKVNILYTAPTAIRALM- 366

Query: 278 AQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFN 333
           AQG+  +   ++ +L    S G  +  E         G     I++ +  +ET  ++   
Sbjct: 367 AQGESCMDGTTRGSLKLLGSVGEPINPEAWEWYHRVIGNSKCPIVDTWWQTETGGILISP 426

Query: 334 NPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPE 387
            P     KPGS  LP +GV+  LVD   N +EG+  G + +          + G H R  
Sbjct: 427 LPGAVDLKPGSATLPFFGVQPALVDNEGNILEGKTEGNLVILDSWPGQMRTIYGDHERFV 486

Query: 388 ANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLA 447
                   G + TGD ARRDE+G+Y+I  R  D++   G+ +   E+E  L+ H +V+ A
Sbjct: 487 QTYFSTYKGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVAHDKVAEA 546

Query: 448 AVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMT 504
           AVVG PHD  G+ I  +V   +G   +++   EL+ W ++ +     P ++++   LP T
Sbjct: 547 AVVGYPHDIKGQGIYVYVTLVQGEEPSDELKKELVQWVRKEIGPIASPDVIQWAPGLPKT 606

Query: 505 ATGKILKRELR 515
            +GKI++R LR
Sbjct: 607 RSGKIMRRILR 617


>ACSA_LEPBP RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  134 bits (338), Expect = 1e-33
 Identities = 132/515 (25%), Positives = 219/515 (42%), Gaps = 28/515 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++   N  AN+L    ++ GD+V +  P VP          + GAV   +    +
Sbjct: 107 LTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVPELAIATLACTRIGAVHSVVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFAFTG------TPELPLGERAWQAFQEVAECELYIDLPAAAGAT 141
           P  +   + D     +    G        EL     A  A  +    ++ +         
Sbjct: 167 PEALLGRIEDCKPTLVITADGGYRGGKPIELKKNVDAALAETKFKVNDVIVVKRTGDEGN 226

Query: 142 TSAIPGAETFWAALNGQPG---EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
            +   G + ++  L   P    E  +V  E +D   I+YTSG+TG+PKG   T    L  
Sbjct: 227 LNWKEGRDHWYHYLMKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLG 286

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEAL 254
           A  + A      D+ D +     +  I G + ++   L    T ++   +P + D     
Sbjct: 287 ANLTFATIFDYKDT-DTYWCTADIGWITGHSYILYGPLSNGATSLMFEGVPSYPDMGRFW 345

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            +++K KVT+F   PT    L+    +H  K+   +L    S G  +  E         G
Sbjct: 346 DVIDKYKVTVFYTAPTAIRALMREGLEHIKKRSLASLRLLGSVGEPINPEAWEWYYANIG 405

Query: 315 ---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
                I++ +  +ET  ++    P     KPGS   P +G++  LVD     ++G+G   
Sbjct: 406 KSKCPIVDTWWQTETGSIMISGIPGAIPQKPGSASWPFYGIQPVLVDNEGVELKGKGEIS 465

Query: 371 ----IAVRGHCVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKDMII 423
               IA     +M+G +  P+           G++ TGD A RD+EG++ I  R  D++ 
Sbjct: 466 GNLCIAKPWPSMMRGVYGDPKRFFDTYFSQFKGYYFTGDGANRDKEGYFRITGRVDDVLN 525

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELIA 480
             G+ +   E+E  L+ H  V+ AAVVG PHD  G+ I A+V   +G     L + ELIA
Sbjct: 526 VSGHRIGSAEVESALVEHKSVAEAAVVGFPHDIKGQGIYAYVTVKQGVVTNDLLKKELIA 585

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 586 MVEKVIGKIARPDVIHWAPGLPKTRSGKIMRRILR 620


>ACSA_LEPBA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 654

 Score =  134 bits (338), Expect = 1e-33
 Identities = 132/515 (25%), Positives = 219/515 (42%), Gaps = 28/515 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++   N  AN+L    ++ GD+V +  P VP          + GAV   +    +
Sbjct: 107 LTYHDLHREVNHFANVLKKFKVKKGDRVLIYLPMVPELAIATLACTRIGAVHSVVFGGFS 166

Query: 88  PREIEYHLRDSGAKALFAFTG------TPELPLGERAWQAFQEVAECELYIDLPAAAGAT 141
           P  +   + D     +    G        EL     A  A  +    ++ +         
Sbjct: 167 PEALLGRIEDCKPTLVITADGGYRGGKPIELKKNVDAALAETKFKVNDVIVVKRTGDEGN 226

Query: 142 TSAIPGAETFWAALNGQPG---EFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFN 198
            +   G + ++  L   P    E  +V  E +D   I+YTSG+TG+PKG   T    L  
Sbjct: 227 LNWKEGRDHWYHYLMKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLG 286

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEAL 254
           A  + A      D+ D +     +  I G + ++   L    T ++   +P + D     
Sbjct: 287 ANLTFATIFDYKDT-DTYWCTADIGWITGHSYILYGPLSNGATSLMFEGVPSYPDMGRFW 345

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG 314
            +++K KVT+F   PT    L+    +H  K+   +L    S G  +  E         G
Sbjct: 346 DVIDKYKVTVFYTAPTAIRALMREGLEHIKKRSLASLRLLGSVGEPINPEAWEWYYANIG 405

Query: 315 ---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGE 370
                I++ +  +ET  ++    P     KPGS   P +G++  LVD     ++G+G   
Sbjct: 406 KSKCPIVDTWWQTETGSIMISGIPGAIPQKPGSASWPFYGIQPVLVDNEGVELKGKGEIS 465

Query: 371 ----IAVRGHCVMKGYHNRPEANAQVMRD---GWFRTGDIARRDEEGFYFIIDRSKDMII 423
               IA     +M+G +  P+           G++ TGD A RD+EG++ I  R  D++ 
Sbjct: 466 GNLCIAKPWPSMMRGVYGDPKRFFDTYFSQFKGYYFTGDGANRDKEGYFRITGRVDDVLN 525

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELIA 480
             G+ +   E+E  L+ H  V+ AAVVG PHD  G+ I A+V   +G     L + ELIA
Sbjct: 526 VSGHRIGSAEVESALVEHKSVAEAAVVGFPHDIKGQGIYAYVTVKQGVVTNDLLKKELIA 585

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             ++ +     P ++ +   LP T +GKI++R LR
Sbjct: 586 MVEKVIGKIARPDVIHWAPGLPKTRSGKIMRRILR 620


>TYCC_BREPA RecName: Full=Tyrocidine synthetase 3;AltName:
            Full=Tyrocidine synthetase III;Includes:  RecName:
            Full=ATP-dependent asparagine adenylase;
          Length = 6486

 Score =  134 bits (336), Expect = 2e-33
 Identities = 132/523 (25%), Positives = 219/523 (41%), Gaps = 45/523 (8%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L  L E+     P++ A++F +  L Y+ +N  AN++A +L ++G+ P   VA+     P
Sbjct: 5658 LHQLFEEQVDKTPDQAALLFSEQSLTYSELNERANRLARVLRAKGVGPDRLVAIMAERSP 5717

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                            VP++       I+Y L DS                     Q   
Sbjct: 5718 EMVXXXXXXXXXXXXYVPVDPGYPQERIQYLLEDSNXXXXXXXXXXXXXXX-----QVSS 5772

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
            E+ EC L ++    AG + S +P           QP           D+A +IYTSGTTG
Sbjct: 5773 ELPEC-LDLNAELDAGLSGSNLPAVN--------QP----------TDLAYVIYTSGTTG 5813

Query: 184  QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMV 243
            +PKG  + H  ++         +   P   D  L V   F   G    + A L    T V
Sbjct: 5814 KPKGVMIPHQGIVNCLQWRRDEYGFGPS--DKALQVFS-FAFDGFVASLFAPLLGGATCV 5870

Query: 244  LMPRFDGDEALS---LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
            L       + ++   LM   +VT + GVP+++  +L+     D  Q    L     GG  
Sbjct: 5871 LPQEAAAKDPVALKKLMAATEVTHYYGVPSLFQAILDCSTTTDFNQ----LRCVTLGGEK 5926

Query: 301  LPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDEN 359
            LP ++ +K KEK   IEI   YG +E S V + +      +  +IG P+  V++ +VDE 
Sbjct: 5927 LPVQLVQKTKEKHPAIEINNEYGPTENSVVTTISRSIEAGQAITIGRPLANVQVYIVDEQ 5986

Query: 360  FNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-----VMRDG--WFRTGDIARRDEEGFY 412
             +       GE+ + G  + +GY N+PE  A+       R G   ++TGD+ +   +G  
Sbjct: 5987 HHLQPIGVVGELCIGGAGLARGYLNKPELTAEKFVANPFRPGERMYKTGDLVKWRTDGTI 6046

Query: 413  FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQV-SLAAVVGVPHDTHGEEIKAFVIPAEGA 471
              I R+ + +   GY +   EIE  ++ +  +            T G  + A+ + A   
Sbjct: 6047 EYIGRADEQVKVRGYRIEIGEIESAVLAYQGIDQXXXXXXXXXXTAGSYLCAYFVAATAV 6106

Query: 472  TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +++   L +   + L AY  P       +LP++A GK+ ++ L
Sbjct: 6107 SVS--GLRSHLAKELPAYMIPSYFVELDQLPLSANGKVDRKAL 6147



 Score =  132 bits (333), Expect = 5e-33
 Identities = 132/523 (25%), Positives = 222/523 (42%), Gaps = 48/523 (9%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L  L E+ A   P+  A+      L+Y  +N  ANQ+A  L  RG++P   V +      
Sbjct: 2539 LQALFEEQAEKSPQATAVEISGQPLSYQELNERANQLAATLRERGVQPDQPVGIMANRSV 2598

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                     LKAG   VP++       + Y L D  A+ +       +  LG +   +  
Sbjct: 2599 EMVVGILAILKAGGAYVPIDPEYPEERVAYMLTDCQARLVLT-----QKHLGAKLGSSV- 2652

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
              AEC LY+D  +  G   S +    T                    D+A IIYTSGTTG
Sbjct: 2653 -TAEC-LYLDDESNYGVHRSNLQPINT------------------ASDLAYIIYTSGTTG 2692

Query: 184  QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMV 243
            +PKG  + H  ++ N +   A +        + L++   F  F         +    T+V
Sbjct: 2693 KPKGVMVEHRGIVNNVLWKKAEYQMKVGDRSL-LSLSFAFDAF--VLSFFTPVLSGATVV 2749

Query: 244  LMPRFDGDEALS---LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
            L    +  + +S   L+   + T+  GVP+++  +L      DI+     L T   GG  
Sbjct: 2750 LAEDEEAKDPVSLKKLIAASRCTLMTGVPSLFQAILECSTPADIR----PLQTVTLGGEK 2805

Query: 301  LPAEVARKVKE-KFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDEN 359
            + A++  K K+    + I+  YG +E+S V ++          +IG PI    + +V++ 
Sbjct: 2806 ITAQLVEKCKQLNPDLVIVNEYGPTESSVVATWQRLAGPDAAITIGRPIANTSLYIVNQ- 2864

Query: 360  FNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDEEGF 411
            ++ ++  G  GEI + G  + +GY N+P    +          +  ++TGD+ +   +G 
Sbjct: 2865 YHQLQPIGVVGEICIGGRGLARGYWNKPALTEEKFVSHPFAAGERMYKTGDLGKWLPDGT 2924

Query: 412  YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA 471
               I R  + +   GY +   EIE  L+   +++ AAVV V  D  G+   A    A+  
Sbjct: 2925 IEYIGRIDEQVKVRGYRIEIGEIESALLAAEKLT-AAVVVVYEDQLGQSALAAYFTAD-E 2982

Query: 472  TLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             L   +L +   +RL +Y  P       +LP+T  GK+ K+ L
Sbjct: 2983 QLDVTKLWSHLSKRLPSYMIPAHFVQLDQLPLTPNGKVDKKAL 3025



 Score =  130 bits (326), Expect = 3e-32
 Identities = 138/524 (26%), Positives = 217/524 (41%), Gaps = 50/524 (9%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+     P   A++FG+ +L Y  +N  ANQ+A +L  +G++P   V +      Y  
Sbjct: 4615 LFEEQVEKTPNEIAVLFGNEQLTYQELNAKANQLARVLRRKGVKPESTVGILVDRSLYMV 4674

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAG   VP++         + L DS AK L              +  AF    
Sbjct: 4675 IGMLAVLKAGGTFVPIDPDYPLERQAFMLEDSEAKLLLTLQKM-------NSQVAFPYET 4727

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
                Y+D        T  +   ET         G  E V  + ++VA IIYTSGTTG+PK
Sbjct: 4728 ---FYLD--------TETVDQEET---------GNLEHV-AQPENVAYIIYTSGTTGKPK 4766

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
            G  + H +  +  VA +   +   DS  V L  +  F     T     AL   G +V+ P
Sbjct: 4767 GVVIEHRS--YANVAFAWKDEYHLDSFPVRLLQMASFAFDVSTGDFARALLTGGQLVICP 4824

Query: 247  ---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPA 303
               + D       + + ++TIF   P +   L++   ++++      L   + G  S PA
Sbjct: 4825 NGVKMDPASLYETIRRHEITIFEATPALIMPLMHYVYENELDMSQMKL--LILGADSCPA 4882

Query: 304  EVARKVKEKFG--IEILEGYGLSETSPVVSF--NNPKRKAKPGS--IGLPIWGVEMKLVD 357
            E  + +  +FG  + I+  YG++E     S+         + G+  IG P+  + M +VD
Sbjct: 4883 EDFKTLLARFGQKMRIINSYGVTEACIDTSYYEETDVTAIRSGTVPIGKPLPNMTMYVVD 4942

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDEEG 410
             + N       GE+ + G  V +GY NRPE        N     +  +RTGD+A+   +G
Sbjct: 4943 AHLNLQPVGVVGELCIGGAGVARGYLNRPELTEEKFVPNPFAPGERLYRTGDLAKWRADG 5002

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R+   +   G  +   EIE  L     ++ A VV        +E+ A+V+    
Sbjct: 5003 NVEFLGRNDHQVKIRGVRIELGEIETQLRKLDGITEAVVVAREDRGQEKELCAYVVADH- 5061

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              L   EL A   + L     P        LP+TA GK+ +R L
Sbjct: 5062 -KLDTAELRANLLKELPQAMIPAYFVTLDALPLTANGKVDRRSL 5104



 Score =  108 bits (271), Expect = 8e-26
 Identities = 132/537 (24%), Positives = 215/537 (40%), Gaps = 77/537 (14%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L  L+E+ A   P+  A+V+ +  L Y               S G  P   + +     P
Sbjct: 1502 LHQLVEEQAARTPDEVAVVYEEYALTYXXXXXXXXXXXXXXXSHGTGPDTLIGIMVDRSP 1561

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                     LKAG    P++    P  I+Y L DS A  L       EL     A+Q   
Sbjct: 1562 GMVVGMLAVLKAGGAYTPIDPSYPPERIQYMLSDSQAPILLTQRHLQEL----AAYQG-- 1615

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
            E+      ID+   A  T     GA+T    + G+           DD+A +IYTSG+TG
Sbjct: 1616 EI------IDVDEEAIYT-----GADTNLDNVAGK-----------DDLAYVIYTSGSTG 1653

Query: 184  QPKGAQLTHTNL---------LFNAVASSALFDQAPDSHD--VFLTVLPLFHIFGQTTMM 232
             PKG  ++H  +          F      A+  + P S D  V+   LPL          
Sbjct: 1654 NPKGVMISHQAICNHMLWMRETFPLTTEDAVLQKTPFSFDASVWEFYLPLI--------- 1704

Query: 233  NAALYRHGTMVLMPRFDGDEALSLMEK----EKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
                   G  +++ + DG   ++ M +    EK+T    VP++   ++   G        
Sbjct: 1705 ------TGGQLVLAKPDGHRDIAYMTRLIRDEKITTLQMVPSLLDLVMTDPG----WSAC 1754

Query: 289  QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGS--IGL 346
             +L     GG +L   +  +  E    +++  YG +ET+   ++    R+ +  +  IG 
Sbjct: 1755 TSLQRVFCGGEALTPALVSRFYETQQAQLINLYGPTETTIDATYWPCPRQQEYSAIPIGK 1814

Query: 347  PIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WF 398
            PI  V + +V+ + N ++  G  GE+ + G  + +GY  R E       D         +
Sbjct: 1815 PIDNVRLYVVNAS-NQLQPVGVAGELCIAGDGLARGYWQREELTKASFVDNPFEPGGTMY 1873

Query: 399  RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            RTGD+ R   +G    + R    +   G+ +   EIE  L+ H  V  A VV    D  G
Sbjct: 1874 RTGDMVRYLPDGHIEYLGRIDHQVKIRGHRIELGEIEATLLQHEAVK-AVVVMARQDGKG 1932

Query: 459  E-EIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            +  + A+V+  +   +   EL  +    L AY  P    F  +LP++A GK+ ++ L
Sbjct: 1933 QNSLYAYVVAEQ--DIQTAELRTYLSATLPAYMVPSAFVFLEQLPLSANGKVDRKAL 1987



 Score =  107 bits (268), Expect = 2e-25
 Identities = 125/530 (23%), Positives = 214/530 (40%), Gaps = 70/530 (13%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L+ + A   P + A+V G+  L Y  +   + Q+AN L  +GI  G  V++   +     
Sbjct: 469 LIAEQASRTPAKAAVVCGEDTLTYQELMERSAQLANALREKGIASGSIVSIMAEHSLELI 528

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGT-PELPLGERAWQAFQEV 125
                 L++GA  +P++       I+Y                 P +             
Sbjct: 529 VAIMAVLRSGAAYLPIDPEYPQDRIQYXXXXXXXXXXXXXXXXXPNI-----------RF 577

Query: 126 AECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
           A   LY+D         S   G  T +A             ++ DD+A +IYTSG+TG P
Sbjct: 578 AGSVLYLD-------DRSLYEGGSTSFAP-----------ESKPDDLAYMIYTSGSTGNP 619

Query: 186 KGAQLTHTNLLFNAVASSALFDQAP-------DSHDVFLTVLPLFH--IFGQTTMMNAAL 236
           KGA +TH  L+     ++ ++ Q          S    LTV  +F   + G T      +
Sbjct: 620 KGAMITHQGLVNYIWWANKVYVQGEAVDFPLYSSISFDLTVTSIFTPLLSGNT----IHV 675

Query: 237 YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
           YR    V +        L +++  KV I    PT    + +  G       + ++   + 
Sbjct: 676 YRGADKVQV-------ILDIIKDNKVGIIKLTPTHLKLIEHIDGK------ASSIRRFIV 722

Query: 297 GGASLPAEVARKVKEKFG--IEILEGYGLSET--SPVVSFNNPKRKAKPG-SIGLPIWGV 351
           GG +LP ++A+++ + FG  ++I   YG +ET    ++   +P+   +    IG+P   V
Sbjct: 723 GGENLPTKLAKQIYDHFGENVQIFNEYGPTETVVGCMIYLYDPQTTTQESVPIGVPADNV 782

Query: 352 EMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WFRTGDIA 404
           ++ L+D +   +     GE+ + G  V KGY NRPE   +   D         +RTGD+A
Sbjct: 783 QLYLLDASMQPVPVGSLGEMYIAGDGVAKGYFNRPELTKEKFIDNPFRPGTKMYRTGDLA 842

Query: 405 RRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAF 464
           +   +G      R    +   G+ +   EIE  L  H              +    + A+
Sbjct: 843 KWLPDGNMEYAGRMDYQVKIRGHRIEMGEIETRLTQHXXXXXXXXXXXXXXSGQNVLYAY 902

Query: 465 VIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           ++      LT  EL  +    L +Y  P       E+P+TA GK+ +++L
Sbjct: 903 LVSER--ELTVAELREFLGRTLPSYMIPSFFIRLAEIPLTANGKVERKKL 950



 Score =  104 bits (260), Expect = 1e-24
 Identities = 129/528 (24%), Positives = 199/528 (37%), Gaps = 57/528 (10%)

Query: 2    LNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
            L +  L E  A   PE  A+V     L Y  +N  ANQ+A++L   G+     V L    
Sbjct: 3575 LTIQELFEQQAAKTPEHAAVVMDGQMLTYRELNEKANQLAHVLRQNGVGKESIVGLLADR 3634

Query: 62   VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
                     G LKAG   + L+       + Y L D G K +                  
Sbjct: 3635 SLEMITGIMGILKAGGAYLGLDPEHPSERLAYMLEDGGVKVVLVQKHL------------ 3682

Query: 122  FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGT 181
                        LP         +   E+      G P    ++     D+A ++YTSG+
Sbjct: 3683 ------------LPLVGEGLMPIVLEEESLRPEDCGNP----AIVNGASDLAYVMYTSGS 3726

Query: 182  TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLT-----VLPLFHIFGQTTMMNAAL 236
            TG+PKG  + H N+    +     + Q  +S  +  T         F IFG   +  A+L
Sbjct: 3727 TGKPKGVMVEHRNV--TRLVMHTNYVQVRESDRMIQTGAIGFDAMTFEIFG-ALLHGASL 3783

Query: 237  YRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMY-WGLLNAQGDHDIKQISQTLHTAV 295
            Y     VL+   D ++    +   ++T      TM+    L  Q   D   +  +L   +
Sbjct: 3784 YLVSKDVLL---DAEKLGDFLRTNQIT------TMWLTSPLFNQLSQDNPAMFDSLRALI 3834

Query: 296  SGGASLPAEVARKVKEKF-GIEILEGYGLSE-TSPVVSFNNPKRKAKPGSIGLPIWGVEM 353
             GG +L  +   +VK     +EI  GYG +E T+    +   +   +   IG PI     
Sbjct: 3835 VGGEALSPKHINRVKSALPDLEIWNGYGPTENTTFSTCYLIEQHFEEQIPIGKPIANSTA 3894

Query: 354  KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARR 406
             +VD N        PGE+ V G  V +GY N+PE  A+          +  +RTGD+AR 
Sbjct: 3895 YIVDGNNQPQPIGVPGELCVGGDGVARGYVNKPELTAEKFVPNPFAPGETMYRTGDLARW 3954

Query: 407  DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
              +G    + R    +   GY +   EIE VL                    + + A+ +
Sbjct: 3955 LPDGTIEYLGRIDQQVKIRGYRIELGEIETVLSXXXXXXXXXXXXXXXXNGQKALCAYFV 4014

Query: 467  PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            P +       EL     ++L  Y  P       +LP+TA GK+ +R L
Sbjct: 4015 PEQAVDAA--ELREAMSKQLPGYMVPAYYVQMEKLPLTANGKVDRRAL 4060


>SRFAA_BACSU RecName: Full=Surfactin synthetase subunit 1;
          Length = 3587

 Score =  134 bits (336), Expect = 2e-33
 Identities = 141/537 (26%), Positives = 227/537 (42%), Gaps = 65/537 (12%)

Query: 2   LNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPN 61
           + +  L ++ A    +  A+VF D  L+Y  ++  + ++AN+L  +G+ P   VA+    
Sbjct: 461 MTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVLIER 520

Query: 62  VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT--GTPELPLGERAW 119
                    G LKAG   VP++       I+Y L D GA  +   +    PE        
Sbjct: 521 SERMITAIMGILKAGGAYVPIDPGFPAERIQYILEDCGADFILTESKVAAPE-------- 572

Query: 120 QAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTS 179
                 A+ EL IDL  A         GAE    +LN              ++A IIYTS
Sbjct: 573 ------ADAEL-IDLDQAIEE------GAEE---SLNAD--------VNARNLAYIIYTS 608

Query: 180 GTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           GTTG+PKG  + H  +  + V S         S  + + +L  FH       + A+L   
Sbjct: 609 GTTGRPKGVMIEHRQV-HHLVESLQQTIYQSGSQTLRMALLAPFHFDASVKQIFASLLLG 667

Query: 240 GTMVLMPR---FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
            T+ ++P+    +G    +   K  +    G P  +  +L A GD +  ++   L     
Sbjct: 668 QTLYIVPKKTVTNGAALTAYYRKNSIEATDGTPA-HLQMLAAAGDFEGLKLKHML----I 722

Query: 297 GGASLPAEVARKVKEKF-----GIEILEGYGLSETS------PVVSFNNPKRKAKPGSIG 345
           GG  L + VA K+ + F        +   YG +ET       PV+  N  +    P  IG
Sbjct: 723 GGEGLSSVVADKLLKLFKEAGTAPRLTNVYGPTETCVDASVHPVIPENAVQSAYVP--IG 780

Query: 346 LPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGW 397
             +    + ++D+    ++ EG  GE+ + G  V +GY + PE   +       V  D  
Sbjct: 781 KALGNNRLYILDQK-GRLQPEGVAGELYIAGDGVGRGYLHLPELTEEKFLQDPFVPGDRM 839

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           +RTGD+ R   +G    + R  D +   GY +   EIE V+   P V+ A V+  P +  
Sbjct: 840 YRTGDVVRWLPDGTIEYLGREDDQVKVRGYRIELGEIEAVIQQAPDVAKAVVLARPDEQG 899

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             E+ A+V+   G+      L   A  +L  Y  P      TE+P+T +GK+ +R+L
Sbjct: 900 NLEVCAYVVQKPGSEFAPAGLREHAARQLPDYMVPAYFTEVTEIPLTPSGKVDRRKL 956



 Score =  129 bits (324), Expect = 6e-32
 Identities = 137/529 (25%), Positives = 220/529 (41%), Gaps = 64/529 (12%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A N P+  A+ +    L Y  +N  AN++A  ++S G   G   A+ C       
Sbjct: 1510 LFEEQAANTPDHTALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMI 1569

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LK+G+  VP++     + +++  RDSGAK L          L +R  +A  E A
Sbjct: 1570 VSILAVLKSGSAYVPIDPEHPIQRMQHFFRDSGAKVL----------LTQRKLKALAEEA 1619

Query: 127  ECELYIDLPAA-----AGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGT 181
            E +  I L        A A   A+P                     +   +A + YTSGT
Sbjct: 1620 EFKGVIVLADEEESYHADARNLALP--------------------LDSAAMANLTYTSGT 1659

Query: 182  TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM--MNAALYRH 239
            TG PKG  +TH N+L     ++ L     D      T+L L +      M  M  +L   
Sbjct: 1660 TGTPKGNIVTHANILRTVKETNYLSITEQD------TILGLSNYVFDAFMFDMFGSLLNG 1713

Query: 240  GTMVLMPR---FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
              +VL+P+    D      ++E+E ++I      ++  L++            TL   + 
Sbjct: 1714 AKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLN-----PACLSTLRKIMF 1768

Query: 297  GGASLPAEVARKVKEKFGI-EILEGYGLSETSPVVSF---NNPKRKAKPGSIGLPIWGVE 352
            GG     E  RK  +  G  ++L  YG SE++   ++   +  +       IG P+   E
Sbjct: 1769 GGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEHTLSVPIGKPVSNTE 1828

Query: 353  MKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIAR 405
            + ++D   +       GE+ V G  ++KGY+NRPE   +          +  ++TGD+AR
Sbjct: 1829 VYILDRTGHVQPAGIAGELCVSGEGLVKGYYNRPELTEEKFVPHPFTSGERMYKTGDLAR 1888

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
                G    I R    +   G  +   EIE  L TH +V  + V+ V     G+++    
Sbjct: 1889 WLPNGDIEFIGRIDHQVKIRGQRIELGEIEHQLQTHDRVQESVVLAVDQGA-GDKLLCAY 1947

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
               EG  ++  E+   A + L AY  P +     ELP+T  GKI +R L
Sbjct: 1948 YVGEG-DISSQEMREHAAKDLPAYMVPAVFIQMDELPLTGNGKIDRRAL 1995



 Score =  107 bits (267), Expect = 2e-25
 Identities = 132/527 (25%), Positives = 212/527 (40%), Gaps = 71/527 (13%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A+   +R A+ +      Y  +N  AN++A +L+  GI P D+V +         
Sbjct: 2550 LFEETAQRHKDRPAVTYNGQSWTYGELNAKANRLARILMDCGISPDDRVGVLTKPSLEMS 2609

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                         VP++     + IEY L+DSGAK L    G                  
Sbjct: 2610 XXXXXXXXXXXXFVPIDPDYPDQRIEYILQDSGAKLLLKQEG------------------ 2651

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAA-LNGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
                 I +P +       + G+ T  +  L+    E        +++A +IYTSGTTGQP
Sbjct: 2652 -----ISVPDSYTGDVILLDGSRTILSLPLDENDEENPETAVTAENLAYMIYTSGTTGQP 2706

Query: 186  KGAQLTHTNLL---------FNAVASSALFDQAPDSHDVFL-TVLPLFHIFGQTTMMNAA 235
            KG  + H  L+         F+  A       A    D  +  + P + I  +  ++  A
Sbjct: 2707 KGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAELHVIEEA 2766

Query: 236  LYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
            +          R D        E   VTI   +PT          +  ++  + +L   +
Sbjct: 2767 I----------RLDIVRLNDYFETNGVTI-TFLPTQL-------AEQFMELENTSLRVLL 2808

Query: 296  SGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKL 355
            +GG  L     R VK+ +   ++  YG +E + V +      +    SIG  I    + +
Sbjct: 2809 TGGDKL----KRAVKKPY--TLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYI 2862

Query: 356  VDENFNTIEGEG-PGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRD 407
            + E  N ++ EG  GE+ V G  + +GY NR +  A+       V  +  +RTGD+ +  
Sbjct: 2863 LGEG-NQVQPEGVAGELCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWT 2921

Query: 408  EEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIP 467
              G  +I    + + +R GY +   EIE  L    +V  AAV  V        I A+V P
Sbjct: 2922 GGGIEYIGRIDQQVKVR-GYRIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTP 2980

Query: 468  AEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             E A +  + L +  KE L  Y  P       ELP+TA GK+ ++ L
Sbjct: 2981 -ESADI--EALKSALKETLPDYMIPAFWVTLNELPVTANGKVDRKAL 3024


>ACSA_SYNAS RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  134 bits (336), Expect = 2e-33
 Identities = 133/515 (25%), Positives = 217/515 (42%), Gaps = 35/515 (6%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++    + AN++ S G+R GD+V +  P +P          + G V   +    +
Sbjct: 106 LTYRRLHEEVCRFANVMKSLGLRRGDRVTIYLPMIPELAVAMLACTRIGVVHSIVFAGFS 165

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  +   +RD   + +        G   LPL E A +A   V +C  +++       T S
Sbjct: 166 PESLRERIRDCQGRVVITADEGLRGGKPLPLKENADEA---VGKCP-FVEKVIVVRRTGS 221

Query: 144 AIP---GAETFWAALNGQPG-EFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFN 198
            IP   G +  W  L  +   +      + +D   I+YTSG+TG+PKG    T   LLF 
Sbjct: 222 QIPWTSGRDFDWEGLMQEASADCPPEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLFT 281

Query: 199 AVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEAL 254
           A++   +FD      D++     +  + G +  +   L    T V+   +P + D     
Sbjct: 282 AMSHQHIFDY--HDGDIYWCTADIGWVTGHSYTIYGPLANGATTVMFEGVPNYPDWSRFW 339

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDI-KQISQTLHTAVSGGASLPAEV----ARKV 309
            +++K  VTI    PT    L+  QGD  + K   +TL    + G  +  E        V
Sbjct: 340 RIVDKHGVTILYTAPTAIRALMR-QGDEPVRKTFRKTLRLLGTVGEPINPEAWLWYYNVV 398

Query: 310 KEKFGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGP 368
            EK    I++ +  +ET  ++    P   A KPGS   P +GV+  ++D     +EG G 
Sbjct: 399 GEK-RCPIVDTWWQTETGGILITPFPGAMALKPGSAARPYFGVKPAIMDSEGRFLEGTGT 457

Query: 369 GEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMII 423
           G + +          + G H R          G + TGD ARRDE+G Y+I  R  D+I 
Sbjct: 458 GNLVITEPWPGMLRTIYGDHQRFLDTYFSTYKGVYFTGDGARRDEDGDYWITGRVDDVIN 517

Query: 424 RGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI---PAEGATLTEDELIA 480
             G+ +                     G PH+  G+ I A+V      + +     EL++
Sbjct: 518 VSGHRLGTXXXXXXXXXXXXXXXXXXXGFPHEIKGQGIYAYVTLKTDRQPSDALRKELVS 577

Query: 481 WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           W +  + A   P  +++   LP T +GKI++R LR
Sbjct: 578 WVRREIGAIAAPDFIQWAPGLPKTRSGKIMRRILR 612


>AAS_KLEP3 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  134 bits (336), Expect = 2e-33
 Identities = 123/470 (26%), Positives = 205/470 (43%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+K+ L  PN      V FGA+  G +   +N     + +   +  + A+    FT    
Sbjct: 255 GEKIGLMLPNAGISAAVIFGAIARGRIPAMMNYTAGVKGLSSAI--AAAEINTIFTSRTF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +   ++ L    G  T A    +  W   +        V+ + +D
Sbjct: 313 LDKG-KLWHLPEQLTQVR-WVFLEDLKGDITLA----DKLWIFGHLLAPRLAQVKQQPED 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H +LL N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 AAMILFTSGSEGNPKGVVHSHKSLLANVEQIKTIADFT--ANDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L+    + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LLTPLFTGAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AK G++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKVGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEANAQ--VMRDGWFR 399
           ++ +L+      + G E  G + ++G  +MKGY           P A  Q      GW+ 
Sbjct: 540 MDARLL-----AMPGIEQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENQHGEKEAGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI   DE+G+  I  R+K      G  +    +E+V +      + A       + GE
Sbjct: 595 TGDIVTFDEQGYVRIQGRAKRFAKIAGEMISLEMVEQVALGASPDKMHATAIKQDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT + L+ +A++  +     PR + +  +LP+  +GK
Sbjct: 655 ALVLFTTDNE---LTREALLRYARQHGVPELAVPRDIRWLKQLPVLGSGK 701


>ACSA_SHEPA RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  133 bits (335), Expect = 3e-33
 Identities = 131/512 (25%), Positives = 219/512 (42%), Gaps = 27/512 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++    + AN L S+G+R GD V +  P VP          + GA+   +    +
Sbjct: 108 LTYGQLHAEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVAMLACARIGAIHSVVFGGFS 167

Query: 88  PREIEYHLRDSGAKALF-AFTGTPE---LPLGERAWQAFQEV-AECELYIDLPAAAGATT 142
           P  I   + D  +K +  A  G      +PL     +A       C   + +    G   
Sbjct: 168 PDSIASRVIDGNSKVVITADEGVRAGRIIPLKANIDEALSHPDVNCVEKVIVMKRTGGDI 227

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAV 200
           + + G + +W +L     E       G +D   ++YTSG+TG PKG    T   +++ A+
Sbjct: 228 NWVEGRDIWWGSLMETASEHCIPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAM 287

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-L 256
               +FD     ++V+     +  I G + M+   L    T+++   +P +     L  +
Sbjct: 288 THEYVFDYK--ENEVYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPTPARLGEM 345

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +++ KV I    PT+   L+ A+G    +     +L    S G  +  E  R   +  G 
Sbjct: 346 VDRHKVNILYTAPTLIRALM-AEGKEQFEGFDGSSLRIMGSVGEPINPEAWRWYNDVIGH 404

Query: 316 E---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N +EG   G +
Sbjct: 405 EKCPIVDTWWQTETGGILISPLPGATDTKPGSATRPFFGVQPALVDNIGNIVEGANEGNL 464

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H+R          G + TGD ARRDE+G+Y+I  R  D+I   G
Sbjct: 465 VILDSWPGQMRTVFGDHDRFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSG 524

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAK 483
           + +                     G PHD  G+ I A+V   +G+  TE+   EL  W +
Sbjct: 525 HRLGTXXXXXXXXXXXXXXXXXXXGYPHDIKGQGIYAYVTLTKGSVETEELRQELRQWVR 584

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + + A   P ++++   LP T +GKI++R LR
Sbjct: 585 KEIGALATPDLIQWAGGLPKTRSGKIMRRFLR 616


>ACSA_RHILW RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  133 bits (335), Expect = 3e-33
 Identities = 127/518 (24%), Positives = 219/518 (42%), Gaps = 31/518 (5%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +      + GAV   +  
Sbjct: 103 DKKVTYNELYEHVCRMANVLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYID---LP 135
             +P  +   + D   ++ F  T      G   +PL +    A    A   +++    + 
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDEGLRGGKPVPLKDNTDTAIHIAARQHVHVSKVLVV 220

Query: 136 AAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHT 193
              G  T   PG + +    +     E   V+ + +D   I+YTSG+TG+PKG    T  
Sbjct: 221 RRTGGKTGWAPGRDLWHHQEIATVKPECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGG 280

Query: 194 NLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-D 249
            L++ A+    +FD      DV+     +  + G + ++   L    T ++   +P F D
Sbjct: 281 YLVYAAMTHEYVFDY--HDGDVYWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPD 338

Query: 250 GDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV 309
                 +++K KV IF   PT    L+ A  D              + G  +  E     
Sbjct: 339 QGRFWEVIDKHKVNIFYTAPTAIRSLMGAGDDFVTXXXXXXXXXXGTVGEPINPEAWEWY 398

Query: 310 KEKFGIE---ILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNTIEG 365
               G +   +++ +  +ET   +    P     KPGS  +P +G++ +LVD     +EG
Sbjct: 399 YNVVGDKRCPVIDTWWQTETGGHMITPLPGAIDLKPGSATVPFFGIKPELVDNEGKVLEG 458

Query: 366 EGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD 420
              G + +          + G H+R          G + TGD  RRD +G+Y+I  R  D
Sbjct: 459 AADGNLCITDSWPGQMRTVYGDHDRFIQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDD 518

Query: 421 MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTEDE 477
           ++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V      EG      +
Sbjct: 519 VLNVSGHRLGTAEVESALVSHNLVSEAAVVGYPHPIKGQGIYCYVTLMAGHEGTDTLRQD 578

Query: 478 LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 579 LVKHVRAEIGPIAAPDKIQFAPGLPKTRSGKIMRRILR 616


>AAS_SHISS RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_SHIFL RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_SHIF8 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_SHIB3 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOSE RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOLC RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOHS RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO5E RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO57 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO55 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO24 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  133 bits (334), Expect = 4e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>ACSA_THEEB RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 656

 Score =  132 bits (333), Expect = 5e-33
 Identities = 144/526 (27%), Positives = 233/526 (44%), Gaps = 41/526 (7%)

Query: 24  GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           GD R L YA ++    Q AN+L   G++ GD+V +  P +P          + GA    +
Sbjct: 110 GDSRTLTYAQLHREVCQFANVLKQLGVKKGDRVGIYMPMIPEAAIAMLACARIGAPHSVV 169

Query: 83  NVLLTPREIEYHLRDSGAKALFAFTG----TPELPLGERAWQAF--QEVAECELYIDLPA 136
               +   +   L D+ AK +    G       +PL ++  +A   Q V   E  + +  
Sbjct: 170 FGGFSAEALRDRLIDAQAKLVVTADGGWRKDAIVPLKDQVDKALAHQGVPSVENVLVVQR 229

Query: 137 AAGATTSAIPGAETFWAALN-GQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195
                T  +PG + +W  L  G   +  +   + +D+  I+YTSG+TG+PKG  + HT  
Sbjct: 230 TQQPVTM-VPGRDHWWHDLQKGVSADCPAEPMDSEDLLFILYTSGSTGKPKG--VVHTTA 286

Query: 196 ---LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRFD 249
              L+  + +  +FD      DV+     +  I G + ++   L    T ++    PR  
Sbjct: 287 GYNLYTHITTQWVFDL--QDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRPS 344

Query: 250 GDEAL-SLMEKEKVTIFAGVPTMYWGLLNAQGDH--DIKQISQTLHTAVSGGASLPAEVA 306
                  ++EK  VTIF   PT     +   G+H    + +S +L    + G  +  E  
Sbjct: 345 NPGCFWDVIEKYGVTIFYTAPTAIRAFIK-MGEHLPRARDLS-SLRLLGTVGEPINPEAW 402

Query: 307 RKVKEKFGIE---ILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEMKLVDENFNT 362
                  G E   I++ +  +ET   +  + P     KPGS   P  G+   +VD   N 
Sbjct: 403 MWYYRVIGGERCPIVDTWWQTETGGHMITSLPGALPMKPGSASKPFPGILADVVDLEGNP 462

Query: 363 IEGEGPGEIAVRGHC--VMKGYHNRPEANAQVM------RDG--WFRTGDIARRDEEGFY 412
           +     G + +R     +M+  +  P+   +        RDG  ++  GD ARRDE+G++
Sbjct: 463 VGVNEGGYLVIRHPWPGMMRTVYGDPDRFRRTYWEHIPPRDGQYFYFAGDGARRDEDGYF 522

Query: 413 FIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGAT 472
           +++ R  D+I   G+ +   EIE  L++HP V+ AAVVG P +  GEEI AFVI    AT
Sbjct: 523 WVMGRVDDVINVSGHRLGTMEIESALVSHPAVAEAAVVGKPDEVKGEEIVAFVILEGSAT 582

Query: 473 ---LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                + EL       + A   P  + F   LP T +GKI++R LR
Sbjct: 583 PSDALQQELKQHVVNEIGALARPAEIRFTDALPKTRSGKIMRRLLR 628


>AAS_ECOLU RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (333), Expect = 5e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFSHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOLI RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (332), Expect = 7e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECODH RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (332), Expect = 7e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOBW RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (332), Expect = 7e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO7I RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (332), Expect = 7e-33
 Identities = 121/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGSSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>PPSD_BACSU RecName: Full=Plipastatin synthetase subunit D;       
            EC=2.3.1.-;AltName: Full=Peptide synthetase 4;Includes:
            RecName: Full=ATP-dependent proline adenylase;
          Length = 3603

 Score =  132 bits (331), Expect = 9e-33
 Identities = 135/519 (26%), Positives = 214/519 (41%), Gaps = 52/519 (10%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            +S L E  A   P+  A+V GD  L Y  ++  +N +A  L SRG++P   V +      
Sbjct: 2535 ISQLFEQQAARTPKASALVSGDKTLTYQELDEWSNGIARALRSRGVKPDTPVGIMMHRSF 2594

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                   G  KAG   VP++         Y L DSG K L       E  LG  A     
Sbjct: 2595 SMIASILGVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTIN---EADLGVLA----- 2646

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
               E E+ + + +      S +P   +                     +A IIYTSGTTG
Sbjct: 2647 -DFEGEI-LTIESVEEDDKSPLPQMSS------------------AHHLAYIIYTSGTTG 2686

Query: 184  QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIF--GQTTMMNAALYRHGT 241
            +PKG  + H       +A++  + +   + +   T+L LF     G  T M   L     
Sbjct: 2687 RPKGVMVEH-----KGIANTLQWRRNAYAFNETDTILQLFSFSFDGFITSMFTPLLSGAK 2741

Query: 242  MVLMPRFDGDEALSL---MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             VL+   +  + L++   + ++++T    VP +Y  LL+     D+K    TL      G
Sbjct: 2742 AVLLHEEEAKDILAIKHQLSRQRITHMIIVPVLYRALLDVVQPEDVK----TLRVVTLAG 2797

Query: 299  ASLPAE-VARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD 357
             +   E +AR +      E+   YG +E S   +      K    SIG PI G ++ +++
Sbjct: 2798 EAADRELIARSLAICPHTELANEYGPTENSVATTVMRHMEKQAYVSIGQPIDGTQVLILN 2857

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF-------RTGDIARRDEEG 410
             N         GE+ + G  + +GY N PE   +      F       RTGD AR   +G
Sbjct: 2858 SNHQLQPIGVAGELCIAGTGLARGYVNLPELTERAFTQNPFKPEARMYRTGDAARWMADG 2917

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R  D +   GY V  +EIE V+     V  AAVV     +   E+ A+V+   G
Sbjct: 2918 TLEYLGRIDDQVKIRGYRVETKEIESVIRCIKGVKDAAVVAHVTASGQTELSAYVVTKPG 2977

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
              L+ + + +  + +L  + +P  +E    LP++  GK+
Sbjct: 2978 --LSTNAVRSELQNKLPVFMHPAFIEKLDSLPLSPNGKL 3014



 Score =  130 bits (326), Expect = 3e-32
 Identities = 130/521 (24%), Positives = 218/521 (41%), Gaps = 53/521 (10%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
           +  + E  A   P+  A++     L Y  +N  AN++A  L  +G+   + VA+      
Sbjct: 465 IHAMFEKQAEKTPDAHAVIDQACSLTYRELNKAANRLARHLRMKGVVRQEPVAIMMERSA 524

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
            F     G LKAG  +VP++       I Y L D G   + +      LP          
Sbjct: 525 AFITGVLGILKAGGAIVPVDPHYPADRIRYILHDCGCSHVVS---QAHLPSSLEDNYIIT 581

Query: 124 EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
              + E  +D     G+   ++  A                     DD+  +IYTSGTTG
Sbjct: 582 HPEDIESKVD-----GSNIKSVNNA---------------------DDLLYMIYTSGTTG 615

Query: 184 QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMV 243
           +PKG Q  H N+  N +             DV     P F +  Q     +AL + GT+ 
Sbjct: 616 KPKGVQFEHRNMA-NLLKFEYTHSGIDFEADVLQFATPSFDVCYQEIF--SALLKGGTLH 672

Query: 244 LMP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
           ++P   + D  +  + + K +  I   +PT +  ++ ++ +          H   +G   
Sbjct: 673 IVPEAIKRDVPQLFAFINKHQTNIVF-LPTAFIKMIFSERELANSFPDGVKHLIAAGEQL 731

Query: 301 LPAEVARKVKEKFGIEILEGYGLSETSPVVSFN----NPKRKAKPGSIGLPIWGVEMKLV 356
           + +++ + V  K GI +   YG SET  V ++     +P  +  P  IG PI   ++ ++
Sbjct: 732 MISDLFQDVLRKRGIHLHNHYGPSETHVVSTYTIHPGDPIPELPP--IGKPIGCTDLYIL 789

Query: 357 DENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF-------RTGDIARRDEE 409
           +          PGE+ + G  V +GY N  +  +       F       RTGD+ARR E+
Sbjct: 790 NHQKQLQPCGVPGELYISGASVARGYVNHDKLTSDKFSSDPFKPDVIMYRTGDLARRLED 849

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE-EIKAFVIPA 468
           G    I R+ + +   GY + P+EIE  LM HP +S AA++ +  D +GE E+ A+    
Sbjct: 850 GNIEYIGRADNQVKIRGYRIEPQEIEVTLMNHPDISEAAIL-IWQDQNGEHELCAYYCSV 908

Query: 469 EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
           +   L   +L ++    L  Y  P    +   +P+T  GK+
Sbjct: 909 Q--KLNTIDLRSYMASELPEYMIPAKWIWVDSIPLTPNGKV 947



 Score =  123 bits (309), Expect = 3e-30
 Identities = 131/524 (25%), Positives = 218/524 (41%), Gaps = 49/524 (9%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            L   LE  A   P++ A++F D  + Y  +N  AN++A  L+ RG++P   VA+     P
Sbjct: 1496 LHYALEQQAEKTPDQAAVIFEDGVMTYKELNEQANRIAWELIGRGVKPETTVAIIGKRSP 1555

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                  +G LKAG   +P++       I + L DSG   L   +    +P          
Sbjct: 1556 EMLLGIYGILKAGGAYLPIDPDYPEERISFLLEDSGTNILLLQSAGLHVP---------- 1605

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTG 183
            E     +Y++   +  A   + P  +    +L                 A +IYTSG+TG
Sbjct: 1606 EFTGEIVYLNQTNSGLAHRLSNPNVDVLPQSL-----------------AYVIYTSGSTG 1648

Query: 184  QPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMV 243
             PKG ++ H + + N + S  L  +    H   +     +        +    Y   ++ 
Sbjct: 1649 MPKGVEIEHRSAV-NFLNS--LQSRYQLKHSDMIMHKTSYSFDASIWELFWWPYAGASVY 1705

Query: 244  LMPRFDGDEA---LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGAS 300
            L+P+    E       +E++K+T    VP+M    L       +   +  L    SGG  
Sbjct: 1706 LLPQGGEKEPEVIAKAIEEQKITAMHFVPSMLHAFLEHIKYRSVPIKTNRLKRVFSGGEQ 1765

Query: 301  LPAEVARKVKEKF-GIEILEGYGLSETSPVVSFNN--PKRKAKPGSIGLPIWGVEMKLVD 357
            L   +  +  E    + I   YG +E +   +F +  P  K +   IG P+  V + L++
Sbjct: 1766 LGTHLVSRFYELLPNVSITNSYGPTEATVEAAFFDCPPHEKLERIPIGKPVHHVRLYLLN 1825

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWF-------RTGDIARRDEEG 410
            +N   +     GE+ + G  V +GY NRP    +   +  F       +TGD+AR   +G
Sbjct: 1826 QNQRMLPVGCIGELYIAGAGVARGYLNRPALTEERFLEDPFYPGERMYKTGDVARWLPDG 1885

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
                + R+ D +   GY + P EIE  L +   V  AAV  V  D+   E+ A+V   EG
Sbjct: 1886 NVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVT-VRTDSGEPELCAYV---EG 1941

Query: 471  ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
              L  +E+ A  +  L  Y  P  +    + P+T +GK+ +  L
Sbjct: 1942 --LQRNEVRAQLERLLPGYMVPAYMIEMEQWPVTPSGKLDRNAL 1983


>BACC_BACLI RecName: Full=Bacitracin synthetase 3;       
            Short=BA3;Includes:  RecName: Full=ATP-dependent
            isoleucine adenylase;           Short=IleA;
          Length = 6359

 Score =  132 bits (331), Expect = 9e-33
 Identities = 133/524 (25%), Positives = 221/524 (42%), Gaps = 69/524 (13%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A   PE  A+V G+ +L Y  +N  +NQ+A  L  +G++    VA+     P   
Sbjct: 5552 LFEEQAEKTPELAAVVSGNDKLTYRELNEKSNQLARYLRDKGVKADTIVAIMAERSPEMV 5611

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                G LKAG   +P++       I+Y L DSGA  + A     +  LG       QE  
Sbjct: 5612 VGIMGILKAGGAYLPIDPDYPEERIKYMLEDSGAAIILA---DHKQDLGT----LHQEAV 5664

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
            E                 + G  + + A N +P          D +A IIYTSG+TG+PK
Sbjct: 5665 E-----------------LTGDFSSYPADNLEPAG------NADSLAYIIYTSGSTGKPK 5701

Query: 187  GAQLTHTNLLFNAVASSALFDQAPD-------SHDVFLTVLPLFH--IFGQTTMMNAALY 237
            G  +    L+     +  ++ Q          S    LTV  +F   I G   ++    Y
Sbjct: 5702 GVMIRQRGLVNYITWADRVYVQGEQLDFALYSSIAFDLTVTSIFTPLISGNRVIV----Y 5757

Query: 238  RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
            RH         DG+  +  + +++    AG+  +    L+   D D      ++   + G
Sbjct: 5758 RHSE-------DGEPLIRKVFRDQK---AGIVKLTPSHLSLVKDMDAS--GSSIKRLIVG 5805

Query: 298  GASLPAEVARKVKEKF--GIEILEGYGLSET---SPVVSFNNPKRKAKPGSIGLPIWGVE 352
            G  L  E+A+++ E+F   IEI   YG +ET     +  ++    +     IG P   V+
Sbjct: 5806 GEDLKTELAKEITERFHHNIEIYNEYGPTETVVGCMIYQYDAGWDRQVSVPIGKPASNVQ 5865

Query: 353  MKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIAR 405
            + ++DE          GE+ + G  V KGY N+PE  ++       +  +  +RTGD+A+
Sbjct: 5866 LYILDERQEVQPVGIAGELYISGDGVAKGYLNKPELTSEKFLPNPFLPGERMYRTGDLAK 5925

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
               +G    + R    +   GY +   EIE  L+ H  +  AAV       + + + A+V
Sbjct: 5926 MRPDGHIEYLGRIDHQVKIRGYRIELGEIEHQLLRHSDIKEAAVAAKTDQNNDQVLCAYV 5985

Query: 466  IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
            +      +T+ ++  +  + L  Y  P  +    ELP+T  GK+
Sbjct: 5986 VSER--DITQKDIKTFLAKELPEYMVPSYLLKLDELPLTPNGKV 6027



 Score =  125 bits (314), Expect = 8e-31
 Identities = 130/519 (25%), Positives = 213/519 (41%), Gaps = 52/519 (10%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L  + A   P++ A+VF D  L Y  ++  +NQ+A  L  +G++P   V +     P   
Sbjct: 1501 LFAERAETSPDKTAVVFEDQTLTYRQLHERSNQLARFLREKGVQPDTAVGIMVDRSPEMX 1560

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                          PL+       I+Y L DS  K L +     E  + +RA+    ++ 
Sbjct: 1561 XXXXXXXXXXXXXXPLDPAYPEDRIKYILGDSQTKFLLS----EEALIKKRAFIKEADMI 1616

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
              +++    AA  A                    + E V   GD +A IIYTSG+TG+PK
Sbjct: 1617 NIDIHDKQIAAQDAA-------------------QLEPVSRSGD-LAYIIYTSGSTGKPK 1656

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL----FHIFGQTTMMNAALYRHGTM 242
            G  +    L     A   L      S  +    L      F IF       +AL      
Sbjct: 1657 GVLIEQKGLSNLVSAVVKLMHLNTGSRVIQFASLSFDASAFEIF-PALAAGSALVLGRQE 1715

Query: 243  VLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLP 302
             +MP   G    S + +  +T  A +P     +LN  G  ++K I       VS G++  
Sbjct: 1716 EMMP---GQPLTSFLRQYNIT-HATLPPTVLDVLNESGLENLKVI-------VSAGSACS 1764

Query: 303  AEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNT 362
             E+A++         +  YG +ET+   +    +   +P  IG PI    + ++D+N   
Sbjct: 1765 EELAKRWSGNR--LFINAYGPTETTVCATAGIYEGSGRP-HIGSPIANTNVYVLDQNQKP 1821

Query: 363  IEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDEEGFYFII 415
            +     GE+ V G  + +GY NRPE  A+          +  +RTGD+AR   +G    +
Sbjct: 1822 VPTGVVGELCVGGMSLARGYLNRPELTAEKFISHPFASGERLYRTGDLARWLPDGHLEFL 1881

Query: 416  DRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE 475
             R    +   GY +   EIE  L+   ++  AAV+    D H + + A+++  E  T T 
Sbjct: 1882 GRIDHQVKIRGYRIELGEIENQLLKLDKIDEAAVIARKDDDHSDYLCAYIVSKEDWTST- 1940

Query: 476  DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             E+  W ++ L  Y  P       +LP+T+  K+ ++ L
Sbjct: 1941 -EISEWLEKELPHYMIPAYFVRLDKLPLTSNDKVDRKAL 1978



 Score =  117 bits (293), Expect = 2e-28
 Identities = 125/518 (24%), Positives = 208/518 (40%), Gaps = 49/518 (9%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E+ A   P   A+VF    L+Y  +N  +NQ+A LL  +G++P   V +         
Sbjct: 3005 LFEEQAERTPGHTAVVFEKEELSYKALNERSNQLAGLLREKGVKPDMIVGVMAERSVEMI 3064

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAG   +P++       I Y + DSG   L                +A +++ 
Sbjct: 3065 VGMLAVLKAGGAYLPIDPEYPEDRIRYMIEDSGISILLK--------------KADKQID 3110

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
                 ID+     A   A                E     +   D+A +IYTSG+TG+PK
Sbjct: 3111 VDFTCIDMNEKGLAKDMA---------------AENLGHTSGSSDMAYVIYTSGSTGKPK 3155

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
            G  + H +++         +  +  + D  L V P F        +   L     +VL+ 
Sbjct: 3156 GVMVNHQSIVNTLYWRKQSYGYS--TADATLQV-PSFSFDSSVEDIFTTLISGAKLVLIR 3212

Query: 247  --RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAE 304
              R +  E + ++   K T    VP+ Y  LL+      I+Q    L      G      
Sbjct: 3213 DLRMNPREIIGVLRTHKATNLLAVPSFYLNLLDT-----IEQPLDDLRFVTVAGEGFNES 3267

Query: 305  VARKVKEKF-GIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTI 363
            + R+  EK   +++   YG +E S   +    ++  +   IG PI   ++ +++ N   +
Sbjct: 3268 LIRQHFEKLPNVKLFNEYGPTENSVCSTRGELRKDDEKVVIGRPISNHKVYILNHNQQLL 3327

Query: 364  EGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDEEGFYFIID 416
                PGE+ + G  + +GY NRP+        N     +  +RTGD+AR   +G    + 
Sbjct: 3328 PLGTPGELCLSGEGLARGYLNRPDLTLEKFVPNPFAPGESMYRTGDLARFLPDGQIEYLG 3387

Query: 417  RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
            R    +   G+ +   EIE  L+    +  AAV+       G+ + A+++ A+ A    D
Sbjct: 3388 RIDHQVKIRGFRIELGEIENQLLKIEGIDAAAVMAREDQAGGKYLCAYIV-ADKAAGVAD 3446

Query: 477  ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
                  KE L  Y  P       +LP+TA GKI ++ L
Sbjct: 3447 VRKCLLKE-LPDYMVPSYFVKLDQLPLTANGKIDRKAL 3483



 Score =  114 bits (284), Expect = 2e-27
 Identities = 134/528 (25%), Positives = 216/528 (40%), Gaps = 59/528 (11%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
           L  L E+ A   P+  A+VFG  R+ Y  +N  ANQ A LL  +GI  G           
Sbjct: 461 LHELFEEQAMKTPDHTALVFGAQRMTYRELNEKANQTARLLREKGIGRGSXXXXXXDRSF 520

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                    LKAG   +P++       I + L D+ A  L A         G+ A     
Sbjct: 521 EMXXXXXXXLKAGGAYLPIDPETPKHRIAFMLSDTKAGVLLA--------QGKAA----- 567

Query: 124 EVAECE---LYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSG 180
           +  +CE   +++D   A G +   +                  SV   GD  A IIYTSG
Sbjct: 568 DGIDCEADIIHLDKGVADGFSKKRL-----------------SSVNDSGD-TAYIIYTSG 609

Query: 181 TTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHG 240
           +TG PKG    H +     V ++   D   D  D  L  L  +   G    +  AL    
Sbjct: 610 STGMPKGVVTPHYSAA-RVVKNTNYIDITED--DAILQ-LSNYSFDGSVFDIFGALLNGA 665

Query: 241 TMVLMPR---FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
           ++VL+ +    +  E   +++KE+V++      +   L N   D +I  +++ L     G
Sbjct: 666 SLVLIEKETVLNTHELAEVIKKEQVSVM----FITTALFNTLADINIGCLAK-LRKIFLG 720

Query: 298 GASLPAEVARKVKEKFGIE-ILEGYGLSETSPVVSF---NNPKRKAKPGSIGLPIWGVEM 353
           G        RKV    G + ++  YG +E++   ++   N    +A+   IG P+    +
Sbjct: 721 GERASIPHVRKVLNHVGRDKLIHVYGPTESTVYATYYFINEIDDEAETIPIGSPLANTSV 780

Query: 354 KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARR 406
            ++DE    +    PGE+ + G  + KGY NR E  A+       +  +  ++TGD+A+ 
Sbjct: 781 LIMDEAGKLLPIGVPGELCIAGDGLSKGYLNREELTAEKFIPHPFIPGERLYKTGDLAKW 840

Query: 407 DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
             +G    I R    +   G+ +   EIE  L  H  ++   +V V  D          I
Sbjct: 841 LPDGNIEFIGRIDHQVKIRGFRIELGEIESRLEMHEDIN-ETIVTVREDEESRPYICAYI 899

Query: 467 PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            A    ++ DEL  +  E+L  Y  P       +LP+T  GK+ ++ L
Sbjct: 900 TA-NREISLDELKGFLGEKLPEYMIPAYFVKMDKLPLTKNGKVDRKAL 946



 Score =  109 bits (273), Expect = 5e-26
 Identities = 126/521 (24%), Positives = 209/521 (40%), Gaps = 54/521 (10%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            L E  A   PE+ A+V+ D +L Y  +N  ANQ+A LL  +G      VA+         
Sbjct: 4037 LFEQQADKTPEQTAVVYADEKLTYRELNERANQLARLLRDKGADADQPVAIMIEPSLEMI 4096

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                  LKAGA  VP+      +     L DS A A+    G+    + E    A + V 
Sbjct: 4097 ISMLAVLKAGAAYVPIEPEQLAKRTNEILSDSRA-AILLVKGS----VKENVAFAGEIVN 4151

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
              +  ID   A+  + S                          D  A IIYTSG+TG+PK
Sbjct: 4152 VADGLIDAKVASNLSASG-----------------------SADQNAYIIYTSGSTGKPK 4188

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
            G  + H N++     +  + +     +D  + V       G T++ +A L   G+ + + 
Sbjct: 4189 GVFVRHGNVV--NYTTWFMKEAGLTENDKAMLVSSYAFDLGYTSIFSALL--SGSELHIA 4244

Query: 247  R----FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLP 302
            R     +   AL  +++  +T     P+++   +N  G    ++   TL   V GG  + 
Sbjct: 4245 RKECYTNAHRALKYIKENGITYIKLTPSLFNIFVNDPG-FSAEKPCATLRLVVLGGEMIN 4303

Query: 303  AEVARKVKEKFGIE-ILEGYGLSETS--PVVSFNNPKR----KAKPGSIGLPIWGVEMKL 355
                     ++    ++  YG +ET+   V    +P+     K  P  IG PI      +
Sbjct: 4304 TRDVETFYNQYPDHVVMNHYGPTETTIGSVFKVIDPEHLDSFKECP-VIGTPIHNTNAYV 4362

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WFRTGDIARRDE 408
            +DEN   +     GE+ + G  V  GY NRP+   +   +         +RTGD+ARR  
Sbjct: 4363 LDENMKLLPEGVYGELCIAGAGVTGGYVNRPDETKEKFIENPFAPHTKMYRTGDLARRLS 4422

Query: 409  EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
            +G   +  R    +   GY + P EI+  L+ H  +  A +         +++ A+    
Sbjct: 4423 DGNIELAGRIDTQVKVRGYRIEPEEIKNRLLAHDDIKEAFIAAREDHKGAKQLCAYF--T 4480

Query: 469  EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
              A L  +++  +    L  Y  P       ++P++A GKI
Sbjct: 4481 ADAELPFEDIRTYLMHELPEYMIPSSFVQIEKMPLSANGKI 4521


>ACSA_SHESH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  132 bits (331), Expect = 9e-33
 Identities = 131/512 (25%), Positives = 216/512 (42%), Gaps = 27/512 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           + Y  ++    + AN L S+G+R GD V +  P VP    V     + GAV   +    +
Sbjct: 108 ITYGELHSDVCKFANALRSQGVRRGDIVTVYMPMVPEAAVVMLACARIGAVHSVVFGGFS 167

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEV-AECELYIDLPAAAGATT 142
           P  I   + D  +K +        G   +PL     +A      +C   + +    G   
Sbjct: 168 PDSIASRVIDGKSKVIITADEGVRGGRIIPLKANIDEALSHPDVDCVEKVIVLERTGGDV 227

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAV 200
           + + G +  W +L     E       G +D   ++YTSG+TG PKG    T   +++ A+
Sbjct: 228 NWVEGRDIKWESLMDTASEHCIPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAM 287

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-L 256
               +FD      +V+     +  I G + M+   L    T+++   +P +     L  +
Sbjct: 288 THEYVFDYKDG--EVYWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNYPTPARLGEM 345

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +++ KV I    PT+   L+ A+G          +L    S G  +  E  R   E  G 
Sbjct: 346 VDRHKVNILYTAPTLIRALM-AEGKEQFADFDGSSLRIMGSVGEPINPEAWRWYNEVIGH 404

Query: 316 E---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N I+G   G +
Sbjct: 405 EHCPIVDTWWQTETGGILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIIDGATEGNL 464

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H+R          G + TGD A+RDE+G+Y+I  R  D+I   G
Sbjct: 465 VILDSWPGQMRTVFGDHDRFALTYFKTFRGMYFTGDGAKRDEDGYYWITGRVDDVINVSG 524

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAK 483
           + +                     G PHD  G+ I A+V   +G   TE+   EL  W +
Sbjct: 525 HRLGTXXXXXXXXXXXXXXXXXXXGYPHDIKGQGIYAYVTLTKGTIETEELRQELRKWVR 584

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + + A   P ++++   LP T +GKI++R LR
Sbjct: 585 KEIGALATPDLIQWAGGLPKTRSGKIMRRFLR 616


>ACSA_SCHPO RecName: Full=Probable acetyl-coenzyme A synthetase;    
               EC=6.2.1.1;AltName: Full=Acetate--CoA
           ligase;AltName: Full=Acyl-activating enzyme;
          Length = 662

 Score =  132 bits (331), Expect = 9e-33
 Identities = 141/542 (26%), Positives = 236/542 (43%), Gaps = 40/542 (7%)

Query: 7   LLEDGARNRPERDAIVFGDMRLN------YALVNMIANQVANLLVSRGIRPGDKVALACP 60
           L++  A  RP+  A+++     N      Y  +    +Q A  L S G+  GD+VA+  P
Sbjct: 91  LVDRHAIARPDAVALIYEADEPNQGRYITYRELLASVSQCAGALQSMGVGMGDRVAIYMP 150

Query: 61  NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALF----AFTGTPELPLGE 116
            +P         ++ GA+   +    +   +   + DS  K +     +  G   +PL  
Sbjct: 151 MIPETIIAMLAIVRLGAIHSVIFAGFSAESVADRVNDSECKVIITADESHRGGKRIPLKG 210

Query: 117 RAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQ-PGEFESVRTEGDDVAVI 175
              +A  E    +  +    +A  T S + G + +W  +  + P          +    +
Sbjct: 211 VVNKALTECPTIKKVLVFQRSAEPTASMVEGRDVWWHDIIPKFPRYCPPAVVNPEHPLFL 270

Query: 176 IYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSH-----DVFLTVLPLFHIFGQT 229
           +YTSG+TG+PKG    T   LL  A     +FD  P        DV       + ++G  
Sbjct: 271 LYTSGSTGKPKGVVHCTGGYLLGAAATCKYVFDLHPTDRMGCAGDVGWITGHTYIVYGPL 330

Query: 230 TMMNAALYRHGTMVLMPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
            +  A L    T    P + D     S++E+ ++T +   PT    LL   G+  +K   
Sbjct: 331 MLGAATLVFEST----PAYPDYSRYWSVVERHRLTQWYIAPTAI-RLLQRAGNEFVKHDR 385

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSET-SPVVSFNNPKRKAKPGSI 344
            +L    S G  +  E      E  G +   + + Y  +ET S +V+   P    KPGS 
Sbjct: 386 SSLRVLGSVGEPIAPESFMWYYEVVGEKRCAVADTYWQTETGSHIVTSLGPVTPMKPGSA 445

Query: 345 GLPIWGVEMKLVDE-NFNTIEGEG-PGEIAVRG------HCVMKGYHNRPEANAQVMRDG 396
            LP +G++  ++D      IEG    G +A+R         V +G H+R          G
Sbjct: 446 TLPFFGIDAVIIDPLTGKIIEGNDVEGVLAIRSPWPSAARTVWRG-HDRYIDTYLKPYPG 504

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           ++ TGD A RD++G+ +I  R  D++   G+ +   EIE  L++H  V+ +AVVGV  + 
Sbjct: 505 FYFTGDGATRDKDGYIWIRGRVDDVVNISGHRLSTAEIEAALLSHDAVAESAVVGVHDEL 564

Query: 457 HGEEIKAFVIPAEGATLT---EDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRE 513
            G+ + AF++   G   T   E ELI   +  +  +  PR + F ++LP T +GKI++R 
Sbjct: 565 TGQAVNAFILLKPGYEATVELEKELIMAVRSTIGPFASPRKLIF-SDLPKTRSGKIMRRI 623

Query: 514 LR 515
           LR
Sbjct: 624 LR 625


>ACSA1_PSEAE RecName: Full=Acetyl-coenzyme A synthetase 1;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 1;AltName:
           Full=Acyl-activating enzyme 1;
          Length = 651

 Score =  132 bits (331), Expect = 9e-33
 Identities = 129/499 (25%), Positives = 212/499 (42%), Gaps = 27/499 (5%)

Query: 41  ANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGA 100
           AN L  + +  GD V +  P +P          + GA+   +    +P  +   + D  +
Sbjct: 121 ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACTRIGAIHSVVFGGFSPEALAGRIIDCKS 180

Query: 101 KALFA----FTGTPELPLGERAWQAFQEVAECELY-IDLPAAAGATTSAIPGAETFWAAL 155
           K +        G    PL      A        +  I +    GA        + ++  L
Sbjct: 181 KVVITADEGVRGGKRTPLKANVDDALTNPETSSVQKIIVCKRTGAEIKWNQHRDVWYDDL 240

Query: 156 NGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSH 213
               G   + +  G +D   I+YTSG+TG+PKG    T   L++ ++    +FD  P   
Sbjct: 241 MKVAGSTCAPKEMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTHERVFDYRPG-- 298

Query: 214 DVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVP 269
           +V+     +  + G T ++   L    T +L   +P + D      +++K KV I    P
Sbjct: 299 EVYWCTADIGWVTGHTYIVYGPLANGATTILFEGVPNYPDVTRVAKIIDKHKVNILYTAP 358

Query: 270 TMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSE 325
           T    ++ A+G   +      +L    S G  +  E  +   E  G     I++ +  +E
Sbjct: 359 TAIRAMM-AEGKAAVAGADGSSLRLLGSVGEPINPEAWQWYYETVGQSRCPIVDTWWQTE 417

Query: 326 TSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VM 379
           T   +    P   A KPGS   P +GV   LVD   N IEG   G + +          +
Sbjct: 418 TGACLMTPLPGAHAMKPGSAAKPFFGVVPALVDNLGNLIEGAAEGNLVILDSWPGQARTL 477

Query: 380 KGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLM 439
            G H+R          G + TGD ARRDE+G+Y+I  R  D++   G+ +   E+E  ++
Sbjct: 478 FGDHDRFVDTYFKTFKGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEVESAMV 537

Query: 440 THPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE---DELIAWAKERLAAYKYPRIVE 496
            HP+V+ AAVVG+ HD  G+ I  +V    G   +E    EL  W +  +     P +++
Sbjct: 538 AHPKVAEAAVVGMQHDIKGQGIYVYVTLNSGVEPSEALRQELKQWVRREIGPIATPDVIQ 597

Query: 497 FRTELPMTATGKILKRELR 515
           +   LP T +GKI++R LR
Sbjct: 598 WAPGLPKTRSGKIMRRILR 616


>AAS_ECOSM RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (331), Expect = 9e-33
 Identities = 121/470 (25%), Positives = 201/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+ + L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GEHIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOL6 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (331), Expect = 9e-33
 Identities = 120/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        ++ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQLKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO27 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  132 bits (331), Expect = 9e-33
 Identities = 120/470 (25%), Positives = 202/470 (42%), Gaps = 36/470 (7%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        ++ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQLKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGWFR 399
           ++ +L+     ++ G E  G + ++G  +M GY              E     M  GW+ 
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYD 594

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + GE
Sbjct: 595 TGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGE 654

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 655 ALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>ACVS_CEPAC RecName:
           Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine
           synthase;         EC=6.3.2.26;AltName:
           Full=Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine
           synthetase;
          Length = 3712

 Score =  131 bits (329), Expect = 1e-32
 Identities = 130/541 (24%), Positives = 226/541 (41%), Gaps = 64/541 (11%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L E+ A  RP+  A++ GD R+ Y  +N +AN++A+ LVS GI+    V L         
Sbjct: 265 LFEEAAVRRPQHVALICGDKRITYEELNAMANRLAHHLVSSGIQTEQLVGLFLDKTELMI 324

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G  K+GA  VP++       +++ L D+ A+ + A     +    E          
Sbjct: 325 ATILGIWKSGAAHVPIDPGYPDERVKFVLNDTKAQVVIASQRHVDRLRAE---------- 374

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQP-------GEFESVRTEGDDVAVIIYTS 179
                     A G     I G E+ +  L  Q        G    +      +A + YTS
Sbjct: 375 ----------AVGGQHLRIIGLESLFDNLAQQTQHSPETSGNLTHLPLNSKQLAYVTYTS 424

Query: 180 GTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP-LFHIFGQTTMMNAALYR 238
           GTTG PKG    HT+++ +    SA +  A +  +V L     +F  F +  +M  AL  
Sbjct: 425 GTTGFPKGIYKEHTSVVNSITDLSARYGVAGEDDEVILVFSAYVFEPFVRQMLM--ALTT 482

Query: 239 HGTMVLM---PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
             ++ ++    +FD D  +  ++K KVT      ++         ++D      +L   +
Sbjct: 483 GNSLAIISDEDKFDPDTLIPFIQKHKVTYIHATSSVL-------QEYDFGS-CPSLKRMI 534

Query: 296 SGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAKPGSIGLPIWGVEM 353
             G +L       ++++F   IL  YG +E++ V + N   P  + K  S+G P+  V+ 
Sbjct: 535 LVGENLTEPRYEALRQRFKSRILNEYGFTESAFVTALNIFEPTSQRKDMSLGRPVRNVKC 594

Query: 354 KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQV---------------MRDGWF 398
            ++D N   +     GE+ + G  + +GY NR E   Q                +    +
Sbjct: 595 YILDANLKRVPIGVTGELHIGGLGISRGYMNREELTRQKFLPNPYQTDKERQRGVNSTMY 654

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
           +TGD+AR    G    + R+   I   G  + P EIE  L  +P +  + VV     + G
Sbjct: 655 KTGDLARWLPSGEVEYLGRADFQIKLRGIRIEPGEIESTLAMYPGIRASIVVSKKLLSQG 714

Query: 459 EE-----IKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRE 513
           +E     +  + +  EG  + E +L+++ +++L  Y  P  +    ++P    GK   R 
Sbjct: 715 QETIQDHLVGYYVCDEG-HIPEGDLLSFLEKKLPRYMVPTRLVQLAQIPTNINGKADLRA 773

Query: 514 L 514
           L
Sbjct: 774 L 774



 Score =  114 bits (286), Expect = 1e-27
 Identities = 123/533 (23%), Positives = 218/533 (40%), Gaps = 61/533 (11%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRG-IRPGDKVALACPNV 62
            L  + E  A+ +P++ A+V+ D+RL Y  +N  AN +A  L+S+  I+P   V L     
Sbjct: 1363 LHAMFESEAQQKPDKVAVVYEDIRLTYRELNSRANALAFYLLSQAAIQPNKLVGLIMDKS 1422

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
             +         K G   VP++     + I+Y L D+ A A+   T +P +          
Sbjct: 1423 EHMITSILAVWKTGGAYVPIDPRYPDQRIQYILEDTAALAVI--TDSPHIDRLRSITNNR 1480

Query: 123  QEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
              V + +  + LP +     S            N +P           D+A I+YTSGTT
Sbjct: 1481 LPVIQSDFALQLPPSPVHPVS------------NCKPS----------DLAYIMYTSGTT 1518

Query: 183  GQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQ-TTMMNAALYRHGT 241
            G PKG  + H  ++   V+   LF       +V L+     ++F      M  AL    T
Sbjct: 1519 GNPKGVMVEHHGVVNLCVSLCRLFGLRNTDDEVILSFSN--YVFDHFVEQMTDALLNGQT 1576

Query: 242  MVLM---PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
            +V++    R D +     +E  +VT  +G P++          ++  +    L      G
Sbjct: 1577 LVVLNDEMRGDKERLYRYIETNRVTYLSGTPSVI-------SMYEFDRFRDHLRRVDCVG 1629

Query: 299  ASLPAEVARKVKEKFGIEILEGYGLSETSPVV---SFNNPKRKAKPGSIGLPIWGVEMKL 355
             +    V  K++E F   I+ GYG +E S       +  P+R+    SIG  +      +
Sbjct: 1630 EAFSEPVFDKIRETFPGLIINGYGPTEVSITTHKRPYPFPERRTDK-SIGCQLDNSTSYV 1688

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANA-----------QVMRDG----WFRT 400
            ++++   +     GE+ + G  V +GYHNRP+  A           Q   +G     ++T
Sbjct: 1689 LNDDMKRVPIGAVGELYLGGDGVARGYHNRPDLTADRFPANPFQTEQERLEGRNARLYKT 1748

Query: 401  GDIAR----RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
            GD+ R     + +G    + R+   +   G  +   EIE VL ++P +  + V+      
Sbjct: 1749 GDLVRWIHNANGDGEIEYLGRNDFQVKIRGQRIELGEIEAVLSSYPGIKQSVVLAKDRKN 1808

Query: 457  HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
             G++       +   +L+   +  +    L  Y  P  +    + P+T +GK+
Sbjct: 1809 DGQKYLVGYFVSSAGSLSAQAIRRFMLTSLPDYMVPAQLVPIAKFPVTVSGKL 1861



 Score =  102 bits (255), Expect = 6e-24
 Identities = 121/539 (22%), Positives = 214/539 (39%), Gaps = 69/539 (12%)

Query: 3    NLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRG-IRPGDKVALACPN 61
            +L  L ED   + P+R AI  G   L+Y+ +N  ANQ+ +L++S   I   D++AL    
Sbjct: 2436 SLHGLFEDIVASTPDRIAIADGTRSLSYSELNERANQLVHLIISSASIVADDRIALLLDK 2495

Query: 62   VPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQA 121
                        KAGA  VPL+     +  E  L +S A+ L   T     P G      
Sbjct: 2496 SIDMVIALLAVWKAGAAYVPLDPTYPSQRTELILEESSARTLI--TTRKHTPRGG----- 2548

Query: 122  FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSG 180
                            A   +  +   ET  A LN Q  E  +  T+   D+A +I+TSG
Sbjct: 2549 --------------TVANVPSVVLDSPETL-ACLNQQSKENPTTSTQKPSDLAYVIFTSG 2593

Query: 181  TTGQPKGAQLTHTNL--LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
            TTG+PKG  + H ++  L N++     F +   SH V      +F    +   ++     
Sbjct: 2594 TTGKPKGVLVEHQSVVQLRNSLI-ERYFGETNGSHAVLFLSNYVFDFSLEQLCLSVL--- 2649

Query: 239  HGTMVLMPRFDG---DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295
             G  +++P  +G   +    +  +EK++  +G P++   +  ++  H        LH   
Sbjct: 2650 GGNKLIIPPEEGLTHEAFYDIGRREKLSYLSGTPSVLQQIELSRLPH--------LHMVT 2701

Query: 296  SGGASLPAEVARKVKEKFGIEILEGYGLSETSP---VVSFNNPKRKAKPGSIGLPIWGVE 352
            + G    A    K++ +F  +I   YG++ET+    + +F       K    G+P  G  
Sbjct: 2702 AAGEEFHASQFEKMRSQFAGQINNAYGITETTVYNIITTFKGDAPFTKALCHGIP--GSH 2759

Query: 353  MKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNR---------------PEANAQVMRDGW 397
            + ++++    +     GE+ + G C+ +GY N+               P+  +       
Sbjct: 2760 VYVLNDRLQRVPFNAVGELYLGGDCLARGYLNQDALTNERFIPNPFYEPKQASDSRPQRL 2819

Query: 398  FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
            ++TGD+ R         + R    +   G+ +   E+ + ++    V  AAV+   +D  
Sbjct: 2820 YKTGDLVRFRGPHHLEYLGRKDQQVKLRGFRIELSEVRDAVLAISAVKEAAVI-PKYDED 2878

Query: 458  GEE------IKAFVIPAEGATLTEDELIAWAKERLAAYKYP-RIVEFRTELPMTATGKI 509
            G +      I  +     G       +       L  Y  P +I +    LP+T  GK+
Sbjct: 2879 GSDSRRVSAIVCYYTLNAGTVCEASSIRDHLHANLPPYMVPSQIHQLEGSLPVTVNGKL 2937


>AAS_KLEP7 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  131 bits (329), Expect = 1e-32
 Identities = 121/472 (25%), Positives = 203/472 (43%), Gaps = 36/472 (7%)

Query: 50  RPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGT 109
           +PG+K+ L  PN      V FGA+  G +   +N     + +   +  + A+    FT  
Sbjct: 253 QPGEKIGLMLPNAGISAAVIFGAIARGRIPAMMNYTAGVKGLSSAI--AAAELNTIFTSR 310

Query: 110 PELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
             L  G + W   +++ +   ++ L    G  T A    +  W   +        V+ + 
Sbjct: 311 TFLDKG-KLWHLPEQLTQVR-WVFLEDLKGDITLA----DKLWIFAHLLAPRLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           +D A+I++TSG+ G PKG   +H +LL N      + D    ++D F++ LPLFH F   
Sbjct: 365 EDAAMILFTSGSEGNPKGVVHSHKSLLSNVEQIKTIADFT--ANDRFMSALPLFHSFXXX 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
                       + L P          L+     T+  G  T           +D  +  
Sbjct: 423 XXXXXXXXXXAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AK G++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKVGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEANAQ--VMRDGW 397
            G++ +L+      + G +  G + ++G  +MKGY           P A  Q   M  GW
Sbjct: 538 PGMDARLL-----AMPGIDQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENQHGEMEAGW 592

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           + TGDI   DE+G+  I  R+K      G  +    +E+V +      + A       + 
Sbjct: 593 YDTGDIVTFDEQGYVRIQGRAKRFAKIAGEMISLEMVEQVALGASPDKMHATAIKQDASK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F    E   LT + L+ +A++  +     PR + +  +LP+  +GK
Sbjct: 653 GEALVLFTTDNE---LTREALLRYARQHGVPELAVPRDIRWLKQLPVLGSGK 701


>AAS_ESCF3 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  131 bits (329), Expect = 1e-32
 Identities = 121/472 (25%), Positives = 205/472 (43%), Gaps = 40/472 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A    T       +  W   +        V+ + 
Sbjct: 313 LDKG-KLWHLPEQLTQVRWIYLEDLKADVTLT-------DKVWIFAHLLMPHLAQVKQQP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           ++ A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T
Sbjct: 365 EEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+     T+  G  T           +D  +  
Sbjct: 423 VGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGHYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGYHN----------RPEANAQVMRDGW 397
            G++ +L+      + G E  G + ++G  +M GY              E     +  GW
Sbjct: 538 PGMDARLL-----AVPGIEDGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENIQGELERGW 592

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           + TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + 
Sbjct: 593 YDTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F   +E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 653 GEALVLFTTDSE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOUT RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  131 bits (329), Expect = 1e-32
 Identities = 120/471 (25%), Positives = 203/471 (43%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+     ++ G E  G + ++G  +M GY                   ++ RD W+
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENIRGEMERD-WY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 654 EALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECOK1 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  131 bits (329), Expect = 1e-32
 Identities = 120/471 (25%), Positives = 203/471 (43%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+     ++ G E  G + ++G  +M GY                   ++ RD W+
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENIRGEMERD-WY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 654 EALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>AAS_ECO45 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  131 bits (329), Expect = 1e-32
 Identities = 120/471 (25%), Positives = 203/471 (43%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+     ++ G E  G + ++G  +M GY                   ++ RD W+
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENIRGEMERD-WY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F    E   LT D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 654 EALVLFTTDNE---LTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>ACSA_NITEU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 655

 Score =  130 bits (328), Expect = 2e-32
 Identities = 139/538 (25%), Positives = 226/538 (42%), Gaps = 46/538 (8%)

Query: 17  ERDAIVFGDM--RLNYALVNMIANQV---ANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71
           ++ AI+F      +N+     +  QV   AN L S GIR GD+V +  P           
Sbjct: 97  DKTAIIFESDAGEVNHCSYRELHRQVCHFANGLKSLGIRQGDRVVIYMPMRIEAVVAMQA 156

Query: 72  ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEVAE 127
             + GA+   +    + + +   + D+GA A+        G    PL     +A      
Sbjct: 157 CARIGAIHSVVFGGFSAKSVYERIIDAGASAVITADEQIRGGRYHPLKATVDEALAMGDT 216

Query: 128 CELY-IDLPAAAGATTSAIPGAETFWAAL-NGQPGEFESVRTEGDDVAVIIYTSGTTGQP 185
             ++ + +    G   +  P  + +W  L  GQP E E      +     +YTSG+TG+P
Sbjct: 217 ATVHSVIVFRHTGTGITWQPERDHWWHDLIAGQPDECEPAWINAEHPLFTLYTSGSTGKP 276

Query: 186 KGAQLTHTNLLFNAVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL 244
           KG Q +    L  AV S   +FD   D  DVF     +  + G + +    L    T V+
Sbjct: 277 KGVQHSSAGYLLGAVTSMQWVFDYHAD--DVFWCTADVGWVTGHSYVAYGPLAIGATQVI 334

Query: 245 MPRFDGDEA-------LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
              F+G            +++K ++T F   PT    L+    D   K    +L    S 
Sbjct: 335 ---FEGTPTHPHAGRFWEIIQKHRITTFYTAPTAIRSLIKLGSDLPAKYDLSSLRLLGSV 391

Query: 298 GASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPKR-KAKPGSIGLPIWGVEM 353
           G  +  E         G     +++ +  +ET   +    P     KPGS  LP+ G++ 
Sbjct: 392 GEPINPEAWMWYYTVVGQSRCPVVDTWWQTETGCHMIAPAPGAISTKPGSCTLPLPGIDA 451

Query: 354 KLVDENFNTIEGEGPGEIAVRGH--CVMKGYHNRPEA------NAQVMRDGWFRTGDIAR 405
            +VDE  + +E    G + ++     +++   N PE          +    ++  GD A 
Sbjct: 452 AVVDETGHPVEQGKGGFLVIKRPFPSMLRTLWNDPERFRKTYFPTDIAGGRYYLAGDSAH 511

Query: 406 RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV 465
           RD++G+++I+ R  D++   G+ +   EIE  L+ HP V+ AAVVG PH+  GE + AFV
Sbjct: 512 RDQDGYFWIMGRVDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEIKGEVVVAFV 571

Query: 466 IPAEGATLTEDELIA--------WAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              E   L +D+  A        W    + A   P  + F   LP T +GKI++R LR
Sbjct: 572 TLRE--KLPDDQRAAEIAATLREWVASEIGAIARPEEIRFGENLPKTRSGKIMRRLLR 627


>ACS1_CANAL RecName: Full=Acetyl-coenzyme A synthetase 1;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 1;AltName:
           Full=Acyl-activating enzyme 1;
          Length = 675

 Score =  130 bits (326), Expect = 3e-32
 Identities = 136/551 (24%), Positives = 231/551 (41%), Gaps = 63/551 (11%)

Query: 12  ARNRPERDAIVF-GDMR-----LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           A   P++ AI++ GD       + Y  +    +++A  L   G++ GD VA+  P +P  
Sbjct: 107 AIKNPDKPAIIYEGDEPDQGRIITYGELLKQVSKLAQALTKLGVKKGDSVAVYLPMIPEA 166

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT----GTPELPLGERAWQA 121
                  ++ GA+   +    +   +   + D+ ++ +        G   +   +    A
Sbjct: 167 IVTLLAIVRIGAMHSVVFAGFSSASLRDRILDADSRIVITADESKRGGKTIETKKIVDDA 226

Query: 122 FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGE-FESVRTEGDDVAVIIYTSG 180
            +E  +    I       +     PG + +W     + G  F  V    +D   ++YTSG
Sbjct: 227 LKECPKVRNVIVFKRTGNSHVPFSPGRDLWWHDEMAKYGPYFPPVPVNSEDPLFLLYTSG 286

Query: 181 TTGQPKGAQLTHTNLLFNAVASSAL-FDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRH 239
           +TG+PKG Q      L  AV ++   FD   D  D+  T   +  I G T  +   L   
Sbjct: 287 STGKPKGVQHNTAGYLLGAVLTTKYTFDVHED--DILFTAGDIGWITGHTYCVYGPLLAG 344

Query: 240 GTMVLMPRFDGDEAL-------SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLH 292
            T V+   F+G  A         +++K KV  F   PT    L  A   +  K    +L 
Sbjct: 345 ATSVV---FEGTPAYPNYSRYWEIVDKYKVNQFYVAPTALRLLKRAGTKYVEKYDLSSLR 401

Query: 293 TAVSGGASLPAEVARKVKEKFG---IEILEGYGLSET-----SPVVSFNNPKRKAKPGSI 344
              S G  + AEV     +  G     I++ Y  +E+     +P+          KPGS 
Sbjct: 402 VLGSVGEPIAAEVWHWYNDNIGRGQAHIVDTYWQTESGSHLLTPLAGIT----PTKPGSA 457

Query: 345 GLPIWGVEMKLVD----ENFNTIEGEGPGEIAVRGHCVMKGYHN----------RPEANA 390
            LP +GV+ K++D    E     + EG   I      + +G +N           P AN 
Sbjct: 458 SLPFFGVDPKILDPTTGEELPDNDVEGVLAIKSAWPSITRGIYNDYNRFIDTYLAPYAN- 516

Query: 391 QVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV 450
                 ++ +GD A RD +GFY+I+ R  D++   G+ +   EIE  L+ HP V  +AVV
Sbjct: 517 ------YYFSGDGAARDRDGFYWILGRVDDVVNVSGHRLSTAEIEAALIEHPIVGESAVV 570

Query: 451 GVPHDTHGEEIKAFVIPAEGATLTED------ELIAWAKERLAAYKYPRIVEFRTELPMT 504
           G   +  G+ + A+V   +   + ED      E+I   ++ +  +  P+++    +LP T
Sbjct: 571 GYADELTGQAVAAYVSLKKDKAVGEDVENIKKEMILTVRKEIGPFAAPKMILLVDDLPKT 630

Query: 505 ATGKILKRELR 515
            +GKI++R LR
Sbjct: 631 RSGKIMRRILR 641


>ACSA_PENCH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 669

 Score =  129 bits (325), Expect = 4e-32
 Identities = 140/542 (25%), Positives = 223/542 (41%), Gaps = 51/542 (9%)

Query: 12  ARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYF 65
           A   P++ AI++         ++ Y  +    ++VA  L  RG++ GD V +  P +P  
Sbjct: 106 ALKNPDKVAIIYEADEPNEGRKITYGELMREVSRVAWTLKERGVKKGDTVGIYLPMIPEA 165

Query: 66  PFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA-------FTGTPELPLGERA 118
              +    + GAV   +    +   +   + D+ +K +                   + A
Sbjct: 166 VIAFLACSRIGAVHSVVFAGFSSDSLRDRVLDASSKVIITSDEXXXXXXXXXXXXXVDEA 225

Query: 119 WQAFQEVAECELYIDLPAAAGATTSAIPGAETFW-AALNGQPGEFESVRTEGDDVAVIIY 177
            +   +V    +Y       GA      G + +W   +   P          +D   ++Y
Sbjct: 226 MKQCPDVHTVLVY----KRTGAEVPWTAGRDIWWHEEVEKYPNYLAPESVSSEDPLFLLY 281

Query: 178 TSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAAL 236
           TSG+TG+PKG   T    LL  A+    +FD   D  D +     +  I G T ++ A L
Sbjct: 282 TSGSTGKPKGVMHTTAGYLLGAAMTGKYVFDIHDD--DRYFCGGDVGWITGHTYVVYAPL 339

Query: 237 YRHGTMVLM------PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
                 V+       P F       +++K  VT F   PT    LL   GD  I     +
Sbjct: 340 LLGCATVVFESTPAYPNF--SRYWDVIDKHDVTQFYVAPTAL-RLLKRAGDEHIHHKMHS 396

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSET-SPVVSFNNPKRKAKPGSIGL 346
           L    S G  + AEV +   E  G E   I + Y  +ET S V++        KPGS  L
Sbjct: 397 LRILGSVGEPIAAEVWKWYFECVGKEEAHICDTYWQTETGSHVITPLGGITPTKPGSASL 456

Query: 347 PIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMK-----------GYHNRPEANAQVMRD 395
           P +G+E  ++D     + GE      V G    K           G H R       +  
Sbjct: 457 PFFGIEPAIID----PVSGEEIVGNDVEGVLAFKQPWPSMARTVWGAHKRYMDTYLNVYK 512

Query: 396 GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHD 455
           G++ TGD A RD +G+Y+I  R  D++   G+ +   EIE  L+ HP V+ AAVVG+  +
Sbjct: 513 GYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALLEHPSVAEAAVVGIADE 572

Query: 456 THGEEIKAFVIPAEGATLTE--DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRE 513
             G+ + AFV   EG    +   +L    ++ +  +  P+ V    +LP T +GKI++R 
Sbjct: 573 LTGQAVNAFVSLKEGKPTEQISKDLAMQVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRI 632

Query: 514 LR 515
           LR
Sbjct: 633 LR 634


>ACSA_AGRRH RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  129 bits (325), Expect = 4e-32
 Identities = 129/520 (24%), Positives = 220/520 (42%), Gaps = 35/520 (6%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P VP   +      + GA+   +  
Sbjct: 103 DRKITYRELYEHVCRMANVLKKHGVKKGDRVTIYMPMVPEAAYAMLACARIGAIHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFT------GTPELPLGERAWQAFQEVAECELYID---LP 135
             +P  +   + D   ++ F  T      G   +PL     +A    A   + +    + 
Sbjct: 163 GFSPEALGGRIVD--CQSTFVITCDEGLRGGKPVPLKANVDKAIDIAARGHVMVKNVLVI 220

Query: 136 AAAGATTSAIPGAETFW---AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLT 191
              G+  S  PG + +    AA        E ++ E  D   I+YTSG+TG+PKG    T
Sbjct: 221 RRTGSPLSWAPGRDLWHHEEAATVSADCPPEPMKAE--DPLFILYTSGSTGKPKGVLHTT 278

Query: 192 HTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRF 248
              L++ ++    +FD      D++     +  + G + ++   L    T ++   +P F
Sbjct: 279 GGYLVYASMTHEYVFDY--QHGDIYWCTADVGWVTGHSYIVYGPLANCATTLMFEGIPTF 336

Query: 249 -DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVAR 307
            D      +++K KV IF   PT    L+ A  D              S G  +  E   
Sbjct: 337 PDAGRFWDVIDKHKVNIFYTAPTAIRSLMGAGDDFVKXXXXXXXXXXGSVGEPINPEAWE 396

Query: 308 KVKEKFG---IEILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTI 363
                 G     +++ +  +ET  ++    P     KPGS   P +G+  +LVD     I
Sbjct: 397 WYYHTVGDGRCPVVDTWWQTETGGIMITPLPGATDLKPGSATRPFFGIRPELVDAEGKLI 456

Query: 364 EGEGPGEIAVRGHCV-----MKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRS 418
           EG   G + +          + G H R         +G + TGD  RRD +G+Y+I  R 
Sbjct: 457 EGAADGNLCIADSWPGQARSVYGDHERFIQTYFSTYEGKYFTGDGCRRDADGYYWITGRV 516

Query: 419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFV---IPAEGATLTE 475
            D++   G+ +   E+E  L++H  VS AAVVG PH+  G+ I  +V     +EG+    
Sbjct: 517 DDVLNVSGHRLGTAEVESALVSHHLVSEAAVVGYPHNIKGQGIYCYVTLMAGSEGSEELR 576

Query: 476 DELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            +L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 577 QQLVKHVRAEIGPIASPDKIQFAPGLPKTRSGKIMRRILR 616


>ACVS2_PENCH RecName:
           Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine
           synthase;         EC=6.3.2.26;AltName:
           Full=Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine
           synthetase;
          Length = 3791

 Score =  129 bits (324), Expect = 6e-32
 Identities = 126/538 (23%), Positives = 227/538 (42%), Gaps = 60/538 (11%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L+E+      ++ A+V  +  L Y  +N   N +A  L S GI P   VAL         
Sbjct: 327 LIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSEKLI 386

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G  K+GA  VP++       + + L D+ A+A+ A                 Q V 
Sbjct: 387 VTILGVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASN---------------QHVE 431

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-----ESVRTEGDDVAVIIYTSGT 181
             +  +      G     I   E   A+L     +F     + +      +A + YTSGT
Sbjct: 432 RLQREV-----IGDRNLCIIRLEPLLASLAQDSSKFPAHNLDDLPLTSQQLAYVTYTSGT 486

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD-VFLTVLPLFHIFGQTTMMNAALYRHG 240
           TG PKG    HTN++ +    SA +  A   H+ + L    +F  F + T+M A +  H 
Sbjct: 487 TGFPKGIFKQHTNVVNSITDLSARYGVAGQHHEAILLFSACVFEPFVRQTLM-ALVNGHL 545

Query: 241 TMVL--MPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             V+  + ++D D  L  + +  +T   G  ++         ++D      +L+  +  G
Sbjct: 546 LAVINDVEKYDADTLLPFIRRHSITYLNGTASVL-------QEYDFSD-CPSLNRIILVG 597

Query: 299 ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAKPGSIGLPIWGVEMKLV 356
            +L       ++++F   IL  YG +E++ V +    +P+   K  S+G P+  V+  ++
Sbjct: 598 ENLTEARYLALRQRFKNRILNEYGFTESAFVTALKIFDPESTRKDTSLGRPVRNVKCYIL 657

Query: 357 DENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ---------------VMRDGWFRTG 401
           + +   +     GE+ + G  + KGY NRPE                    +    ++TG
Sbjct: 658 NPSLKRVPIGATGELHIGGLGISKGYLNRPELTPHRFIPNPFQTDCEKQLGINSLMYKTG 717

Query: 402 DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV-----PHDT 456
           D+AR    G    + R+   I   G  + P EIE +L  +P+V  + VV       P +T
Sbjct: 718 DLARWLPNGEVEYLGRADFQIKLRGIRIEPGEIETMLAMYPRVRTSLVVSKKLRNGPEET 777

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             E +  + +  + A+++E +L+++ +++L  Y  P  +   +++P+   GK   R L
Sbjct: 778 TNEHLVGYYV-CDSASVSEADLLSFLEKKLPRYMIPTRLVQLSQIPVNVNGKADLRAL 834



 Score = 97.8 bits (242), Expect = 2e-22
 Identities = 125/534 (23%), Positives = 210/534 (39%), Gaps = 75/534 (14%)

Query: 17   ERDAIVFGDMRLNYALVNMIANQVANLLVSRG-IRPGDKVALACPNVPYFPFVYFGALKA 75
            E+ A+V GD  L+YA +N  ANQ+A  + S   I   D +AL                KA
Sbjct: 2515 EKIAVVQGDRALSYADLNGQANQLARYIQSVSCIGADDGIALMLEKSIDTIICILAIWKA 2574

Query: 76   GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
            GA  VPL+    P  ++  L +  AKA+   +                  ++CE +    
Sbjct: 2575 GAAYVPLDPTYPPGRVQLILEEIKAKAVLVHSS---------------HASKCERH---- 2615

Query: 136  AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH-TN 194
               GA   A+       A       +  ++ + G+ +A II+TSGT+G+PKG  +     
Sbjct: 2616 ---GAKVIAVDSPAIETAVSQQSAADLPTIASLGN-LAYIIFTSGTSGKPKGVLVEQKAV 2671

Query: 195  LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF-DGDEA 253
            LL         F +    H   L +      F    ++ + L  H  +V    F   DE 
Sbjct: 2672 LLLRDALRERYFGRDCTKHHGVLFLSNYVFDFSVEQLVLSVLSGHKLIVPPAEFVADDEF 2731

Query: 254  LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              +     ++  +G P++   +  A+ DH        L    + G  L A    K++ +F
Sbjct: 2732 YRMASTHGLSYLSGTPSLLQKIDLARLDH--------LQVVTAAGEELHATQYEKMRRRF 2783

Query: 314  GIEILEGYGLSETS--PVVS-------FNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
               I   YG++ET+   +++       F N  R+  PG+           +++     + 
Sbjct: 2784 NGPIYNAYGVTETTVYNIIAEFTTNSIFENALREVLPGT--------RAYVLNAALQPVP 2835

Query: 365  GEGPGEIAVRGHCVMKGYHNRP---------------EANAQVMRDGWFRTGDIAR---- 405
             +  GE+ + G  V +GY N+P               E  A       ++TGD+ R    
Sbjct: 2836 FDAVGELYLAGDSVTRGYLNQPLLTDQRFIPNPFCKEEDIAMGRFARLYKTGDLVRSRFN 2895

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG--VPHDTHGEEIKA 463
            R ++     + R    I   GY +   E++ VL + P V   AVV     +DT+     +
Sbjct: 2896 RQQQPQLEYLGRGDLQIKMRGYRIEISEVQNVLTSSPGVREGAVVAKYENNDTYSRTAHS 2955

Query: 464  FV--IPAEGATLTEDELIAWAKERLAAYKYP-RIVEFRTELPMTATGKILKREL 514
             V     +  T++E +++ + K RL  Y  P  +      LP+T  GK+  R L
Sbjct: 2956 LVGYYTTDNETVSEADILTFMKARLPTYMVPSHLCCLEGALPVTINGKLDVRRL 3009



 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 117/533 (21%), Positives = 206/533 (38%), Gaps = 62/533 (11%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNV 62
            L  + E+ A  +P++ A+V+ +  L Y  +N  AN++A+ L S     P + +AL     
Sbjct: 1419 LHEMFENEASQKPDKIAVVYEETSLTYRELNERANRMAHQLRSDVSPNPNEVIALVMDKS 1478

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
             +         K+G   VP++       I+Y L D+ A A+ A +               
Sbjct: 1479 EHMIVNILAVWKSGGAYVPIDPGYPNDRIQYILEDTQALAVIADS--------------- 1523

Query: 123  QEVAECELYIDLPAAAGATT---SAIPG-AETFWAALNGQPGEFESVRTEGDDVAVIIYT 178
                 C L      AA  T    S +P   ++ W+  N  P       +   D+A IIYT
Sbjct: 1524 -----CYLPRIKGMAASGTLLYPSVLPANPDSKWSVSNPSP------LSRSTDLAYIIYT 1572

Query: 179  SGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
            SGTTG+PKG  + H  ++   V+ S +F       +V L+            M +A L  
Sbjct: 1573 SGTTGRPKGVTVEHHGVVNLQVSLSKVFGLRDTDDEVILSFSNYVFDHFVEQMTDAILNG 1632

Query: 239  HGTMVLMPRFDGDE--ALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
               +VL     GD+      +EK +VT  +G P++          ++  +    L     
Sbjct: 1633 QTLLVLNDGMRGDKERLYRYIEKNRVTYLSGTPSVV-------SMYEFSRFKDHLRRVDC 1685

Query: 297  GGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS---FNNPKRKAKPGSIGLPIWGVEM 353
             G +    V  K++E F   ++ GYG +E S       +  P+R+    SIG  +     
Sbjct: 1686 VGEAFSEPVFDKIRETFHGLVINGYGPTEVSITTHKRLYPFPERRMDK-SIGQQVHNSTS 1744

Query: 354  KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-----------RDG----WF 398
             +++E+                       HNR +  A+             R+G     +
Sbjct: 1745 YVLNEDMKRTPIXXXXXXXXXXXXXXXXXHNRADVTAERFIPNPFQSEEDKREGRNSRLY 1804

Query: 399  RTGDIAR--RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
            +TGD+ R      G    + R+   +   G  +   EIE +L ++  +  + V+      
Sbjct: 1805 KTGDLVRWIPGSSGEVEYLGRNDFQVKIRGLRIELGEIEAILSSYHGIKQSVVIAKDCRE 1864

Query: 457  HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
              ++       A+ A L    +  + + RL  Y  P  +   ++ P+T +GK+
Sbjct: 1865 GAQKFLVGYYVAD-AALPSAAIRRFMQSRLPGYMVPSRLILVSKFPVTPSGKL 1916


>ACVS1_PENCH RecName:
           Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine
           synthase;         EC=6.3.2.26;AltName:
           Full=Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine
           synthetase;
          Length = 3746

 Score =  129 bits (324), Expect = 6e-32
 Identities = 126/538 (23%), Positives = 227/538 (42%), Gaps = 60/538 (11%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L+E+      ++ A+V  +  L Y  +N   N +A  L S GI P   VAL         
Sbjct: 297 LIEEVVERHEDKIAVVCDERELTYGELNAQGNSLARYLRSIGILPEQLVALFLDKSEKLI 356

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               G  K+GA  VP++       + + L D+ A+A+ A                 Q V 
Sbjct: 357 VTILGVWKSGAAYVPIDPTYPDERVRFVLDDTKARAIIASN---------------QHVE 401

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEF-----ESVRTEGDDVAVIIYTSGT 181
             +  +      G     I   E   A+L     +F     + +      +A + YTSGT
Sbjct: 402 RLQREV-----IGDRNLCIIRLEPLLASLAQDSSKFPAHNLDDLPLTSQQLAYVTYTSGT 456

Query: 182 TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD-VFLTVLPLFHIFGQTTMMNAALYRHG 240
           TG PKG    HTN++ +    SA +  A   H+ + L    +F  F + T+M A +  H 
Sbjct: 457 TGFPKGIFKQHTNVVNSITDLSARYGVAGQHHEAILLFSACVFEPFVRQTLM-ALVNGHL 515

Query: 241 TMVL--MPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
             V+  + ++D D  L  + +  +T   G  ++         ++D      +L+  +  G
Sbjct: 516 LAVINDVEKYDADTLLPFIRRHSITYLNGTASVL-------QEYDFSD-CPSLNRIILVG 567

Query: 299 ASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAKPGSIGLPIWGVEMKLV 356
            +L       ++++F   IL  YG +E++ V +    +P+   K  S+G P+  V+  ++
Sbjct: 568 ENLTEARYLALRQRFKNRILNEYGFTESAFVTALKIFDPESTRKDTSLGRPVRNVKCYIL 627

Query: 357 DENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ---------------VMRDGWFRTG 401
           + +   +     GE+ + G  + KGY NRPE                    +    ++TG
Sbjct: 628 NPSLKRVPIGATGELHIGGLGISKGYLNRPELTPHRFIPNPFQTDCEKQLGINSLMYKTG 687

Query: 402 DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV-----PHDT 456
           D+AR    G    + R+   I   G  + P EIE +L  +P+V  + VV       P +T
Sbjct: 688 DLARWLPNGEVEYLGRADFQIKLRGIRIEPGEIETMLAMYPRVRTSLVVSKKLRNGPEET 747

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             E +  + +  + A+++E +L+++ +++L  Y  P  +   +++P+   GK   R L
Sbjct: 748 TNEHLVGYYV-CDSASVSEADLLSFLEKKLPRYMIPTRLVQLSQIPVNVNGKADLRAL 804



 Score = 97.8 bits (242), Expect = 2e-22
 Identities = 125/534 (23%), Positives = 210/534 (39%), Gaps = 75/534 (14%)

Query: 17   ERDAIVFGDMRLNYALVNMIANQVANLLVSRG-IRPGDKVALACPNVPYFPFVYFGALKA 75
            E+ A+V GD  L+YA +N  ANQ+A  + S   I   D +AL                KA
Sbjct: 2483 EKIAVVQGDRALSYADLNGQANQLARYIQSVSCIGADDGIALMLEKSIDTIICILAIWKA 2542

Query: 76   GAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLP 135
            GA  VPL+    P  ++  L +  AKA+   +                  ++CE +    
Sbjct: 2543 GAAYVPLDPTYPPGRVQLILEEIKAKAVLVHSS---------------HASKCERH---- 2583

Query: 136  AAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTH-TN 194
               GA   A+       A       +  ++ + G+ +A II+TSGT+G+PKG  +     
Sbjct: 2584 ---GAKVIAVDSPAIETAVSQQSAADLPTIASLGN-LAYIIFTSGTSGKPKGVLVEQKAV 2639

Query: 195  LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF-DGDEA 253
            LL         F +    H   L +      F    ++ + L  H  +V    F   DE 
Sbjct: 2640 LLLRDALRERYFGRDCTKHHGVLFLSNYVFDFSVEQLVLSVLSGHKLIVPPAEFVADDEF 2699

Query: 254  LSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKF 313
              +     ++  +G P++   +  A+ DH        L    + G  L A    K++ +F
Sbjct: 2700 YRMASTHGLSYLSGTPSLLQKIDLARLDH--------LQVVTAAGEELHATQYEKMRRRF 2751

Query: 314  GIEILEGYGLSETS--PVVS-------FNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIE 364
               I   YG++ET+   +++       F N  R+  PG+           +++     + 
Sbjct: 2752 NGPIYNAYGVTETTVYNIIAEFTTNSIFENALREVLPGT--------RAYVLNAALQPVP 2803

Query: 365  GEGPGEIAVRGHCVMKGYHNRP---------------EANAQVMRDGWFRTGDIAR---- 405
             +  GE+ + G  V +GY N+P               E  A       ++TGD+ R    
Sbjct: 2804 FDAVGELYLAGDSVTRGYLNQPLLTDQRFIPNPFCKEEDIAMGRFARLYKTGDLVRSRFN 2863

Query: 406  RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG--VPHDTHGEEIKA 463
            R ++     + R    I   GY +   E++ VL + P V   AVV     +DT+     +
Sbjct: 2864 RQQQPQLEYLGRGDLQIKMRGYRIEISEVQNVLTSSPGVREGAVVAKYENNDTYSRTAHS 2923

Query: 464  FV--IPAEGATLTEDELIAWAKERLAAYKYP-RIVEFRTELPMTATGKILKREL 514
             V     +  T++E +++ + K RL  Y  P  +      LP+T  GK+  R L
Sbjct: 2924 LVGYYTTDNETVSEADILTFMKARLPTYMVPSHLCCLEGALPVTINGKLDVRRL 2977



 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 117/533 (21%), Positives = 206/533 (38%), Gaps = 62/533 (11%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNV 62
            L  + E+ A  +P++ A+V+ +  L Y  +N  AN++A+ L S     P + +AL     
Sbjct: 1387 LHEMFENEASQKPDKIAVVYEETSLTYRELNERANRMAHQLRSDVSPNPNEVIALVMDKS 1446

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
             +         K+G   VP++       I+Y L D+ A A+ A +               
Sbjct: 1447 EHMIVNILAVWKSGGAYVPIDPGYPNDRIQYILEDTQALAVIADS--------------- 1491

Query: 123  QEVAECELYIDLPAAAGATT---SAIPG-AETFWAALNGQPGEFESVRTEGDDVAVIIYT 178
                 C L      AA  T    S +P   ++ W+  N  P       +   D+A IIYT
Sbjct: 1492 -----CYLPRIKGMAASGTLLYPSVLPANPDSKWSVSNPSP------LSRSTDLAYIIYT 1540

Query: 179  SGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
            SGTTG+PKG  + H  ++   V+ S +F       +V L+            M +A L  
Sbjct: 1541 SGTTGRPKGVTVEHHGVVNLQVSLSKVFGLRDTDDEVILSFSNYVFDHFVEQMTDAILNG 1600

Query: 239  HGTMVLMPRFDGDE--ALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVS 296
               +VL     GD+      +EK +VT  +G P++          ++  +    L     
Sbjct: 1601 QTLLVLNDGMRGDKERLYRYIEKNRVTYLSGTPSVV-------SMYEFSRFKDHLRRVDC 1653

Query: 297  GGASLPAEVARKVKEKFGIEILEGYGLSETSPVVS---FNNPKRKAKPGSIGLPIWGVEM 353
             G +    V  K++E F   ++ GYG +E S       +  P+R+    SIG  +     
Sbjct: 1654 VGEAFSEPVFDKIRETFHGLVINGYGPTEVSITTHKRLYPFPERRMDK-SIGQQVHNSTS 1712

Query: 354  KLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-----------RDG----WF 398
             +++E+                       HNR +  A+             R+G     +
Sbjct: 1713 YVLNEDMKRTPIXXXXXXXXXXXXXXXXXHNRADVTAERFIPNPFQSEEDKREGRNSRLY 1772

Query: 399  RTGDIAR--RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
            +TGD+ R      G    + R+   +   G  +   EIE +L ++  +  + V+      
Sbjct: 1773 KTGDLVRWIPGSSGEVEYLGRNDFQVKIRGLRIELGEIEAILSSYHGIKQSVVIAKDCRE 1832

Query: 457  HGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKI 509
              ++       A+ A L    +  + + RL  Y  P  +   ++ P+T +GK+
Sbjct: 1833 GAQKFLVGYYVAD-AALPSAAIRRFMQSRLPGYMVPSRLILVSKFPVTPSGKL 1884


>ACSA_SERP5 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 652

 Score =  129 bits (324), Expect = 6e-32
 Identities = 141/552 (25%), Positives = 234/552 (42%), Gaps = 48/552 (8%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GD-----MRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LNL+   L+     R ++ AI++ GD      ++ Y  ++    Q AN            
Sbjct: 75  LNLAANCLDRHLAERGDQTAIIWEGDDPTQSKQVTYKQLHHDVCQFANXXXXXXXXXXXX 134

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPL 114
            A+  P VP          + GAV   +    +P  +   + DS +K +           
Sbjct: 135 XAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSKLVITADE------ 188

Query: 115 GERAWQAFQEVAECELYIDLPAAAGATTSAI-----------PGAETFWAALN-GQPGEF 162
           G RA +A       +  +  P     T   +            G + +W  L  G   + 
Sbjct: 189 GLRAGRAVPLKKNVDDALKNPGVKSITNVVVFQRTGKPGYWQEGRDLWWHELTAGVSADC 248

Query: 163 ESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLP 221
                  +D   I+YTSG+TG+PKG    T   L++ A+    +FD      DV+     
Sbjct: 249 PPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDY--HDGDVYWCTAD 306

Query: 222 LFHIFGQTTMMNAALYRHGTMVLM----PRFDGDEALS-LMEKEKVTIFAGVPTMYWGLL 276
           +  + G + ++   L   G + LM    P + G   LS +++K +V I    PT    L+
Sbjct: 307 VGWVTGHSYLLYGPL-ACGAITLMFEGVPNYPGVNRLSQVIDKHQVNILYTAPTAIRALM 365

Query: 277 NAQGDHDIKQISQ-TLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSF 332
            A+GD  I+   + +L    S G  +  E       K G     I++ +  +ET   +  
Sbjct: 366 -AEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNAKCPIVDTWWQTETGGFMIT 424

Query: 333 NNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRP 386
             P   + K GS   P +GV+  LVD      EG   G + +          + G H+R 
Sbjct: 425 PLPGATELKAGSATRPFFGVQPALVDNIGTVQEGACEGNLVITDSWPGQARTLFGDHDRF 484

Query: 387 EANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSL 446
           E        G + +GD ARRDE+G+Y+I  R  D++   G+ +   EIE  L++HP+++ 
Sbjct: 485 EQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAE 544

Query: 447 AAVVGVPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPM 503
           AAVVG+PH+  G+ I A++    G   T +   E+  W ++ +     P ++ +   LP 
Sbjct: 545 AAVVGIPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPIATPDVLHWTDSLPK 604

Query: 504 TATGKILKRELR 515
           T +GKI++R LR
Sbjct: 605 TRSGKIMRRILR 616


>AAS_ECOL5 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  129 bits (324), Expect = 6e-32
 Identities = 119/471 (25%), Positives = 202/471 (42%), Gaps = 38/471 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+++ L  PN      V FGA+    +   +N     + +   +  +  K +F  T    
Sbjct: 255 GERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITAAEIKTIF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDD 171
           L  G + W   +++ +          A  TT     A+  W   +        V+ + ++
Sbjct: 313 LDKG-KLWHLPEQLTQVRWVYLEDLKADVTT-----ADKVWIFAHLLMPRLAQVKQQPEE 366

Query: 172 VAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTM 231
            A+I++TSG+ G PKG   +H ++L N      + D    ++D F++ LPLFH FG T  
Sbjct: 367 EALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFT--TNDRFMSALPLFHSFGLTVG 424

Query: 232 MNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQT 290
           +   L     + L P          L+     T+  G  T           +D  +    
Sbjct: 425 LFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR---- 480

Query: 291 LHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG 350
           L   V+G   L     +  ++KFG+ ILEGYG++E +PVVS N P   AKPG++G  + G
Sbjct: 481 LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVP-MAAKPGTVGRILPG 539

Query: 351 VEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY-----------HNRPEANAQVMRDGWF 398
           ++ +L+     ++ G E  G + ++G  +M GY                   ++ RD W+
Sbjct: 540 MDARLL-----SVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERD-WY 593

Query: 399 RTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHG 458
            TGDI R DE+GF  I  R+K      G  V    +E++ +      + A       + G
Sbjct: 594 DTGDIVRFDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKG 653

Query: 459 EEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           E +  F    E   L  D+L  +A+E  +     PR + +  ++P+  +GK
Sbjct: 654 EALVLFTTDNE---LMRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGK 701


>ACSA2_RHIME RecName: Full=Acetyl-coenzyme A synthetase 2;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 2;AltName:
           Full=Acyl-activating enzyme 2;
          Length = 649

 Score =  129 bits (323), Expect = 7e-32
 Identities = 127/523 (24%), Positives = 219/523 (41%), Gaps = 41/523 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L  +G++ GD+V +  P +P   +      + GA+   +  
Sbjct: 103 DKKITYNELYDKVCRLANVLKEQGVKKGDRVTIYMPMIPEAAYAMLACARIGAIHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
             +P  +   + D   ++ F  T       G R  +        +  ID+ A    T S 
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDE----GVRGGKPVALKENTDTAIDIAARQHVTVSK 216

Query: 145 I-----PGAETFWAALNGQPGEFESVRTE---------GDDVAVIIYTSGTTGQPKGA-Q 189
           +      G +  WA         E+   E          +D   I+YTSG+TG+PKG   
Sbjct: 217 VLVVRRTGGKVGWAPGRDLWYHQETAAAEPHCPPEKMNAEDPLFILYTSGSTGKPKGVLH 276

Query: 190 LTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MP 246
            T   L++ ++    +FD      D++     +  + G + ++   L    T ++   +P
Sbjct: 277 TTGGYLVYASMTHQYVFDY--QDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMFEGVP 334

Query: 247 RF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
            F D      +++K KV IF   PT    L+ A  D              + G  +  E 
Sbjct: 335 NFPDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGDDFVKXXXXXXXXXXGTVGEPINPEA 394

Query: 306 ARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFN 361
                   G E   +++ +  +ET  ++    P     KPGS   P +GV+ ++VD +  
Sbjct: 395 WEWYYHVVGDERCPVVDTWWQTETGGILITPLPGATDLKPGSATRPFFGVQPQIVDSDGK 454

Query: 362 TIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIID 416
            ++G   G + +          + G H R          G + TGD  RRDE+G+Y+I  
Sbjct: 455 VVDGAADGNLCITDSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITG 514

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
           R  D++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V    G  + +D
Sbjct: 515 RVDDVLNVSGHRLGTAEVESALVSHNLVSEAAVVGYPHPIKGQGIYCYVSLMAG-EVGDD 573

Query: 477 E----LIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           E    L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 574 ELRQALVKHVRSEIGPIATPDKIQFAPGLPKTRSGKIMRRILR 616


>ACSA_SINMW RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 649

 Score =  128 bits (322), Expect = 1e-31
 Identities = 125/522 (23%), Positives = 214/522 (40%), Gaps = 39/522 (7%)

Query: 25  DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84
           D ++ Y  +     ++AN+L   G++ GD+V +  P +P   +      + GAV   +  
Sbjct: 103 DKKITYNELYDTVCRLANVLKKHGVKKGDRVTIYMPMIPEAAYAMLACTRIGAVHSVVFG 162

Query: 85  LLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSA 144
             +P  +   + D   ++ F  T       G R  +        +  + + A    T   
Sbjct: 163 GFSPEALAGRIVD--CESTFVITCDE----GVRGGKPVALKENTDTAVGIAAKQNVTVGK 216

Query: 145 I-----PGAETFWAALNGQPGEFESVRTE---------GDDVAVIIYTSGTTGQPKGA-Q 189
           +      G +  WA         E+   E          +D   I+YTSG+TG+PKG   
Sbjct: 217 VLVVRRTGGKVGWAPERDLWYHQETAAVEPHCPPERMNAEDPLFILYTSGSTGKPKGVLH 276

Query: 190 LTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MP 246
            T   L++ ++    +FD      D++     +  + G + ++   L    T ++   +P
Sbjct: 277 TTGGYLVYASMTHQYVFDY--QDGDIYWCTADVGWVTGHSYIVYGPLANAATTLMFEGVP 334

Query: 247 RF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV 305
            F D      +++K KV IF   PT    L+ A  D              + G  +  E 
Sbjct: 335 NFPDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGDDFVKXXXXXXXXXXGTVGEPINPEA 394

Query: 306 ARKVKEKFGIE---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFN 361
                   G E   +++ +  +ET  ++    P     KPGS   P +GV+ ++VD   N
Sbjct: 395 WEWYYHVVGDERCPVVDTWWQTETGGILITPLPGATDLKPGSATRPFFGVQPQIVDGEGN 454

Query: 362 TIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIID 416
            +EG   G + +          + G H R          G + TGD  RRDE+G+Y+I  
Sbjct: 455 VVEGAADGNLCIIDSWPGQMRTVYGDHERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITG 514

Query: 417 RSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED 476
           R  D++   G+ +   E+E  L++H  VS AAVVG PH   G+ I  +V    G    ++
Sbjct: 515 RVDDVLNVSGHRLGTAEVESALVSHQLVSEAAVVGYPHSIKGQGIYCYVSLMAGEVGNDE 574

Query: 477 ---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
               L+   +  +     P  ++F   LP T +GKI++R LR
Sbjct: 575 LRQALVKHVRSEIGPIATPDKIQFAPGLPKTRSGKIMRRILR 616


>ACSA_RUBXD RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 644

 Score =  128 bits (322), Expect = 1e-31
 Identities = 134/540 (24%), Positives = 230/540 (42%), Gaps = 49/540 (9%)

Query: 13  RNRPERDAIVF-----GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           + R ++ AI++     G+ R L Y+ +     + AN+L   G+R GD V++  P +P  P
Sbjct: 85  QGRGDKRAIIWEGDEPGENRTLTYSELKAEVEKFANVLKGLGVRKGDAVSIYLPMIPELP 144

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE----LPLGERAWQAF 122
                  + GA    +    + + +   + D  AK L      P      PL   A +A 
Sbjct: 145 IAMLACARIGAPHSVVFGAFSAQSLRDRINDCEAKVLVTADSGPRGGKRTPLKANADEAL 204

Query: 123 QEVAECELYIDLPAAAGATTSAIPGAETFWAAL--NGQPGEFESVRTEGDDVAVIIYTSG 180
           ++    E  + +    G   + + G + +W  L    +P E  +   + +D+  I+Y+SG
Sbjct: 205 EDTPSIEKVV-VVRRTGDEVNMVEGRDLWWHELMREAEP-ECPAEEMDSEDILYILYSSG 262

Query: 181 TTGQPKG------AQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNA 234
           +TG+PKG        LTH N       +  +FD   D  DV+     +  + G + ++  
Sbjct: 263 STGKPKGIVHTTGGYLTHVN-----TTTDWVFDLKED--DVYWCTADIGWVTGHSYIVYG 315

Query: 235 ALYRHGTMVLM---PRFDG-DEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDI-KQISQ 289
            L    T ++    P +   D    ++E+  VTI    PT     +  QG   I K    
Sbjct: 316 PLSNGATALMFEGTPSYPANDRWWDIIERHGVTILYTAPTAIRAFMK-QGPGPIEKHDLS 374

Query: 290 TLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPK-RKAKPGSIG 345
           +L    S G  +         E  G     +++ +  +ET  ++    P   + KPGS  
Sbjct: 375 SLRLLGSVGEPINPRAWEWYHEHVGGGRCPVVDTWWQTETGGIMISPLPGITRTKPGSAT 434

Query: 346 LPIWGVEMKLVDENFNTIEGEGPGEIAVRG------HCVMKGYHNRPEANAQVMRDGWFR 399
            P+ G+   + DE  N IEG G G + ++         + K      E   Q   D +F 
Sbjct: 435 FPLPGIFAGIYDEEGNEIEGPGVGNLVIKRPWPGMLRTLYKDPERFRETYWQKYGDVYF- 493

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           +GD ARRDE+G++++  R  D+I   G+ +   E+E              +G   +  G+
Sbjct: 494 SGDGARRDEDGYFWVTGRVDDVINVSGHRISTAEVESXXXXXXXXXXXXXIGRYDEDTGQ 553

Query: 460 EIKAFVIPAEGATLTEDELIAWAKER----LAAYKYPRIVEFRTELPMTATGKILKRELR 515
            I A+VI  EG     DEL    +++    + A+  P+ + F  +LP T +GKI++R LR
Sbjct: 554 AIVAYVI-LEGGREGNDELAQELRQQVRKVIGAHARPQEIIFTPDLPKTRSGKIMRRILR 612


>ACS2L_MOUSE RecName: Full=Acetyl-coenzyme A synthetase 2-like,
           mitochondrial;         EC=6.2.1.1;AltName:
           Full=Acetate--CoA ligase 2;
          Length = 682

 Score =  128 bits (322), Expect = 1e-31
 Identities = 143/553 (25%), Positives = 233/553 (42%), Gaps = 50/553 (9%)

Query: 2   LNLSV-LLEDGARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LN+SV  L+   +  PE  A+++       ++R+ Y  +     ++AN L   G+  GD+
Sbjct: 101 LNVSVNCLDQHVQKSPETIALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDR 160

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFT-GTPELP 113
           VA+  P  P          + GA+   +    +   +   + D+  KA+  F  G     
Sbjct: 161 VAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGR 220

Query: 114 LGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRT----EG 169
           + E      + V  C     +  A    T    G+      L  +  +   V T      
Sbjct: 221 VVELKKIVDEAVKSCPTVQHVLVAHRTDTKVPMGSLDI--PLEQEMAKEAPVCTPESMSS 278

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQAPDSHDVFLTVLPLFHIF 226
           +D+  ++YTSG+TG PKG  L HT    LL+ A+    +FD  P   DVF  V  +  I 
Sbjct: 279 EDMLFMLYTSGSTGTPKG--LVHTQAGYLLYAAMTHKLVFDYQPG--DVFGCVADIGWIT 334

Query: 227 GQTTMMNAALYRHGTMVLMPRF----DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           G + ++   L    T VL        D       +++ K+  F G PT    LL   GD 
Sbjct: 335 GHSYVVYGPLCNGATTVLFESTPVYPDAGRYWETVQRLKINQFYGAPTAV-RLLLKYGDA 393

Query: 283 DIKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPKRK 338
            +K+  ++ L T  S G  +  E    + +  G     +++ +  +ET  +     P   
Sbjct: 394 WVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIAPRPSED 453

Query: 339 AK---PGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEA---NAQV 392
                PG    P +G+   L+DE  N +EG   G+++    C+ + +         + Q 
Sbjct: 454 GAEILPGMAMRPFFGIVPVLMDEKGNVLEG---GDVS-GALCISQAWPGMARTIYGDHQR 509

Query: 393 MRDGWFR-------TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVS 445
             D +FR       TGD A R E G+Y I  R  D+I   G+ +   EIE+ +  HP V 
Sbjct: 510 FVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVP 569

Query: 446 LAAVVGVPHDTHGEEIKAFVIPAEGAT---LTEDELIAWAKERLAAYKYPRIVEFRTELP 502
             AV+G PHD  GE   AF++  +  +   +  +EL      ++A Y  P  +     LP
Sbjct: 570 ETAVIGYPHDIKGEAAFAFIVLKDNISDENMVVNELKLSVATKIAKYAVPDQILVVKRLP 629

Query: 503 MTATGKILKRELR 515
            T +GK+++R LR
Sbjct: 630 KTRSGKVMRRLLR 642


>ACSA_PSESM RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  128 bits (321), Expect = 1e-31
 Identities = 106/359 (29%), Positives = 169/359 (47%), Gaps = 21/359 (5%)

Query: 175 IIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
           I+YTSG+TG+PKG   T    LL+ A+    +FD  P   +++     +  + G + ++ 
Sbjct: 261 ILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYKPG--EIYWCTADVGWVTGHSYIVY 318

Query: 234 AALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS- 288
             L    T +L   +P + D      +++K KV I    PT    ++ A+G   ++    
Sbjct: 319 GPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMM-AEGTKSVEGADG 377

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSI 344
            +L    S G  +  E         G +   I++ +  +ET  ++    P   A KPGS 
Sbjct: 378 SSLRLLGSVGEPINPEAWGWYYNTVGKQNCPIVDTWWQTETGGILISPLPGATALKPGSA 437

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVMRDGWFR 399
             P +GV   LVD   N IEG   G + +          + G H+R          G + 
Sbjct: 438 TRPFFGVIPALVDNLGNLIEGAAEGNLVILDSWPGQSRTLYGDHDRFVDTYFKTFRGMYF 497

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  ++ HP+V+ AAVVGVPHD  G+
Sbjct: 498 TGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEAAVVGVPHDLKGQ 557

Query: 460 EIKAFV---IPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            I  +V      E +     EL  W ++ +     P  +++   LP T +GKI++R LR
Sbjct: 558 GIYVYVTLNAGEEPSDALRTELRNWVRKEIGPIASPDFIQWAPGLPKTRSGKIMRRILR 616


>ACSA_NITEC RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 655

 Score =  128 bits (321), Expect = 1e-31
 Identities = 136/545 (24%), Positives = 220/545 (40%), Gaps = 83/545 (15%)

Query: 26  MRLNYALVNMIANQVANLLVSRGIRPGDKVAL-------------ACPNVPYFPFVYFGA 72
           +R +Y  ++    + AN L + GIR GD++ +             AC  +     V FG 
Sbjct: 111 IRCSYRELHQRVCRFANGLKALGIRQGDRIVIYMPMRIEAVVAMQACARIGVIHSVVFGG 170

Query: 73  LKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYI 132
             A             + +   + D+GA A+   T   +   G+R           +  +
Sbjct: 171 FSA-------------KSVYERIIDAGASAVI--TADEQTRGGKRH--------ALKATV 207

Query: 133 DLPAAAGATTSAI---------------PGAETFWAALNG-QPGEFESVRTEGDDVAVII 176
           D   A G TTS                 P  + +W  L   Q  E E +    +     +
Sbjct: 208 DEALAMGDTTSVHSVIVFRHTGTDIPWQPERDRWWHNLTASQSDECEPIWVNAEHPLFTL 267

Query: 177 YTSGTTGQPKGAQLTHTNLLFNAVASSA-LFDQAPDSHDVFLTVLPLFHIFGQTTMMNAA 235
           YTSG+TG+PKG Q +    L  A+ S   +FD    S D+F     +  + G + +    
Sbjct: 268 YTSGSTGKPKGVQHSSAGYLLGAIVSMQWVFDY--HSEDIFWCTADVGWVTGHSYVTYGP 325

Query: 236 LYRHGTMVLMPRFDGDEAL-------SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
           L    T V+   F+G            +++K +VT F   PT    L+    D   K   
Sbjct: 326 LAIGATQVI---FEGTPTYPHAGRFWEIIQKHRVTTFYTAPTAIRSLIKLGPDLPEKYDL 382

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSET-SPVVSFNNPKRKAKPGSI 344
            +L    S G  +  E         G     +++ +  +ET S +          KPGS 
Sbjct: 383 SSLRLLGSVGEPINPEAWMWYYTVIGQSRCPVVDTWWQTETGSHMXXXXXXXXXXKPGSC 442

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGH--CVMKGYHNRPEA------NAQVMRDG 396
            LP+ G++  +VDE     E    G + ++     +++   N PE        A +    
Sbjct: 443 TLPLPGIDAAVVDETGLPAEQGKGGFLVIKRPFPSMLRTLWNDPERFRNTYFPADIAGGH 502

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           ++  GD A RD++G+++I+ R  D++   G+ +   EIE  L+ HP V+ AAVVG PH+ 
Sbjct: 503 YYLAGDSAHRDQDGYFWIMGRIDDVLNVSGHRLGTMEIESALVAHPLVAEAAVVGKPHEI 562

Query: 457 HGEEIKAFVI------PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
            GE I AFV+        + A    + L  W    + A   P  + F   LP T +GK++
Sbjct: 563 RGEVIVAFVVLRGKLPDDQQAAEIAETLREWVSSEIGAIARPEEIRFGENLPKTRSGKLM 622

Query: 511 KRELR 515
           +R LR
Sbjct: 623 RRLLR 627


>ACSA_CAUCR RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 647

 Score =  128 bits (321), Expect = 1e-31
 Identities = 126/512 (24%), Positives = 216/512 (42%), Gaps = 29/512 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++    ++AN+L ++G++ GD+V +  P VP          + GAV   +    +
Sbjct: 109 LTYGQLHEEVCRMANVLKAQGVKKGDRVTIYLPMVPLAAVAMLACARIGAVHSVVFGGFS 168

Query: 88  PREIEYHLRDSGAKALFAF----TGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
           P  I   ++D  +  +        G   +PL     +A +        + +    GA   
Sbjct: 169 PDSIAGRIQDCASHFVITADEGRRGGRRVPLKANIDEALKHCPWVGKVL-MIRWTGADVP 227

Query: 144 AIPGAETFWAALNGQ-PGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVAS 202
              G +  W  +      +        +D   I+YTSG+TG+PKG  + HT   + A AS
Sbjct: 228 LKAGRDIVWQDVRDTVSADCPPEPMNAEDPLFILYTSGSTGKPKG--VLHTTGGYLAWAS 285

Query: 203 ---SALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEAL-S 255
               A+FD  P   +VF     +  + G + ++   L   GT ++   +P +        
Sbjct: 286 WTFWAVFDYKPG--EVFWCTADVGWVTGHSYVVYGPLANGGTSLIFEGVPNYPTPSRFWE 343

Query: 256 LMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEV---ARKVKEK 312
           +++K +V+IF   PT    L+     H  K    +L    S G  +  E      +V  K
Sbjct: 344 VIDKHQVSIFYTAPTALRALMREGDAHVTKNDLSSLRLLGSVGEPINPEAWLWYHRVVGK 403

Query: 313 FGIEILEGYGLSETSPVVSFNNPKRKA-KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
             + I++ +  +ET  ++    P   A KPGS   P+ GV+ +LVD     ++G   G +
Sbjct: 404 EKLPIVDTWWQTETGGMLITPLPGATALKPGSASKPLPGVKPQLVDAEGKFLDGATEGNL 463

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H R          G + TGD  RRD +G+Y+I  R  D+I   G
Sbjct: 464 VITDSWPGQMRTVYGDHQRFFETYFSTYPGKYFTGDGCRRDADGYYWITGRVDDVINVSG 523

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE---DELIAWAK 483
           + +   EIE               G PHD  G+ + A+V    G   T+    +L+ W +
Sbjct: 524 HRLGTAEIESXXXXXXXXXXXXXXGYPHDIKGQGVYAYVTLKAGIEATDALRKDLVLWVR 583

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
             +  +  P ++++   LP T +GKI++R LR
Sbjct: 584 HEIGPFAAPDVIQWAPGLPKTRSGKIMRRILR 615


>AAS_PECCP RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 723

 Score =  128 bits (321), Expect = 1e-31
 Identities = 107/353 (30%), Positives = 164/353 (46%), Gaps = 30/353 (8%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           DD A++++TSG+ G PKG   +H +LL N      + D  P   D F++ LPLFH FG T
Sbjct: 365 DDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTP--RDRFMSALPLFHAFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+  +  T+  G  T           +D  ++ 
Sbjct: 423 VGLLTPLMTGARIFLYPSPLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAHPYDFARLR 482

Query: 289 QTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLP 347
                 V  GA   +E  R+V ++KFGI ILEGYG++E +PVV+ N P    K  S+GL 
Sbjct: 483 Y-----VVAGAEKLSETTRQVWQDKFGIRILEGYGVTECAPVVAINVP-MATKIHSVGLL 536

Query: 348 IWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEA-NAQ-VMRDG 396
           +  +E +L+     T+ G    G + +RG  +MKGY           P A NA+  ++ G
Sbjct: 537 LPEIESRLI-----TVPGITRGGRLQLRGPNIMKGYLRVENPGVLEAPAAENAEGELQQG 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI   DE+GF  II R K      G  V    +E++ +     +  A       +
Sbjct: 592 WYDTGDIVELDEKGFCTIIGRVKRFAKLAGEMVSLESVEQLAVKVSPEAQHAASAKSDSS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   ++   +T D L+A A+   +     PR + +   LP+  +GK
Sbjct: 652 KGEALVLFTTDSQ---ITRDVLLAQARSSGVPELAVPRDIRYVKALPLLGSGK 701


>FCSA_DICDI RecName: Full=Fatty acyl-CoA synthetase A;       
           EC=6.2.1.3;AltName: Full=Long-chain-fatty-acid--CoA
           synthetase 1;AltName: Full=Long chain fatty acyl
           coenzyme A-synthetase 1;
          Length = 667

 Score =  127 bits (320), Expect = 2e-31
 Identities = 140/544 (25%), Positives = 224/544 (41%), Gaps = 85/544 (15%)

Query: 2   LNLSVLLEDGARNRPERDAIVFGDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACP 60
           L +  LL DG R          GD + ++Y    + AN + + LV  G+  GD++ +   
Sbjct: 71  LGIRELLADGKR----------GDYKWISYKQACIRANNIGSALVQLGLNKGDRIGIFSI 120

Query: 61  NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
           N P +      A+    V V L   L    IEY +  S    L       E  L      
Sbjct: 121 NRPEWVLSDMAAMNHSLVPVALYATLGANAIEYVVNHSEISVLLCEGKNVEKILSMPGTT 180

Query: 121 AFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTE---GDDVAVIIY 177
               V+    Y  LP A           + +  +   + GE    + E    +D+  ++Y
Sbjct: 181 IKTIVS----YDPLPQATLDKFKDNENVKLYLLSDFEKLGEQNPAQHEVPSPEDLCTLLY 236

Query: 178 TSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALY 237
           TSG+TG PKG  LTHTN++ + VA +          DV ++ LPL H F +  +++   Y
Sbjct: 237 TSGSTGNPKGVMLTHTNMV-SEVAGANFSPAGVIPEDVHMSYLPLAHSF-ERAVVSLMCY 294

Query: 238 RHGTMVLMPRFDG--DEALSLMEKEKVTIFAGVPTMY----------------------- 272
             G +     F G   E  + ++  + T   G P ++                       
Sbjct: 295 VGGQIGF---FSGLIPELFNDIQVLRPTFLCGAPRVWQRLHDKLWFTVNNDSWLKKFLFN 351

Query: 273 WGLLNAQGDHDI----------------KQISQTLHTAVSGGASLPAEVARKVKEKFGIE 316
           WGL + Q    +                 ++   +   +SG A L  ++A  ++  F   
Sbjct: 352 WGLNSKQSALRLGSTTPIWDKLVFSKTKDRLGGRVKFILSGSAPLDPKLAEFLRACFCCP 411

Query: 317 ILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVD----ENFNTIEGEGPGEIA 372
           ++ GYGLSE     S   P+     G +G P+   EMKL+D      F+T +    GE+ 
Sbjct: 412 VVSGYGLSENVGGASVAYPEDN-NVGHVGPPLSACEMKLIDVPEMNYFSTDKPCPRGEVC 470

Query: 373 VRGHCVMKGYHNRPEANAQVMR-DGWFRTGDIARRDEEGFYFIIDRSKDMI-IRGGYNVY 430
           +RG  V KGY   PE   + ++ DGWF TGDI R +E G   IIDR K++  +  G  V 
Sbjct: 471 IRGFNVFKGYFKDPEKTKEDLKEDGWFHTGDIGRWNENGTLSIIDRKKNIFKLSQGEYVA 530

Query: 431 PREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK 490
              +E V +  P  S   V       +G+ + +F++   G  + + E++    ++L A K
Sbjct: 531 AEYLESVFVRSPFASQVFV-------YGDSLNSFLV---GVVVPDFEVV----QKLFASK 576

Query: 491 YPRI 494
           YP +
Sbjct: 577 YPEL 580


>ACSA_PSE14 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  127 bits (319), Expect = 2e-31
 Identities = 106/359 (29%), Positives = 169/359 (47%), Gaps = 21/359 (5%)

Query: 175 IIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
           I+YTSG+TG+PKG   T    LL+ A+    +FD  P   +++     +  + G + ++ 
Sbjct: 261 ILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYKPG--EIYWCTADVGWVTGHSYIVY 318

Query: 234 AALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS- 288
             L    T +L   +P + D      +++K KV I    PT    ++ A+G   ++    
Sbjct: 319 GPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMM-AEGTKSVEGADG 377

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSI 344
            +L    S G  +  E         G +   I++ +  +ET  ++    P   A KPGS 
Sbjct: 378 SSLRLLGSVGEPINPEAWGWYYNTVGKQNCPIVDTWWQTETGGILISPLPGATALKPGSA 437

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV-----MKGYHNRPEANAQVMRDGWFR 399
             P +GV   LVD   N IEG   G + +          + G H+R          G + 
Sbjct: 438 TRPFFGVIPALVDNLGNLIEGAAEGNLVILDSWPGQSRSLYGDHDRFVDTYFKTFRGMYF 497

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  ++ HP+V+ AAVVGVPHD  G+
Sbjct: 498 TGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEAAVVGVPHDLKGQ 557

Query: 460 EIKAFVI---PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            I  +V      E +     EL  W ++ +     P  +++   LP T +GKI++R LR
Sbjct: 558 GIYVYVTLNGGEEPSDALRTELRNWVRKEIGPIASPDFIQWAPGLPKTRSGKIMRRILR 616


>ACSA1_PSEPK RecName: Full=Acetyl-coenzyme A synthetase 1;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 1;AltName:
           Full=Acyl-activating enzyme 1;
          Length = 653

 Score =  127 bits (318), Expect = 3e-31
 Identities = 105/364 (28%), Positives = 172/364 (47%), Gaps = 21/364 (5%)

Query: 170 DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQ 228
           ++   I+YTSG+TG+PKG    T   L++ A+    +FD  P   +V+     +  + G 
Sbjct: 256 EEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRPG--EVYWCTADVGWVTGH 313

Query: 229 TTMMNAALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDI 284
           + ++   L    T +L   +P + D      +++K KV I    PT    ++ A+G   +
Sbjct: 314 SYIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTAIRAMM-AEGQAAV 372

Query: 285 KQIS-QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA- 339
           +     +L    S G  +  E      +  G E   I++ +  +ET  ++    P     
Sbjct: 373 EGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGGILISPLPGATGL 432

Query: 340 KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV-----MKGYHNRPEANAQVMR 394
           KPGS   P +GV   LVD   N I+G   G + +          + G H+R         
Sbjct: 433 KPGSATRPFFGVVPALVDNLGNLIDGAAEGNLVILDSWPGQSRSLYGDHDRFVDTYFKTF 492

Query: 395 DGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPH 454
            G + TGD ARRDE+G+Y+I  R  D++   G+ +   EIE  ++ H +V+ AAVVGVPH
Sbjct: 493 RGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHSKVAEAAVVGVPH 552

Query: 455 DTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILK 511
           D  G+ I  +V    G   +E    EL  W ++ +     P ++++   LP T +GKI++
Sbjct: 553 DIKGQGIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQWAPGLPKTRSGKIMR 612

Query: 512 RELR 515
           R LR
Sbjct: 613 RILR 616


>AAS_ERWT9 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  127 bits (318), Expect = 3e-31
 Identities = 130/478 (27%), Positives = 197/478 (41%), Gaps = 36/478 (7%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R  +PG+ V L  PN         GA   G V   LN     + +   L     K +
Sbjct: 247 ILERYSQPGEYVGLLLPNATVTAAAILGASMRGRVPAMLNYTAGVKGLTSALTAGEIKTV 306

Query: 104 FAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFE 163
           F  T    L  G + W   Q + + + +I L       T+     +  W   +       
Sbjct: 307 F--TSRQFLDKG-KLWHLPQGITQVK-WIYLEDLKDTLTTQ----DKLWILGHLLLPRRA 358

Query: 164 SVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLF 223
            V  + +D A++++TSG+ G PKG   +H +LL N      + D  P   D F++ LPLF
Sbjct: 359 MVAQQPEDAAMVLFTSGSEGHPKGVVHSHKSLLANVEQIRTVADFTPC--DRFMSALPLF 416

Query: 224 HIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           H FG T  +   L     + L P          L+     T+  G  T           +
Sbjct: 417 HAFGLTVGLFTPLMTGARVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPY 476

Query: 283 DIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPG 342
           D  +    L   V+G   L         EK+GI ILEGYG++E +PVV+ N P   AK  
Sbjct: 477 DFAR----LRYVVAGAEKLQDHTRELWMEKYGIRILEGYGVTECAPVVAINVP-MAAKSH 531

Query: 343 SIGLPIWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEAN--AQ 391
           ++G  + G++ +LV     ++ G E  G + +RG  +MKGY           P+A+    
Sbjct: 532 TVGRILPGMDSRLV-----SVPGIEQGGRLQLRGPNIMKGYLRVEHPGRLEAPQADNGEG 586

Query: 392 VMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG 451
            M  GW+ TGDI   DE GF  I  R K      G  V    +E++          A   
Sbjct: 587 QMEPGWYDTGDIVSFDEGGFCQIQGRVKRFAKIAGEMVSLEIVEQIARNASDDKQHAATI 646

Query: 452 VPHDTHGEEIKAFVIPAEGATLTEDELIAWAKE-RLAAYKYPRIVEFRTELPMTATGK 508
            P    GE +  F   A+   LT ++L+  A+E        PR +   ++LP+  +GK
Sbjct: 647 KPDGNRGEALVLFTTDAQ---LTREQLMHSARELGSPELAVPRDIRLLSQLPLLGSGK 701


>ACSA_PSEU2 RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  126 bits (317), Expect = 4e-31
 Identities = 106/359 (29%), Positives = 169/359 (47%), Gaps = 21/359 (5%)

Query: 175 IIYTSGTTGQPKGAQLTHTN-LLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMN 233
           I+YTSG+TG+PKG   T    LL+ A+    +FD  P   +V+     +  + G + ++ 
Sbjct: 261 ILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYRPG--EVYWCTADVGWVTGHSYIVY 318

Query: 234 AALYRHGTMVL---MPRF-DGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS- 288
             L    T +L   +P + D      +++K KV I    PT    ++ A+G   ++    
Sbjct: 319 GPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMM-AEGTKSVEGADG 377

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIE---ILEGYGLSETSPVVSFNNPKRKA-KPGSI 344
            +L    S G  +  E         G +   I++ +  +ET  ++    P   A KPGS 
Sbjct: 378 SSLRLLGSVGEPINPEAWAWYYNTVGKQNCPIVDTWWQTETGGILISPLPGATALKPGSA 437

Query: 345 GLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCV-----MKGYHNRPEANAQVMRDGWFR 399
             P +GV   LVD   N IEG   G + +          + G H+R          G + 
Sbjct: 438 TRPFFGVIPALVDNLGNLIEGAAEGNLVILDSWPGQSRSLYGDHDRFVDTYFKTFRGMYF 497

Query: 400 TGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGE 459
           TGD ARRDE+G+++I  R  D++   G+ +   EIE  ++ HP+V+ AAVVGVPHD  G+
Sbjct: 498 TGDGARRDEDGYFWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEAAVVGVPHDLKGQ 557

Query: 460 EIKAFVI---PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
            I  +V      E +     EL  W ++ +     P  +++   LP T +GKI++R LR
Sbjct: 558 GIYVYVTLNGGEEPSDALRTELRNWVRKEIGPIASPDFIQWAPGLPKTRSGKIMRRILR 616


>AAS_ERWCT RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 738

 Score =  126 bits (317), Expect = 4e-31
 Identities = 105/353 (29%), Positives = 161/353 (45%), Gaps = 30/353 (8%)

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           DD A++++TSG+ G PKG   +H +LL N      + D  P   D F++ LPLFH FG T
Sbjct: 365 DDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTPG--DRFMSALPLFHAFGLT 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
             +   L     + L P          L+  +  T+  G  T           +D  ++ 
Sbjct: 423 VGLLTPLITGARVFLYPSPLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAHPYDFARLR 482

Query: 289 QTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLP 347
                 V  GA   +E  R+V ++KFGI ILEGYG++E +PVV+ N P    K  S+GL 
Sbjct: 483 Y-----VVAGAEKLSETTRQVWQDKFGIRILEGYGVTECAPVVAINVP-MATKIHSVGLL 536

Query: 348 IWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY---------HNRPEANAQ-VMRDG 396
           +  +E +L+     T+ G    G + +RG  +MKGY               NA+  ++ G
Sbjct: 537 LPEMESRLI-----TVPGITRGGRLQLRGPNIMKGYLRVENPGVLETPAAENAEGELQQG 591

Query: 397 WFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDT 456
           W+ TGDI   DE GF  II R K      G  V    +E++ +     +  A       +
Sbjct: 592 WYDTGDIVELDERGFCTIIGRVKRFAKLAGEMVSLESVEQLAVKVSPEAQHAASAKSDSS 651

Query: 457 HGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
            GE +  F   ++   +T D L+A A+   +     PR + +   LP+  +GK
Sbjct: 652 KGEALVLFTTDSQ---ITRDVLLAQARSSGVPELAVPRDIRYVKALPLLGSGK 701


>AAS_CITK8 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 719

 Score =  126 bits (317), Expect = 4e-31
 Identities = 118/472 (25%), Positives = 200/472 (42%), Gaps = 40/472 (8%)

Query: 52  GDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPE 111
           G+ + L  PN      V FGA+  G +   +N     + +   +  +  K +F  T    
Sbjct: 255 GENIGLMLPNAAISAAVIFGAVSRGRIPAMMNYTAGVKGLTSAITAAEIKTVF--TSRQF 312

Query: 112 LPLGERAWQAFQEVAECE-LYI-DLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEG 169
           L  G + W   +++ +   +Y+ DL A        +  A+  W   +        V+   
Sbjct: 313 LEKG-KLWHLPEQLTQVRWIYLEDLKAD-------VTLADKLWIFAHLLMPRLAQVKQRP 364

Query: 170 DDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT 229
           ++ A+I++TSG+ G PKG   +H +LL N      + D    ++D F++ LPLFH F   
Sbjct: 365 EEAAMILFTSGSEGHPKGVVHSHKSLLANVEQIKTIADFT--ANDRFMSALPLFHSFXXX 422

Query: 230 TMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS 288
                       + L P          L+     T+  G  T           +D  +  
Sbjct: 423 XXXXXXXXXXAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR-- 480

Query: 289 QTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPI 348
             L   V+G   L     +  ++KFG+ +LEGYG++E +PVVS N P   AKPG++G  +
Sbjct: 481 --LRYVVAGAEKLQDSTRQLWQDKFGLRVLEGYGVTECAPVVSINVP-MAAKPGTVGRIL 537

Query: 349 WGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEANAQV--MRDGW 397
            G++ +L+      + G +  G + ++G  +M GY           P A   +  +  GW
Sbjct: 538 PGMDARLL-----AVPGIDDGGRLQLKGPNIMNGYLRVEKPGVLEAPAAENALGDVEQGW 592

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTH 457
           + TGDI R DE GF  I  R+K      G  V    +E++ +      + A       + 
Sbjct: 593 YDTGDIVRFDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKMHATAIKSDASK 652

Query: 458 GEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
           GE +  F    E   LT + L+ +A+   +     PR + +  +LP+  +GK
Sbjct: 653 GEALVLFTTDGE---LTRESLLQYARTHGIPELAVPRDIRYLKQLPLLGSGK 701


>ACSA_SHELP RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 650

 Score =  125 bits (314), Expect = 8e-31
 Identities = 128/512 (25%), Positives = 211/512 (41%), Gaps = 27/512 (5%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  ++    + AN L S+G+R GD V +  P VP    V     + GA+   +    +
Sbjct: 108 LTYGELHTEVCKFANALRSQGVRRGDVVTVYMPMVPEAAVVMLACARIGAIHSVVFGGFS 167

Query: 88  PREIEYHLRDSGAKALFA----FTGTPELPLGERAWQAFQEV-AECELYIDLPAAAGATT 142
           P  I   + D  +K +        G   +PL     +A       C   + +    G   
Sbjct: 168 PDSIASRVIDGKSKVVITADEGVRGGRTIPLKANIDEALSHPDVTCVEKVIVLERTGNPV 227

Query: 143 SAIPGAETFWAALNGQPGEFESVRTEG-DDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAV 200
           + + G +  WA+L     E       G +D   ++YTSG+TG PKG    T   L++ ++
Sbjct: 228 NWVEGRDIKWASLMETASEHCVAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYASM 287

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL---MPRFDGDEALS-L 256
               +FD      +++     +  I G + M+   L    T+++   +P +     L  +
Sbjct: 288 THEYVFDYKEG--EIYWCTADVGWITGHSYMVYGPLANGATILIHEGIPNYPTPARLGEM 345

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFGI 315
           +++ KV I    PT+   L+ A+G          +L    S G  +  E  R   E  G 
Sbjct: 346 IDRHKVNILYTAPTLIRALM-AEGKEQFDGFDGSSLRIMGSVGEPINPEAWRWYHEVIGH 404

Query: 316 E---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371
           E   I++ +  +ET  ++    P     KPGS   P +GV+  LVD   N I+G   G +
Sbjct: 405 ENCPIVDTWWQTETGGILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIIDGAAEGNL 464

Query: 372 AVRGHC-----VMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGG 426
            +          + G H+R          G + TGD ARRDE+G+Y+I  R  D+I   G
Sbjct: 465 VILDSWPGQMRTVYGDHDRFALTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSG 524

Query: 427 YNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGA---TLTEDELIAWAK 483
           + +                     G PHD  G+ I A+V   +G             W +
Sbjct: 525 HRLGTXXXXXXXXXXXXXXXXXXXGYPHDIKGQGIYAYVTLTKGTXXXXXXXXXXXXWVR 584

Query: 484 ERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + + A   P ++++   LP T +GKI++R LR
Sbjct: 585 KEIGALATPDLIQWAGGLPKTRSGKIMRRFLR 616


>AAS_YERE8 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  125 bits (314), Expect = 8e-31
 Identities = 123/478 (25%), Positives = 198/478 (41%), Gaps = 36/478 (7%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R    G+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTAQGEHVGMLLPNXXXXXXXXFGATLRGRIPALLNYTSGAKGLKSAITAASLKTI 306

Query: 104 FAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFE 163
              T    L  G+      Q      +Y++           +  A+  W   +       
Sbjct: 307 I--TSRQFLEKGKLTHLPEQVTEANWVYLE------DLKDTVTLADKLWILFHLCCPRRA 358

Query: 164 SVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLF 223
            V  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D F++ LPLF
Sbjct: 359 MVPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RDRFMSSLPLF 416

Query: 224 HIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDH 282
           H FG T  +   L     + L P          L+     T+  G  T           +
Sbjct: 417 HAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPY 476

Query: 283 DIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPG 342
           D  +    L   V+G   L     +  ++KFGI ILEGYG++E +PVV+ N P   AK  
Sbjct: 477 DFAR----LRYVVAGAEKLADSTKQIWQDKFGIRILEGYGVTECAPVVAINVP-MAAKVN 531

Query: 343 SIGLPIWGVEMKLVDENFNTIEG-EGPGEIAVRGHCVMKGY--------HNRPEA-NAQV 392
           ++G  + G+E +++      + G E  G + +RG  +M+GY          +P A N Q 
Sbjct: 532 TVGRILPGMESRVI-----PVPGIEQGGRLQLRGPNIMRGYLRVEKPGVLEQPSAENTQG 586

Query: 393 MRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG 451
            ++ GW+ TGDI   DE+GF  I  R K      G  V    +E++++        A   
Sbjct: 587 EQEAGWYDTGDIVAIDEQGFCTIRGRMKRFAKLAGEMVSLESVEQLVLRISPEGQHAAAT 646

Query: 452 VPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGK 508
                 GE +  F   +E   +T ++L+  A+E  +     PR +     LP+  +GK
Sbjct: 647 KTDSAKGEALVLFTTDSE---ITREKLVKAARESGVPELAVPRDIRVVKALPLLGSGK 701


>ACS2_CANAL RecName: Full=Acetyl-coenzyme A synthetase 2;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 2;AltName:
           Full=Acyl-activating enzyme 2;
          Length = 671

 Score =  125 bits (313), Expect = 1e-30
 Identities = 137/519 (26%), Positives = 222/519 (42%), Gaps = 38/519 (7%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLT 87
           L Y  +    ++VA +L S GI+ GD VA+  P             + GA    +    +
Sbjct: 124 LTYGDLLREVSKVAGVLQSWGIKKGDTVAVYLPMNAQAIIAMLAIARLGAAHSVIFAGFS 183

Query: 88  PREIEYHLRDSGAKALFAFT----GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTS 143
              I+  + D+  KAL        G     + +   +A  +    E  +           
Sbjct: 184 AGSIKDRVNDASCKALITCDEGKRGGRTTNIKKLCDEALVDCPTVEKVLVYKRTNNPEIH 243

Query: 144 AIPGAETFWAALNGQ-PGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVA 201
              G + +W     + PG    V    +D   ++YTSG+TG PKG    T   LL  A++
Sbjct: 244 LTEGRDYYWDVETAKFPGYLPPVSVNSEDPLFLLYTSGSTGTPKGVVHSTAGYLLGAALS 303

Query: 202 SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEAL------- 254
           +  +FD  P+  D+  T   +  I G T  +   L      ++   F+G  A        
Sbjct: 304 TKYIFDIHPE--DILFTAGDVGWITGHTYALYGPLLLGVPTII---FEGTPAYPDYGRFW 358

Query: 255 SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKF 313
            ++EK K T F   PT    LL   G+ +I +    +L T  S G  +  ++     E  
Sbjct: 359 QIVEKHKATHFYVAPTAL-RLLRKAGEQEIAKYDLSSLRTLGSVGEPISPDIWEWYNEFV 417

Query: 314 G---IEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNT-IEG-EG 367
           G     I + Y  +E+ S +++        KPGS   P +G++  L+D      IEG + 
Sbjct: 418 GKNQCHISDTYWQTESGSHLIAPLAGVVPNKPGSASYPFFGIDAALIDPVTGVEIEGNDA 477

Query: 368 PGEIAVRGHCVMKG---YHNRPEANAQVMRD--GWFRTGDIARRDEEGFYFIIDRSKDMI 422
            G +A++ H        Y N  +     M    G++ TGD A RD +G+Y+I  R  D++
Sbjct: 478 EGVLAIKDHWPSMARTVYKNHTKYMDTYMNPYPGYYFTGDGAARDHDGYYWIRGRVDDVV 537

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTED------ 476
              G+ +   EIE  L+   +VS AAVVG+  D  G+ + A+V   EG +  ED      
Sbjct: 538 NVSGHRLSTAEIEAALIEDKKVSEAAVVGIHDDITGQAVIAYVALKEGNS-DEDSEGLRK 596

Query: 477 ELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           EL+   ++ +  +  P+ V    +LP T +GKI++R LR
Sbjct: 597 ELVLQVRKTIGPFAAPKSVIIVQDLPKTRSGKIMRRILR 635


>ACSL1_MOUSE RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
              EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA
           synthetase 1;         Short=LACS 1;
          Length = 699

 Score =  124 bits (312), Expect = 1e-30
 Identities = 137/516 (26%), Positives = 211/516 (40%), Gaps = 79/516 (15%)

Query: 28  LNYALVNMIANQVANLLVSRGIRPGDK--VALACPNVPYFPFVYFGALKAGAVVVPLNVL 85
           ++Y  V  +A  + + L+ +G +P  +  + L   N P +  V  G      VVVPL   
Sbjct: 122 ISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDT 181

Query: 86  LTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI 145
           L    I Y +  +    +FA        L E          +  + +D   +        
Sbjct: 182 LGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKK 241

Query: 146 PGAETFWAALNGQPGEFESVRT---EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAV-- 200
            G E          G    V+    E +D+A+I +TSGTTG PKGA +TH N++ +    
Sbjct: 242 CGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGF 301

Query: 201 --ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLME 258
             A+ + F  + D  DV ++ LPL H+F   T++   +  HG  +    F GD  L LM+
Sbjct: 302 IKATESAFIASTD--DVLISFLPLAHMF--ETVVECVMLCHGAKIGF--FQGDIRL-LMD 354

Query: 259 KEKV---TIFAGVPTMYWGLLNAQGDHDIKQISQTL------------------------ 291
             KV   TIF  VP     LLN   D    Q + +L                        
Sbjct: 355 DLKVLQPTIFPVVPR----LLNRMFDRIFGQANTSLKRWLLDFASKRKEADVRSGIVRNN 410

Query: 292 -------------------HTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSF 332
                                 ++G A + A V   ++   G +  EGYG +E +     
Sbjct: 411 SLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCL 470

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ 391
           + P      G +G P+    +KLVD E  N +  +G GE+ V+G  V KGY   P   A+
Sbjct: 471 SLPGDWTA-GHVGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKDPARTAE 529

Query: 392 VM-RDGWFRTGDIARRDEEGFYFIIDRSKDMI-IRGGYNVYPREIEEVLMTHPQVSLAAV 449
            + +DGW  TGDI +    G   IIDR K +  +  G  + P +IE + +    V+   V
Sbjct: 530 ALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFV 589

Query: 450 VGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER 485
                  HGE ++AF+I         + L +WA++R
Sbjct: 590 -------HGESLQAFLIAV--VVPDVESLPSWAQKR 616


>ACSA_DROME RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 670

 Score =  124 bits (312), Expect = 1e-30
 Identities = 134/516 (25%), Positives = 207/516 (40%), Gaps = 48/516 (9%)

Query: 41  ANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGA 100
           AN+L   GIR GD+V++  P +   P       + GAV   +    +P  +   + D  A
Sbjct: 129 ANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKA 188

Query: 101 KALFAFTGT--PELPLG---------ERAWQAFQEVAECELYIDL----PAAAGATTSAI 145
           K L    G    E PL          E+  +    V +C +   L    P         I
Sbjct: 189 KLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEI 248

Query: 146 PGAET--FW--AALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAV 200
           P  +   +W    +  +         + +D   ++YTSG+TG+PKG              
Sbjct: 249 PWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHXXXXXXXXXXX 308

Query: 201 ASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRFDG-DEALSL 256
               +FD  P   D++     +  I G T ++   L    T V+    P F G D   S+
Sbjct: 309 XFKIVFDYKPG--DIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSV 366

Query: 257 MEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIE 316
           ++K KVT F   PT    L+       +K     L    S G  +  E      +  G E
Sbjct: 367 IDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKE 426

Query: 317 ---ILEGYGLSETSPVVSFNNP-KRKAKPGSIGLPIWGVEMKLVDEN----------FNT 362
              I++ +  +ET   V    P     KPGS   P +GV+  L+D            +  
Sbjct: 427 QCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDXXXXXXXXXXXXYLV 486

Query: 363 IEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMI 422
                PG +       +   H R E        G++ TGD ARRD +G+ +I  R  DM+
Sbjct: 487 FSQPWPGMMRT-----LYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDML 541

Query: 423 IRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTE---DELI 479
              G+ +   E+E VL  HP+V+ +AVV  PH   GE +  F+ P E     +    +L 
Sbjct: 542 NVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLK 601

Query: 480 AWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
              +ER+  +  P +++    LP T +GKI++R LR
Sbjct: 602 KMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLR 637


>ACS2L_HUMAN RecName: Full=Acetyl-coenzyme A synthetase 2-like,
           mitochondrial;         EC=6.2.1.1;AltName:
           Full=Acetate--CoA ligase 2;
          Length = 689

 Score =  124 bits (311), Expect = 2e-30
 Identities = 139/553 (25%), Positives = 229/553 (41%), Gaps = 50/553 (9%)

Query: 2   LNLSV-LLEDGARNRPERDAIVFG------DMRLNYALVNMIANQVANLLVSRGIRPGDK 54
           LN+SV  L+   R  PE  A+++       ++R+ Y  +     ++AN L   G+  GD+
Sbjct: 108 LNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDR 167

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPL 114
           VA+  P  P          + GAV   +    +   +   + D+  K +  F        
Sbjct: 168 VAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLR--- 224

Query: 115 GERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTE------ 168
           G R  +  + V E   +   P       +     +     L+  P E E  + +      
Sbjct: 225 GGRVVELKKIVDEAVKHC--PTVQHVLVAHRTDNKVHMGDLD-VPLEQEMAKEDPVCAPE 281

Query: 169 ---GDDVAVIIYTSGTTGQPKGAQLTHTN---LLFNAVASSALFDQAPDSHDVFLTVLPL 222
               +D+  ++YTSG+TG PKG  + HT    LL+ A+    +FD  P   D+F  V  +
Sbjct: 282 SMGSEDMLFMLYTSGSTGMPKG--IVHTQAGYLLYAALTHKLVFDHQPG--DIFGCVADI 337

Query: 223 FHIFGQTTMMNAALYRHGTMVLMPRF----DGDEALSLMEKEKVTIFAGVPTMYWGLLNA 278
             I G + ++   L    T VL        +       +E+ K+  F G PT    LL  
Sbjct: 338 GWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAV-RLLLK 396

Query: 279 QGDHDIKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNN 334
            GD  +K+  ++ L T  S G  +  E    +    G     +++ +  +ET  +     
Sbjct: 397 YGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPR 456

Query: 335 PKRKAK---PGSIGLPIWGVEMKLVDENFNTIEGEG-PGEIAVRGHC-----VMKGYHNR 385
           P  +     P     P +G+   L+DE  + +EG    G + +          + G H R
Sbjct: 457 PSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQR 516

Query: 386 PEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVS 445
                     G++ TGD A R E G+Y I  R  D+I   G+ +   EIE+ +  HP V 
Sbjct: 517 FVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVP 576

Query: 446 LAAVVGVPHDTHGEEIKAFVIPAEGA---TLTEDELIAWAKERLAAYKYPRIVEFRTELP 502
            +AV+G PHD  GE   AF++  + A    +   EL +    ++A Y  P  +     LP
Sbjct: 577 ESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLP 636

Query: 503 MTATGKILKRELR 515
            T +GK+++R LR
Sbjct: 637 KTRSGKVMRRLLR 649


>PPSA_BACSU RecName: Full=Plipastatin synthetase subunit A;       
           EC=2.3.1.-;AltName: Full=Peptide synthetase 1;Includes: 
           RecName: Full=ATP-dependent glutamate adenylase 1;
          Length = 2561

 Score =  123 bits (308), Expect = 4e-30
 Identities = 140/526 (26%), Positives = 218/526 (41%), Gaps = 59/526 (11%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L E  A   PER AI F    L YA ++M A+++A  L +RG+     V +     P   
Sbjct: 463 LFERQAAFTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDML 522

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                 LKAG   +PL+       + Y L+DSGA  L    G                  
Sbjct: 523 IAVLAVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLTQPGC----------------- 565

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGE-FESVRTEGDDVAVIIYTSGTTGQP 185
                   P  +G T       E    +L  +  E  E    +G  +A +IYTSG+TGQP
Sbjct: 566 ------SAPNFSGETL------EVDMTSLASEKAENHEFTPADGGSLAYVIYTSGSTGQP 613

Query: 186 KGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQT-TMMNAALYRHGTMVL 244
           KG  + H   +      + +  Q P S D  + V   F        +   +L      +L
Sbjct: 614 KGVAVEHRQAV---SFLTGMQHQFPLSEDDIVMVKTSFSFDASVWQLFWWSLSGASAYLL 670

Query: 245 MPRFDGDEAL--SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ--TLHTAVSGGAS 300
            P ++ D AL    + +E VT    +P M    L+     +I+++S   +L    +GG  
Sbjct: 671 PPGWEKDSALIVQAIHQENVTTAHFIPAMLNSFLD---QAEIERLSDRTSLKRVFAGGEP 727

Query: 301 L-PAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAK--PGSIGLPIWGVEMKL 355
           L P   AR       + ++ GYG +E +   +F   +P+R        IG P+ G  + +
Sbjct: 728 LAPRTAARFASVLPQVSLIHGYGPTEATVDAAFYVLDPERDRDRLRIPIGKPVPGARLYV 787

Query: 356 VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDG-------WFRTGDIARRDE 408
           +D +         GE+ + G  V +GY NRP    +   +         ++TGD+AR   
Sbjct: 788 LDPHLAVQPSGVAGELYIAGAGVARGYLNRPALTEERFLEDPFYPGERMYKTGDVARWLP 847

Query: 409 EGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468
           +G    + R+ D +   GY + P EIE  L +   V  AAV  V  D+   E+ A+V   
Sbjct: 848 DGNVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVT-VRTDSGEPELCAYV--- 903

Query: 469 EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
           EG  L  +E+ A  +  L  Y  P  +    + P+T +GK+ +  L
Sbjct: 904 EG--LQRNEVRAQLERLLPGYMVPAYMIEMEQWPVTPSGKLDRNAL 947



 Score =  106 bits (265), Expect = 4e-25
 Identities = 124/525 (23%), Positives = 211/525 (40%), Gaps = 50/525 (9%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            + E  A   PE  A++  +  ++Y               +R         LA  ++    
Sbjct: 1503 IFEAKAEENPEHIAVIDNETEISYXXXXXXXXXXXXXXQNRKGPKPTVAVLAKRSIDAIV 1562

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
             V    +KAG V +P++       IEY LRDSGA  L        L           E  
Sbjct: 1563 GV-LAVMKAGGVYIPIDAHYPKARIEYILRDSGADILLLQRELKHLISNS------PESE 1615

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
               +++D   +   +             LN  P   E V         IIYTSGTTG PK
Sbjct: 1616 MSHIFLDDEGSFEESN----------CNLNLSPAPEEPV--------YIIYTSGTTGAPK 1657

Query: 187  GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
            G  +T+ N    A+A   +++   D   V L  +  F     +  +   L   GT+++ P
Sbjct: 1658 GVIVTYQNFTHAALAWRQIYEL--DRKPVRLLQIASFSFDVFSGDLARTLTNGGTLIVCP 1715

Query: 247  ---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPA 303
               R +  E   +++ +++T+    P +   ++     +  K     L   + G   + A
Sbjct: 1716 DETRLEPAEIYKIIKSQRITVMESTPALIIPVMEYVYRNQFK--LPDLDILILGSDMVKA 1773

Query: 304  EVARKVKEKFG--IEILEGYGLSETSPVVSFNNPKRKAKPGS----IGLPIWGVEMKLVD 357
            +  + + ++FG  + I+  YG++E +   SF       +       IG P+  V M ++ 
Sbjct: 1774 QDFKTLTDRFGQSMRIINSYGVTEATIDSSFYETSMGGECTGDNVPIGSPLPNVHMYVLS 1833

Query: 358  ENFNTIEGEGPGEIAVRGHCVMKGYHNRPE-------ANAQVMRDGWFRTGDIARRDEEG 410
            +          GE+ + G  V KGYH++P+        N  V  +  +RTGD A     G
Sbjct: 1834 QTDQIQPIGVAGELCIGGAGVAKGYHHKPDLTQMKFTENPFVSGERLYRTGDRACWLPNG 1893

Query: 411  FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEE-IKAFVIPAE 469
               ++ R    +   GY +   EIE VL+    V  AA V V HD +G+  + A+++P++
Sbjct: 1894 TIRLLGRMDYQVKINGYRIETEEIESVLLQTGLVREAA-VAVQHDKNGQAGLAAYIVPSD 1952

Query: 470  GATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
               +  + L A   + L AY  P  +     +P+T  GK+ +  L
Sbjct: 1953 ---VNTNALRAALTKELPAYMIPAYLIPLVNMPLTLNGKLDRNAL 1994


>AAS_YERPY RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKAARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>AAS_YERPS RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKAARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>AAS_YERPP RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKVARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>AAS_YERPG RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKVARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>AAS_YERPB RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKAARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>AAS_YERP3 RecName: Full=Bifunctional protein aas;Includes:
           RecName: Full=2-acylglycerophosphoethanolamine
           acyltransferase;           EC=2.3.1.40;
          Length = 718

 Score =  123 bits (308), Expect = 4e-30
 Identities = 126/487 (25%), Positives = 197/487 (40%), Gaps = 54/487 (11%)

Query: 44  LVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKAL 103
           ++ R   PG+ V +  PN        FGA   G +   LN     + ++  +  +  K +
Sbjct: 247 ILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIAASLKTI 306

Query: 104 FA---------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
                       T  PE  + E  W   +++ +     D                  W  
Sbjct: 307 VTSRQFLEKGKLTHLPE-QVNEVNWVYLEDLKDTVTLTD----------------KLWIL 349

Query: 155 LNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHD 214
            +        +  + DD A+I++TSG+ G PKG   +H +LL N      + D  P   D
Sbjct: 350 FHLCFPRRAMLPQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTP--RD 407

Query: 215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR-FDGDEALSLMEKEKVTIFAGVPTMYW 273
            F++ LPLFH FG T  +   L     + L P          L+     T+  G  T   
Sbjct: 408 RFMSSLPLFHAFGLTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLG 467

Query: 274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKV-KEKFGIEILEGYGLSETSPVVSF 332
                   +D  ++       V  GA   AE  +++ ++KFGI ILEGYG++E +PVV+ 
Sbjct: 468 NYARFAHPYDFARVRY-----VVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAI 522

Query: 333 NNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMKGY--------HN 384
           N P   AK  ++G  + G+E +L+    N       G + +RG  +M+GY          
Sbjct: 523 NVP-MAAKVNTVGRILPGMEARLI----NVPGIAQGGRLQLRGPNIMRGYLRVENPGVLE 577

Query: 385 RPEA-NAQVMRD-GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHP 442
           +P A NAQ   D  W+ TGDI   DE+GF  I  R K      G  V    +E++ ++  
Sbjct: 578 QPSAENAQGELDANWYDTGDIVTLDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLS 637

Query: 443 QVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKER-LAAYKYPRIVEFRTEL 501
                A         GE +  F   +E   +T + LI  A+E  +     PR +     L
Sbjct: 638 PEGQHAAAAKTDSAKGEALVLFTTDSE---ITRERLIKAARENGVPELAVPRDIRVVKAL 694

Query: 502 PMTATGK 508
           P+  +GK
Sbjct: 695 PLLGSGK 701


>ACS2_DEBHA RecName: Full=Acetyl-coenzyme A synthetase 2;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase 2;AltName:
           Full=Acyl-activating enzyme 2;
          Length = 679

 Score =  122 bits (307), Expect = 5e-30
 Identities = 135/513 (26%), Positives = 218/513 (42%), Gaps = 40/513 (7%)

Query: 39  QVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDS 98
           QVA +L S GI+ GD VA+  P             + GA+   +    +   I+  + D+
Sbjct: 135 QVAGVLQSWGIKKGDTVAIYMPMNSQAIIAMLAVARLGAIHSVIFAGFSSGSIKDRVNDA 194

Query: 99  GAKALFAFT----GTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFWAA 154
             KAL        G   + + +   +A       E  +          +   G + +W+ 
Sbjct: 195 SCKALITCDEGRRGGKTINIKKLCDEALLNCPSIEKVLVYERTGNKEVTLKEGRDYWWSE 254

Query: 155 LNGQ-PGEFESVRTEGDDVAVIIYTSGTTGQPKGA-QLTHTNLLFNAVASSALFDQAPDS 212
              +  G    V    +D   ++YTSG+TG PKG    T   LL  A+ +  +FD  P+ 
Sbjct: 255 ETQKFAGYLPPVPVNSEDPLFLLYTSGSTGTPKGVVHSTAGYLLGAALTTKYVFDIHPE- 313

Query: 213 HDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM---PRF-DGDEALSLMEKEKVTIFAGV 268
            DV  T   +  I G T  +   L      V+    P F D      ++EK K T F   
Sbjct: 314 -DVLFTAGDVGWITGHTYALYGPLSLGVPTVVFEGTPAFPDYGRLWQIVEKHKATHFYVA 372

Query: 269 PTMYWGLLNAQGDHDIKQIS-QTLHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLS 324
           PT    LL   G+ +I++    +L T  S G  +  ++     EK G     + + Y  +
Sbjct: 373 PTAL-RLLRKSGEQEIEKYDLSSLRTLGSVGEPISPDIWEWYNEKVGKGQCHVTDTYWQT 431

Query: 325 ET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEG---PGEIAVRG---HC 377
           E+ S  ++        KPGS  +P +G++  L+D   + IE +G    G +AV+      
Sbjct: 432 ESGSHFIAPIAGVVPNKPGSAAVPFFGIQTCLIDP-VSGIEIQGNDVEGVLAVKDTWPSM 490

Query: 378 VMKGYHNRPEANAQVMRD--GWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIE 435
               Y N  +     +    G++ TGD A RD +G+Y+I  R  D++   G+ +   EIE
Sbjct: 491 ARSVYKNHTKYMDTYLNPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNVSGHRLSTAEIE 550

Query: 436 EVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI-------------PAEGATLTEDELIAWA 482
             L+ H  +S AAVVG+  D  G+ + AFV                E A   + E+I   
Sbjct: 551 AALIEHNAISEAAVVGMNDDLTGQTVVAFVALKEHLIANLKADESPEEALKLKKEMILQV 610

Query: 483 KERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
           + ++  +  P+ V    +LP T +GKI++R LR
Sbjct: 611 RTQIGPFAAPKSVIIVEDLPKTRSGKIMRRILR 643


>ACSA_MYCTU RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  122 bits (306), Expect = 7e-30
 Identities = 136/529 (25%), Positives = 221/529 (41%), Gaps = 43/529 (8%)

Query: 24  GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           GD R L Y+ +    ++ AN L   G+  GD+VA+  P +P          + G +   +
Sbjct: 102 GDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVV 161

Query: 83  NVLLTPREIEYHLRDSGAKALFAFTGT----PELPLGERAWQAFQEVAECEL-YIDLPAA 137
               T   ++  + D+ AK L    G        PL          + +C + ++ +   
Sbjct: 162 FGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKXXXXXXXXXIPDCSVEHVLVVRR 221

Query: 138 AGATTSAIPGAETFWAALNGQPGEFESVRT-EGDDVAVIIYTSGTTGQPKGAQLTHTNLL 196
            G   +   G + +W  + G      +    + +    ++YTSGTTG+PKG   T    L
Sbjct: 222 TGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYL 281

Query: 197 FNAVASS-ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF----DGD 251
                +   +FD  PDS DVF     +  + G T  +   L    T VL        D  
Sbjct: 282 TQCCYTMRTIFDVKPDS-DVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRH 340

Query: 252 EALSLMEKEKVTIFAGVPT-----MYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVA 306
               ++EK  VTI+   PT     M WG       HD+     +L    S G  +  E  
Sbjct: 341 RHFQIIEKYGVTIYYTAPTLIRMFMKWGR-EIPDSHDLS----SLRLLGSVGEPINPEAW 395

Query: 307 RKVKEKFG---IEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNT 362
           R  ++  G     +++ +  +ET S ++S       AKPGS   P+ G+  K+VD++ + 
Sbjct: 396 RWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDP 455

Query: 363 IEGEGPGEIAVRGHCVM--------KGYHNRPEAN-----AQVMRDGWFRTGDIARRDEE 409
           +     G   V G+ V+        +G    P        ++    G++  GD AR D +
Sbjct: 456 LPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPD 515

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           G  +++ R  D++   G+ +   E+E  L+ H  V+ AAVVGV  +T  + I AFV+   
Sbjct: 516 GAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRA 575

Query: 470 GAT---LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                  T +EL       ++    PR V    ELP T +GKI++R LR
Sbjct: 576 NYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLR 624


>ACSA_MYCBO RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 651

 Score =  122 bits (306), Expect = 7e-30
 Identities = 136/529 (25%), Positives = 221/529 (41%), Gaps = 43/529 (8%)

Query: 24  GDMR-LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPL 82
           GD R L Y+ +    ++ AN L   G+  GD+VA+  P +P          + G +   +
Sbjct: 102 GDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVV 161

Query: 83  NVLLTPREIEYHLRDSGAKALFAFTGT----PELPLGERAWQAFQEVAECEL-YIDLPAA 137
               T   ++  + D+ AK L    G        PL          + +C + ++ +   
Sbjct: 162 FGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKXXXXXXXXXIPDCSVEHVLVVRR 221

Query: 138 AGATTSAIPGAETFWAALNGQPGEFESVRT-EGDDVAVIIYTSGTTGQPKGAQLTHTNLL 196
            G   +   G + +W  + G      +    + +    ++YTSGTTG+PKG   T    L
Sbjct: 222 TGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYL 281

Query: 197 FNAVASS-ALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRF----DGD 251
                +   +FD  PDS DVF     +  + G T  +   L    T VL        D  
Sbjct: 282 TQCCYTMRTIFDVKPDS-DVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRH 340

Query: 252 EALSLMEKEKVTIFAGVPT-----MYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVA 306
               ++EK  VTI+   PT     M WG       HD+     +L    S G  +  E  
Sbjct: 341 RHFQIIEKYGVTIYYTAPTLIRMFMKWGR-EIPDSHDLS----SLRLLGSVGEPINPEAW 395

Query: 307 RKVKEKFG---IEILEGYGLSET-SPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNT 362
           R  ++  G     +++ +  +ET S ++S       AKPGS   P+ G+  K+VD++ + 
Sbjct: 396 RWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDP 455

Query: 363 IEGEGPGEIAVRGHCVM--------KGYHNRPEAN-----AQVMRDGWFRTGDIARRDEE 409
           +     G   V G+ V+        +G    P        ++    G++  GD AR D +
Sbjct: 456 LPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPD 515

Query: 410 GFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469
           G  +++ R  D++   G+ +   E+E  L+ H  V+ AAVVGV  +T  + I AFV+   
Sbjct: 516 GAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRA 575

Query: 470 GAT---LTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELR 515
                  T +EL       ++    PR V    ELP T +GKI++R LR
Sbjct: 576 NYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLR 624


>PPSC_BACSU RecName: Full=Plipastatin synthetase subunit C;       
           EC=2.3.1.-;AltName: Full=Peptide synthetase 3;Includes: 
           RecName: Full=ATP-dependent glutamate adenylase 2;
          Length = 2555

 Score =  122 bits (305), Expect = 9e-30
 Identities = 134/524 (25%), Positives = 210/524 (40%), Gaps = 55/524 (10%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L E  A   PER AI F    L YA ++M A+++A  L +RG+     V +     P   
Sbjct: 469 LFERQAAVTPERLAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDML 528

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                 LKAG   +PL+       + Y L+DSGA  L    G           +      
Sbjct: 529 IAVLAVLKAGGAYLPLDPAYPKERLSYMLKDSGASLLLTQPGCSAPNFSGETLEVDMTSL 588

Query: 127 ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
           ECE                            +     S       +A +IYTSG+TGQPK
Sbjct: 589 ECE----------------------------EVKRHVSASVSDGSLAYVIYTSGSTGQPK 620

Query: 187 GAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMP 246
           G  + H   +         F  + D  D+ +             +   AL      +L P
Sbjct: 621 GVAVEHRQAVSFLTGMQHQFRLSED--DIVMVKTSFSFDASVWQLFWWALSGASAYLLPP 678

Query: 247 RFDGDEAL--SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQ--TLHTAVSGGASL- 301
            ++ D AL    + +E VT    +P M    L+     +I+++S   +L    +GG  L 
Sbjct: 679 GWEKDSALIVQAIHQENVTTAHFIPAMLNSFLD---QAEIERLSDRTSLKRVFAGGEPLA 735

Query: 302 PAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAK--PGSIGLPIWGVEMKLVD 357
           P   AR       + ++ GYG +E +   +F   +P+R        IG P+ G  + ++D
Sbjct: 736 PRTAARFASVLPQVSLIHGYGPTEATVDAAFYVLDPERDRDRLRIPIGKPVPGARLYVLD 795

Query: 358 ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-------VMRDGWFRTGDIARRDEEG 410
            +         GE+ + G  V +GY NRP    +        + +  ++TGD+AR   +G
Sbjct: 796 PHLAVQPSGVAGELYIAGAGVARGYLNRPALTEERFLEDPFYLGERMYKTGDVARWLPDG 855

Query: 411 FYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEG 470
               + R+ D +   GY + P EIE  L +   V  AAV  V  D+   E+ A+V   EG
Sbjct: 856 NVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVT-VRTDSGEPELCAYV---EG 911

Query: 471 ATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             L  +E+ A  +  L  Y  P  +    + P+T +GK+ +  L
Sbjct: 912 --LQRNEVRAQLQRLLPGYMVPAYMIEMEQWPVTPSGKLDRNAL 953



 Score =  108 bits (270), Expect = 1e-25
 Identities = 129/528 (24%), Positives = 203/528 (38%), Gaps = 61/528 (11%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
            +S L E  A   P   AIV       Y  +N  ANQ+A++L  +G+ P   VAL     P
Sbjct: 1507 ISRLFEMQAEQTPNAVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVALLTGRTP 1566

Query: 64   YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                   G LKAG   +P++  L    I Y L DS A  L     T +  LG        
Sbjct: 1567 ELIAGMLGILKAGGAYLPIDSNLPVERIAYMLSDSRAALLLQSEKTEKRLLGXXXXXXXX 1626

Query: 124  EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGD--DVAVIIYTSGT 181
                                                GE ++V +      +A IIYTSG+
Sbjct: 1627 XXXXXX------------------------------GEAKNVESSAGPHSLAYIIYTSGS 1656

Query: 182  TGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPL----FHIFGQTTMMNAALY 237
            TG+PKG  +   +++   V +S      P+   +  + +      F IFG   +  AAL+
Sbjct: 1657 TGKPKGVMIEQRSVI-RLVKNSNYITFTPEDRLLMTSSIGFDVGSFEIFGPL-LNGAALH 1714

Query: 238  RHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSG 297
                   +   D  +    +E + +T       +   L N   + + +  SQ  H  + G
Sbjct: 1715 LSDQQTFL---DSHQLKRYIEHQGITTI----WLTSSLFNHLTEQNEQTFSQLKHLIIGG 1767

Query: 298  GASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIW---GVEMK 354
             A  P+ V R       + I  GYG +E +   +F+      K   + +PI    G    
Sbjct: 1768 EALSPSHVNRIRNVCPEVSIWNGYGPTENT---TFSTCLHIQKTYELSIPIGRPVGNSTA 1824

Query: 355  LVDENFNTIEGEGP-GEIAVRGHCVMKGYHNRPEANAQVM-------RDGWFRTGDIARR 406
             +   +  ++  G  GE+ V G  V +GY  RP+   +          D  +RTGD+AR 
Sbjct: 1825 FILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLTKEKFVPHPFAPGDRLYRTGDLARW 1884

Query: 407  DEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVI 466
              +G    + R  D +   GY V   EIE  L     V  AAV+     T  +E+  ++ 
Sbjct: 1885 LSDGTIEYVGRIDDQVKVRGYRVELGEIETALRQIDGVKEAAVLARTAQTGSKELFGYIS 1944

Query: 467  PAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
               G     +++ +     L  Y  P  +     LP+T+ GK+ ++ L
Sbjct: 1945 VKAGT--NAEQVRSLLARSLPNYMIPAYIIEMETLPLTSNGKLNRKAL 1990


>ACSL1_CAVPO RecName: Full=Long-chain-fatty-acid--CoA ligase 1;     
              EC=6.2.1.3;AltName: Full=Long-chain acyl-CoA
           synthetase 1;         Short=LACS 1;
          Length = 698

 Score =  121 bits (303), Expect = 2e-29
 Identities = 132/512 (25%), Positives = 213/512 (41%), Gaps = 71/512 (13%)

Query: 28  LNYALVNMIANQVANLLVSRGIR--PGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVL 85
           L+Y  V  ++  + + L+ +G +  P   + +   N P +  +         VVVPL   
Sbjct: 121 LSYKQVEDLSECIGSALLQKGFQASPDQFIGIFAQNRPEWVIIEQACFAYSMVVVPLYDT 180

Query: 86  LTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGATTSAI 145
           L    I Y +  +    +FA        L E          +  + +D   +        
Sbjct: 181 LGADAITYIVNKAELSVIFADKPEKARILLESVENKLTPGLKIIVVMDSYGSELVEQGKK 240

Query: 146 PGAETFWAALNGQPGEFESVRT-----EGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAV 200
            G E    +L    G   + R      E DD+AVI +TSGTTG PKGA +TH N++ +  
Sbjct: 241 CGVEVI--SLKAMEGLGRANRRKPKPPEPDDLAVICFTSGTTGNPKGAMITHKNVVSDCS 298

Query: 201 ASSALFDQAP--DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLME 258
           A     ++A   ++ D+ ++ LPL H++ Q  ++   +  HG  +    F GD  L LM+
Sbjct: 299 AFVKATEKALVLNASDIHISFLPLAHMYEQ--LLQCVMLCHGAKIGF--FQGDIRL-LMD 353

Query: 259 KEKV---TIFAGVPTMYWGLLN---AQGDHDIKQ-------------------------- 286
             K    TIF  VP +   + +   AQ +  +K+                          
Sbjct: 354 DLKALQPTIFPVVPRLLNRMFDRIFAQANTTVKRWLLDFASKRKEAELRSGIIRNNSVWD 413

Query: 287 ----------ISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPK 336
                     +   +   V+G A + A V   ++   G +  EGYG +E +   S + P 
Sbjct: 414 KLIFHKIQSSLGGKVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCSLSVPG 473

Query: 337 RKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM-R 394
                G +G P+    +KLVD E  N +   G GE+ V+G  V KGY   P   A+ + +
Sbjct: 474 DWTA-GHVGAPMPCNFIKLVDVEEMNYMAAMGEGEVCVKGPNVFKGYLKDPAKTAEALDK 532

Query: 395 DGWFRTGDIARRDEEGFYFIIDRSKDMI-IRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
           DGW  TGDI +    G   IIDR K +  +  G  + P +IE + +    V+   V    
Sbjct: 533 DGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYVRSEPVAQVFV---- 588

Query: 454 HDTHGEEIKAFVIPAEGATLTEDELIAWAKER 485
              HGE ++AF+I         + L +WA++R
Sbjct: 589 ---HGESLQAFLIAI--VVPDAESLASWARKR 615


>ACSA_PSYCK RecName: Full=Acetyl-coenzyme A synthetase;       
           EC=6.2.1.1;AltName: Full=Acetate--CoA ligase;AltName:
           Full=Acyl-activating enzyme;
          Length = 655

 Score =  121 bits (303), Expect = 2e-29
 Identities = 129/545 (23%), Positives = 232/545 (42%), Gaps = 34/545 (6%)

Query: 2   LNLSV-LLEDGARNRPERDAIVF-GDMRLNYALVNM-----IANQVANLLVSRGIRPGDK 54
           LN+SV  L+   RN P + AI++ GD    + +++         ++ N +   G++ GD+
Sbjct: 77  LNISVNCLDRHVRNNPYKPAIIWEGDHPSLHKIISFKELHEAVCRLGNAMRKLGVKKGDR 136

Query: 55  VALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFA----FTGTP 110
           V L  P +P          + GAV   +    +   +   + DS +K +        G  
Sbjct: 137 VTLYMPMIPEAMVAMLACTRIGAVHSVVFGGFSAESLGNRIIDSQSKLVITADEGIRGNK 196

Query: 111 ELPLGERAWQAFQEVAECELYIDLPAAAGATTSAIPGAETFW--AALNGQPGEFESVRTE 168
             PL     +A        +   +       +  + G    W  + ++G+    E     
Sbjct: 197 RTPLKANVDRALDMDGTDSVSNVIVVHRTGNSVPMSGRRDIWYHSLVDGESQHCEPEVMN 256

Query: 169 GDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSA-LFDQAPDSHDVFLTVLPLFHIFG 227
            +D   ++YTSG+TG+PKG   T    +  A+++   +FD   D  DV+     +  + G
Sbjct: 257 AEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRDVFDIKED--DVYWCTADVGWVTG 314

Query: 228 QTTMMNAALYRHGTMVL---MPRFDGDEALS-LMEKEKVTIFAGVPTMYWGLLNAQGDHD 283
            T    A L    T V+   +P +     +  +++K ++T+    PT    ++  +GD  
Sbjct: 315 HTYATYAPLANGTTTVMFEGVPEYPTWARIGHIIDKHQITVLYTAPTAIRAMMK-EGDTF 373

Query: 284 IKQISQT-LHTAVSGGASLPAEVARKVKEKFG---IEILEGYGLSETSPVVSFNNPKRKA 339
           +++  ++ L    + G  +  E         G     +++ +  +ET  ++    P   A
Sbjct: 374 VRESDRSSLRLLGTVGEPINPEAWDWYYHVVGGSKCPVVDTWWQTETGGIMLAPIPGTVA 433

Query: 340 -KPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHC-----VMKGYHNRPEANAQVM 393
            KPG+   P++G+  +++D +   +EG   G + +          +   H R        
Sbjct: 434 MKPGAAMNPLYGIVPEVIDTDGVALEGAAEGNLVINSSWPGQMRTIYQDHARFLTTYFTE 493

Query: 394 RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVP 453
             G++ TGD  +RDE+G Y+I  R  D++   G+ +   EIE  ++ HP  + AAVVG+P
Sbjct: 494 YPGYYFTGDGVQRDEDGHYWITGRVDDVLNVSGHRLGTAEIESSIVAHPATAEAAVVGMP 553

Query: 454 HDTHGEEIKAFVIPAEGATLTE---DELIAWAKERLAAYKYPRIVEFRTELPMTATGKIL 510
           HD  G  I AFVI     T TE    EL    +  +        +     LP T +GKI+
Sbjct: 554 HDIRGMGICAFVILKSSETATESLKSELNRHVRSEIGPIANLDAIYMVNVLPKTRSGKIM 613

Query: 511 KRELR 515
           +R LR
Sbjct: 614 RRILR 618


>LGRA_BREPA RecName: Full=Linear gramicidin synthetase subunit
           A;Includes:  RecName: Full=ATP-dependent valine/leucine
           adenylase;           Short=Val/LeuA;
          Length = 2273

 Score =  120 bits (302), Expect = 2e-29
 Identities = 128/520 (24%), Positives = 206/520 (39%), Gaps = 61/520 (11%)

Query: 7   LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
           L E      P+  A+V     L Y  +N  ANQ+A+ L  +G++P D+VA+         
Sbjct: 207 LFEQQVEMTPDHVAVVDRGQSLTYKQLNERANQLAHHLRGKGVKPDDQVAIMLDKSLDMI 266

Query: 67  FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
                 +KAG   VP++       I Y L DS A  L       E   G           
Sbjct: 267 VSILAVMKAGGAYVPIDPDYPGERIAYMLADSSAAILLTNALHEEKANGA---------- 316

Query: 127 ECELYIDL--PAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQ 184
            C++ ID+  P +    T+ +P                       DD+  ++YTSG+TG 
Sbjct: 317 -CDI-IDVHDPDSYSENTNNLPHVN------------------RPDDLVYVMYTSGSTGL 356

Query: 185 PKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVL 244
            KG  + H NL+         F   P    +   V   F   G    +   L     + +
Sbjct: 357 AKGVMIEHHNLVNFCEWYRPYFGVTPADKAL---VYSSFSFDGSALDIFTHLLAGAALHI 413

Query: 245 MP---RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASL 301
           +P   ++D D       +E +TI + +PT          +  ++  +Q+    ++GG   
Sbjct: 414 VPSERKYDLDALNDYCNQEGITI-SYLPT-------GAAEQFMQMDNQSFRVVITGG--- 462

Query: 302 PAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFN 361
             +V +K++     ++  GYG +E + +V+     +      IG PI    + ++DE   
Sbjct: 463 --DVLKKIERNGTYKLYNGYGPTECTIMVTMFEVDKPYANIPIGKPIDRTRILILDEALA 520

Query: 362 TIEGEGPGEIAVRGHCVMKGYHNRPEANAQVM------RDGWFRTGDIARRDEEGFYFII 415
                  GE+ + G  + +GY NRPE  A+         +  +RTGD AR   +G    +
Sbjct: 521 LQPIGVAGELFIVGEGLGRGYLNRPELTAEKFIVHPQTGERMYRTGDRARFLPDGNIEFL 580

Query: 416 DRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPH-DTHGEEIKAFVIPAEGATLT 474
            R  +++   GY + P EIE  LM HP + L  V+     D     +  +V P E   + 
Sbjct: 581 GRLDNLVKIRGYRIEPGEIEPFLMNHPLIELTTVLAKEQADGRKYLVGYYVAPEE---IP 637

Query: 475 EDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
             EL  W    L  Y  P         P+TA GK+ +R L
Sbjct: 638 HGELREWLGNDLPDYMIPTYFVHMKAFPLTANGKVDRRAL 677



 Score =  113 bits (282), Expect = 4e-27
 Identities = 130/521 (24%), Positives = 214/521 (41%), Gaps = 49/521 (9%)

Query: 7    LLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFP 66
            +LED A   P++ A+VF + R+ Y  +N   NQ+A+ L  +G++P D V L         
Sbjct: 1225 MLEDWAAATPDKTALVFREQRVTYRELNERVNQLAHTLREKGVQPDDLVMLMAERSVEMM 1284

Query: 67   FVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVA 126
               F  LKAG   +P++       I Y   DSGAK + A     + P  E+A  A     
Sbjct: 1285 VAIFAVLKAGGAYLPIDPHSPAERIAYIFADSGAKLVLA-----QSPFVEKASMA----- 1334

Query: 127  ECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPK 186
              E+ +DL +A+         A+T    L  QPG          D+  ++YTSG+TG+PK
Sbjct: 1335 --EVVLDLNSASSY------AADTSNPPLVNQPG----------DLVYVMYTSGSTGKPK 1376

Query: 187  GAQLTHTNLLFNAVASSALFDQAP-DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM 245
            G  + H  LL N +    + D+ P    D FL             +      R   ++L 
Sbjct: 1377 GVMIEHGALL-NVL--HGMQDEYPLLQDDAFLLKTTYIFDISVAEIFGWVPGRGKLVILE 1433

Query: 246  PRFDGDEAL--SLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPA 303
            P  + +       +    +T    VP+M   L+      + +  +  L   ++ G ++P 
Sbjct: 1434 PEAEKNPKAIWQAVVGAGITHINFVPSM---LIPFVEYLEGRTEANRLRYILACGEAMPD 1490

Query: 304  EVARKVKEKFGIEILEG-YGLSETSPVVSFNNPKR--KAKPGSIGLPIWGVEMKLVDENF 360
            E+  KV E      LE  YG +E +   S  +  +  +  P  IG P+    M +++ + 
Sbjct: 1491 ELVPKVYEVLPEVKLENIYGPTEATIYASRYSLAKGSQESPVPIGKPLPNYRMYIINRHG 1550

Query: 361  NTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMR-------DGWFRTGDIARRDEEGFYF 413
                   PGE+ + G  + +GY N P    +          +  +RTGD+AR  E+G   
Sbjct: 1551 QLQPIGVPGELCIAGASLARGYLNNPALTEEKFTPHPLEKGERIYRTGDLARYREDGNIE 1610

Query: 414  IIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATL 473
             + R    +   GY +   EI   L+    +  A VV   +D +G+      + +E    
Sbjct: 1611 YLGRMDHQVKIRGYRIELDEIRSKLIQEETIQDAVVV-ARNDQNGQAYLCAYLLSE-QEW 1668

Query: 474  TEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514
            T  +           Y  P       + P+TA GK+ ++ L
Sbjct: 1669 TVGQXXXXXXXXXXXYMIPAHFVLLKQFPLTANGKLDRKAL 1709


>ACVS_EMENI RecName:
           Full=N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine
           synthase;         EC=6.3.2.26;AltName:
           Full=Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine
           synthetase;
          Length = 3770

 Score =  120 bits (301), Expect = 3e-29
 Identities = 127/542 (23%), Positives = 224/542 (41%), Gaps = 62/542 (11%)

Query: 4   LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVP 63
           L+ L+E+  +   ++ AIV+   +L Y  +N  AN  A+ L S GI P   VAL      
Sbjct: 321 LNHLIEEATQLHEDKVAIVYKRRQLTYGELNAQANCFAHYLRSIGILPEQLVALFLEKSE 380

Query: 64  YFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQ 123
                  G  K+GA  VP++       + + L D+ AK + A        L ER     +
Sbjct: 381 NLIVTILGIWKSGAAYVPIDPTYPDERVRFVLEDTQAKVIIASN-----HLAERLQS--E 433

Query: 124 EVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTE-----GDDVAVIIYT 178
            +++ EL             +I   E   +A++ QP  F              +A + YT
Sbjct: 434 VISDREL-------------SIIRLEHCLSAIDQQPSTFPRANLRDPSLTSKQLAYVTYT 480

Query: 179 SGTTGQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYR 238
           SGTTG PKG    HTN++ +    SA +    D H+  L  L   ++F            
Sbjct: 481 SGTTGFPKGILKQHTNVVNSITDLSARYGVTGDHHEAIL--LFSAYVFEPFVRQMLMALV 538

Query: 239 HGTMVLM----PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTA 294
           +G ++ M     ++D ++ +  + + K+T   G  ++         ++D      +L   
Sbjct: 539 NGHLLAMVDDAEKYDAEKLIPFIREHKITYLNGTASVL-------QEYDFSS-CPSLKRL 590

Query: 295 VSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFN--NPKRKAKPGSIGLPIWGVE 352
           +  G +L       ++  F   IL  YG +E++ V + N   P       S+G P+  V+
Sbjct: 591 ILVGENLTESRYLALRRHFKNCILNEYGFTESAFVTALNVFEPGSARNNTSLGRPVRNVK 650

Query: 353 MKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ---------------VMRDGW 397
             +++++   +     GE+ + G  + KGY NRP+   Q                +    
Sbjct: 651 CYILNKSLKRVPIGATGELHIGGLGISKGYLNRPDLTPQRFIPNPFQTDHEKELGLNQLM 710

Query: 398 FRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGV----- 452
           ++TGD+AR    G    + R+   I   G  + P EIE  L  +P V  + VV       
Sbjct: 711 YKTGDLARWLPNGEIEYLGRADFQIKLRGIRIEPGEIESTLAGYPGVRTSLVVSKRLRHG 770

Query: 453 PHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKR 512
             +T  E +  + +  +  +++E  L+ + + +L  Y  P  +   +++P+T  GK   R
Sbjct: 771 EKETTNEHLVGYYV-GDNTSVSETALLQFLELKLPRYMIPTRLVRVSQIPVTVNGKADLR 829

Query: 513 EL 514
            L
Sbjct: 830 AL 831



 Score = 99.4 bits (246), Expect = 6e-23
 Identities = 109/472 (23%), Positives = 190/472 (40%), Gaps = 57/472 (12%)

Query: 4    LSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSR-GIRPGDKVALACPNV 62
            L  + E  A  +P++ A+V+    L Y  +N  AN++A+ L S    +P   +AL     
Sbjct: 1413 LHAMFEKEAAQKPDKVAVVYEQRSLTYRQLNERANRMAHQLKSDISPKPNSIIALVVDKS 1472

Query: 63   PYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAF 122
             +         K G   VP++       I Y L D+ A A+ +                 
Sbjct: 1473 EHMIATILAVWKTGGAYVPIDPEYPDDRIRYILEDTSAIAVIS---------DACYLSRI 1523

Query: 123  QEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTT 182
            QE+A   + +     +  T          W+  N  P    +      D+A IIYTSGTT
Sbjct: 1524 QELAGESVRLYRSDISTQTDGN-------WSVSNPAPSSTST------DLAYIIYTSGTT 1570

Query: 183  GQPKGAQLTHTNLLFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQ-TTMMNAALYRHGT 241
            G+PKG  + H  ++   ++ S  F       +V L+     ++F      M  A+    T
Sbjct: 1571 GKPKGVMVEHHGVVNLQISLSKTFGLRDTDDEVILSFSN--YVFDHFVEQMTDAILNGQT 1628

Query: 242  MVLM---PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGG 298
            +V++    R D +     +E  +VT  +G P++          ++  +    L      G
Sbjct: 1629 LVMLNDAMRSDKERLYQYIETNRVTYLSGTPSVI-------SMYEFSRFKDHLRRVDCVG 1681

Query: 299  ASLPAEVARKVKEKFGIEILEGYGLSETSPVVS---FNNPKRKAKPGSIGLPIWGVEMKL 355
             +    V  ++++ F   I+ GYG +E S       +  P+R+    SIG  I      +
Sbjct: 1682 EAFSQPVFDQIRDTFQGLIINGYGPTEISITTHKRLYPFPERRTDK-SIGQQIGNSTSYV 1740

Query: 356  VDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQ-VMRDGW--------------FRT 400
            ++ +   +     GE+ + G  V +GYHNRPE  A+  +R+ +              +RT
Sbjct: 1741 LNADMKRVPIGAVGELYLGGEGVARGYHNRPEVTAERFLRNPFQTDSERQNGRNSRLYRT 1800

Query: 401  GDIAR--RDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVV 450
            GD+ R      G    + R+   +   G  +   EIE V+ +HP +  + V+
Sbjct: 1801 GDLVRWIPGSNGEIEYLGRNDFQVKIRGLRIELGEIEAVMSSHPDIKQSVVI 1852



 Score = 99.0 bits (245), Expect = 8e-23
 Identities = 132/555 (23%), Positives = 223/555 (40%), Gaps = 87/555 (15%)

Query: 2    LNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRG-IRPGDKVALACP 60
            ++LS   E  A   P+R A+V GD  L+Y  +N  ANQ+A  + S   +RP DKV L   
Sbjct: 2492 ISLSRAFEFEAFRVPDRAAVVQGDKSLSYTELNKRANQLARYIQSVAHLRPDDKVLLILD 2551

Query: 61   NVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQ 120
                         K G+  VPL+                          P  P  ER  Q
Sbjct: 2552 KSIDMIICILAIWKTGSAYVPLD--------------------------P