# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30299.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ54145.1  [L=306]
Description: tfus0 AAZ54145.1 GIB00263CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     0.0044   19.1   1.5        0.1   14.6   1.0    2.3  1  PF00149  Calcineurin-like phosphoesterase
  ------ inclusion threshold ------
        7.1    8.3   0.2         15    7.2   0.2    1.5  1  PF03466  LysR substrate binding domain
         11    8.9   0.2         18    8.2   0.1    1.3  1  PF10545  Alcohol dehydrogenase transcription factor Myb/SANT
         27    7.2   1.2         65    5.9   0.8    1.7  1  PF09838  Uncharacterized protein conserved in bacteria (DUF2
         27    7.0   0.0         47    6.3   0.0    1.4  1  PF07481  Domain of Unknown Function (DUF1521)
         51    6.0   1.6    2.4e+02    3.9   0.0    2.5  2  PF01788  PsbJ
         95    5.6   0.0    1.5e+02    4.9   0.0    1.2  1  PF04254  Protein of unknown function (DUF432)
      1e+02    4.2   0.0    1.4e+02    3.8   0.0    1.1  1  PF11477  Sialyltransferase PMO188
      1e+02    5.1   0.5    2.7e+02    3.8   0.4    1.7  1  PF11784  Protein of unknown function (DUF3320)
    1.3e+02    5.0   0.0    2.5e+02    4.2   0.0    1.3  1  PF07107  Wound-induced protein WI12
    1.3e+02    4.4   0.0    2.2e+02    3.7   0.0    1.2  1  PF02366  Dolichyl-phosphate-mannose-protein mannosyltransfer
    1.5e+02    5.1   0.2    2.7e+02    4.3   0.1    1.3  1  PF11883  Domain of unknown function (DUF3403)
    1.5e+02    3.6   0.4    2.3e+02    3.1   0.3    1.1  1  PF01032  FecCD transport family
    1.6e+02    5.3   1.9    1.5e+02    5.4   0.1    1.9  1  PF05594  Haemagluttinin repeat
    1.6e+02    4.9   0.0    2.3e+02    4.4   0.0    1.3  1  PF00702  haloacid dehalogenase-like hydrolase
    1.7e+02    4.4   0.0    3.3e+02    3.4   0.0    1.5  1  PF02197  Regulatory subunit of type II PKA R-subunit
    2.1e+02    4.5   0.1    4.8e+02    3.4   0.0    1.5  1  PF02983  Alpha-lytic protease prodomain
    2.2e+02    4.2   0.0    4.9e+02    3.1   0.0    1.5  1  PF09200  Monellin
    2.3e+02    3.5   0.0    3.8e+02    2.8   0.0    1.3  1  PF06889  Protein of unknown function (DUF1266)
    2.3e+02    3.9   0.0    4.7e+02    2.9   0.0    1.4  1  PF03745  Domain of unknown function (DUF309)
    2.4e+02    4.0   0.0    3.7e+02    3.3   0.0    1.2  1  PF02729  Aspartate/ornithine carbamoyltransferase, carbamoyl
    2.5e+02    4.3   0.1    7.3e+02    2.8   0.1    1.7  1  PF11409  Smad anchor for receptor activation (SARA)
    3.7e+02    2.6   0.3    1.7e+03    0.5   0.0    1.7  1  PF04917  Bacterial shufflon protein, N-terminal constant reg
    4.1e+02    2.1   0.0    5.8e+02    1.6   0.0    1.1  1  PF11940  Domain of unknown function (DUF3458)
    1.8e+03    0.8   4.4    3.7e+03   -0.2   3.0    1.5  1  PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT
    2.5e+03    1.2   3.4      5e+03    0.2   2.4    1.4  1  PF07043  Protein of unknown function (DUF1328)


Domain and alignment annotation for each model:
>> PF00149  Calcineurin-like phosphoesterase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   14.6   1.0   2.7e-05       0.1       1      49 [.      55     101 ..      55     243 .. 0.62

  Alignments for each domain:
  == domain 1    score: 14.6 bits;  conditional E-value: 2.7e-05
                 EEEEEEEEBTCBHHHHHTHHHHHHHHHHHTTTSEEEEE-TTSSGGGCHH CS
     PF00149   1 lrilvigDlHgglddletlllilleiaaeekpdlvlflGDlvdrgdwss 49 
                 lril+++D H++++    ll  + +    ++pdlv+ +GD   ++    
  AAZ54145.1  55 LRILHLSDAHLTPGRR--LLIDWIRSLDAHNPDLVVNTGDSLAHPQAVK 101
                 69**************..89999*****************887766444 PP

>> PF03466  LysR substrate binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.2     0.004        15     145     206 ..      17      78 ..      13      81 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.004
                 HHHHSS-EE.EEEGGGCHGGSCTTCEEEEEECSTTSE.EEEEEEEETTSTTHHHHHHHHHHHHH CS
     PF03466 145 lvaaGlGia.llprsavrdeladgrlvvlplpdpplp.rtlylvyrkgrelspavrafidflre 206
                 +v   lG+a l+ +s+v++  +  rl+  ++p +++   +l ++++++ +l+p  r +id++r+
  AAZ54145.1  17 AVTGALGVAgLVYASVVER--NWFRLRHYEIPILAPGsDRLRILHLSDAHLTPGRRLLIDWIRS 78 
                 5666666653777788777..88999999999999999************************96 PP

>> PF10545  Alcohol dehydrogenase transcription factor Myb/SANT-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.1    0.0047        18      10      37 ..     135     162 ..     131     171 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0047
     PF10545  10 cLwdrshpdyrnrsareeawaeiaeelg 37 
                  Lw +s+ dyr+r+  +  w+e+++ ++
  AAZ54145.1 135 YLWRSSKADYRKRKIPDLPWRELGAAMR 162
                 7**********************99997 PP

>> PF09838  Uncharacterized protein conserved in bacteria (DUF2065)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.8     0.017        65      33      53 ..       4      24 ..       1      28 [. 0.84

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.017
     PF09838 33 lpdrqLRliGlvlmvlGlvll 53
                +  r+LR+iG +++v+G++ +
  AAZ54145.1  4 TTGRVLRRIGTAAAVTGALGV 24
                66789************9876 PP

>> PF07481  Domain of Unknown Function (DUF1521)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.012        47     115     141 ..     213     239 ..     199     268 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.012
     PF07481 115 lkvtqsnaGrtldaltsdGaqlieeqt 141
                 + v +s + r+ld++t dG++l+    
  AAZ54145.1 213 IGVMHSPEPRNLDRFTADGYELLLAGH 239
                 5689999*************9875543 PP

>> PF01788  PsbJ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.2      0.94   3.6e+03       1       8 [.       1       8 [.       1      28 [. 0.75
   2 ?    3.9   0.0     0.062   2.4e+02      26      33 ..     115     122 ..     104     123 .. 0.76

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.94
     PF01788 1 manttGRI 8
               m nttGR+
  AAZ54145.1 1 MVNTTGRV 8
               78999997 PP

  == domain 2    score: 3.9 bits;  conditional E-value: 0.062
     PF01788  26 giffYGSy 33 
                 g+f+YGS+
  AAZ54145.1 115 GLFVYGSN 122
                 9******8 PP

>> PF04254  Protein of unknown function (DUF432)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.038   1.5e+02      38      74 ..     210     246 ..     191     256 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.038
     PF04254  38 evgvfvsskdeaeliDvfelgkekyaLYGspenGvic 74 
                 +v + v+++ e++ +D+f+ +   + L G+ + G+ic
  AAZ54145.1 210 DVRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQIC 246
                 55666666666*************************9 PP

>> PF11477  Sialyltransferase PMO188
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.035   1.4e+02     261     297 ..     209     245 ..     193     248 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.035
                 HHHHHHHHHHHCSTT-SS--S---EEEE---TT-S-H CS
     PF11477 261 aqqqinllneaknpdsplyigkdydlffKGHpsggai 297
                 a+ +i ++   +  + + ++ ++y+l++ GH++gg+i
  AAZ54145.1 209 ADVRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQI 245
                 666777777777788899***************9986 PP

>> PF11784  Protein of unknown function (DUF3320)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.4      0.07   2.7e+02      37      47 ..     262     272 ..     261     273 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.07
     PF11784  37 arawGlsRaGa 47 
                 arawGlsR G+
  AAZ54145.1 262 ARAWGLSRNGT 272
                 89******996 PP

>> PF07107  Wound-induced protein WI12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.064   2.5e+02      81     105 ..     128     152 ..     118     153 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.064
     PF07107  81 asssksksvWesrladrakkslPgL 105
                 +++ +++ +W+s++ad  k+++P L
  AAZ54145.1 128 QPKNPARYLWRSSKADYRKRKIPDL 152
                 56678899**************987 PP

>> PF02366  Dolichyl-phosphate-mannose-protein mannosyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.056   2.2e+02      43      71 ..      94     122 ..      90     136 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.056
     PF02366  43 dvhpplgkmllalggylagkdgnftfess 71 
                 ++hp  +k++l+  g l +++g+f + s+
  AAZ54145.1  94 LAHPQAVKPFLDALGPLLDRPGLFVYGSN 122
                 689***********************998 PP

>> PF11883  Domain of unknown function (DUF3403)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.1     0.071   2.7e+02       7      22 ..     127     142 ..     126     150 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.071
     PF11883   7 PqPKqPgFcvgrsple 22 
                 PqPK+P+ ++ rs+ +
  AAZ54145.1 127 PQPKNPARYLWRSSKA 142
                 9*****9988888765 PP

>> PF01032  FecCD transport family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.3      0.06   2.3e+02      43      64 ..       9      30 ..       5      37 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.06
     PF01032 43 lprilaallvGaaLavaGallQ 64
                l ri +a+ v +aL+vaG+++ 
  AAZ54145.1  9 LRRIGTAAAVTGALGVAGLVYA 30
                679999************9875 PP

>> PF05594  Haemagluttinin repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1      0.04   1.5e+02      40      71 ..     169     187 ..     164     199 .. 0.60

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.04
                 -EEESSE..................EEEEE-- CS
     PF05594  40 llnqggilqsggalvlraaqlidnglkisaaG 71 
                 l+nq+g l++g              l+i+aaG
  AAZ54145.1 169 LNNQKGHLTAGN-------------LRIAAAG 187
                 455555555554.............5555544 PP

>> PF00702  haloacid dehalogenase-like hydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0      0.06   2.3e+02     106     135 ..      73     102 ..       6     132 .. 0.75

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.06
                 HHHHHHHHHTTSEEEEEESSTHHHHHHHHH CS
     PF00702 106 realraLkkaGikvvllTgdnrataeavlk 135
                 ++ +r L +++ ++v+ Tgd+ a+++av  
  AAZ54145.1  73 IDWIRSLDAHNPDLVVNTGDSLAHPQAVKP 102
                 3446667777*****************765 PP

>> PF02197  Regulatory subunit of type II PKA R-subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.086   3.3e+02       5      20 ..      70      85 ..      69      89 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.086
                HHH---HHHHHHH--S CS
     PF02197  5 alLedltveVlraqPs 20
                +lL d ++ +++++P+
  AAZ54145.1 70 RLLIDWIRSLDAHNPD 85
                78999**********8 PP

>> PF02983  Alpha-lytic protease prodomain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.12   4.8e+02      15      28 ..     260     274 ..     255     275 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.12
     PF02983  15 d.aaaekadkpvtsW 28 
                 d a+a++ + ++tsW
  AAZ54145.1 260 DrARAWGLSRNGTSW 274
                 5599*********** PP

>> PF09200  Monellin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.13   4.9e+02       9      19 ..     115     125 ..     114     127 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.13
                 EECEEECCCCC CS
     PF09200   9 qlyvYAsdkLf 19 
                 +l+vY s+ Lf
  AAZ54145.1 115 GLFVYGSNDLF 125
                 89********9 PP

>> PF06889  Protein of unknown function (DUF1266)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0       0.1   3.8e+02      83     123 ..     231     271 ..     222     279 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.1
     PF06889  83 eWkelleelsereriyaqfvaetaecCGeGGikaWdyvrmg 123
                  ++ ll+  +  ++i   f  + +++CG    +aW + r g
  AAZ54145.1 231 GYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNG 271
                 5667888899999***********************99976 PP

>> PF03745  Domain of unknown function (DUF309)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.12   4.7e+02      23      49 ..     163     189 ..     162     197 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.12
                 HHHCTT----HHHHH---HHHH---HH CS
     PF03745  23 EelWkkakeperellqgliqlAvAlyh 49 
                 E+ W   ++++ +l+ g + +A+A +h
  AAZ54145.1 163 EAGWLDLNNQKGHLTAGNLRIAAAGIH 189
                 778987777799************999 PP

>> PF02729  Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.097   3.7e+02     107     129 ..      75      97 ..      55     106 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.097
                 HHHHHHHH-SS-EEESS-----H CS
     PF02729 107 aieelakyssvpViNagddleHP 129
                  i+ l ++++  V+N gd+l+HP
  AAZ54145.1  75 WIRSLDAHNPDLVVNTGDSLAHP 97 
                 677888899999*********** PP

>> PF11409  Smad anchor for receptor activation (SARA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.1      0.19   7.3e+02       3      12 ..     126     135 ..     125     136 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.19
     PF11409   3 sPNPNNPmEY 12 
                 sP P NP+ Y
  AAZ54145.1 126 SPQPKNPARY 135
                 8*******99 PP

>> PF04917  Bacterial shufflon protein, N-terminal constant region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.0      0.44   1.7e+03     284     308 ..     158     182 ..     156     192 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 0.44
     PF04917 284 GlymsdsswlrsvnnkGiytGGqvk 308
                 G  m ++ wl   n kG  t G+++
  AAZ54145.1 158 GAAMREAGWLDLNNQKGHLTAGNLR 182
                 55689999***9999*****99987 PP

>> PF11940  Domain of unknown function (DUF3458)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.15   5.8e+02     344     362 ..      68      86 ..      59     102 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.15
                 --HHHHHHHHHHHTT-HHH CS
     PF11940 344 GYrfladqilkldklNpqv 362
                 G r+l d+i  ld+ Np +
  AAZ54145.1  68 GRRLLIDWIRSLDAHNPDL 86 
                 5599*************76 PP

>> PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   3.0      0.97   3.7e+03      17      31 ..      14      28 ..      10      30 .. 0.84

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 0.97
                HHHHH---------H CS
     PF10399 17 lATaavgaVGaaaaa 31
                 A+a++ga G+a  +
  AAZ54145.1 14 TAAAVTGALGVAGLV 28
                699999****99876 PP

>> PF07043  Protein of unknown function (DUF1328)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   2.4       1.3     5e+03       7      20 ..      16      29 ..      13      32 .. 0.74

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.3
     PF07043  7 AlvAgvlGFgGiAg 20
                A+v+g lG  G+  
  AAZ54145.1 16 AAVTGALGVAGLVY 29
                77888888888755 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (306 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       181  (0.0151948); expected 238.2 (0.02)
Passed bias filter:                      171  (0.0143553); expected 238.2 (0.02)
Passed Vit filter:                        27  (0.00226662); expected 11.9 (0.001)
Passed Fwd filter:                        27  (0.00226662); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              26  [number of targets reported over threshold]
# CPU time: 0.20u 0.09s 00:00:00.29 Elapsed: 00:00:00
# Mc/sec: 3303.12
//