# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30301.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ54369.1  [L=307]
Description: tfus0 AAZ54369.1 GIB00263CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
       0.41   12.0   0.1       0.41   12.0   0.1    1.7  1  PF06097  Bacterial protein of unknown function (DUF945)
        3.8    9.8   1.1         19    7.6   0.8    2.3  1  PF07210  Protein of unknown function (DUF1416)
        4.3    9.5   0.0         11    8.2   0.0    1.8  1  PF04335  VirB8 protein
        8.4    7.7   0.0         12    7.2   0.0    1.1  1  PF11940  Domain of unknown function (DUF3458)
        8.5    8.4   0.0         14    7.7   0.0    1.3  1  PF06532  Protein of unknown function (DUF1109)
         13    8.1   5.7        5.5    9.3   0.1    2.8  2  PF10099  Anti-sigma-K factor rskA
         14    8.4   0.1         41    6.9   0.0    1.8  1  PF11367  Protein of unknown function (DUF3168)
         22    8.0   0.3         55    6.8   0.2    1.6  1  PF09990  Predicted membrane protein (DUF2231)
         23    7.8   0.2         46    6.8   0.1    1.4  1  PF07131  Protein of unknown function (DUF1382)
         25    7.0   0.6         48    6.1   0.4    1.4  1  PF11772  DNA-directed RNA polymerase subunit beta
         25    7.6   0.0         48    6.7   0.0    1.4  1  PF12279  Protein of unknown function (DUF3619)
         51    5.8   0.1      1e+02    4.8   0.1    1.5  1  PF11249  Protein of unknown function (DUF3047)
         54    6.9   0.0    1.2e+02    5.9   0.0    1.5  1  PF06749  Protein of unknown function (DUF1218)
         54    6.2   0.1    1.2e+02    5.1   0.0    1.6  1  PF12555  Thiamine pyrophosphokinase C terminal
         65    6.5   0.6    3.2e+02    4.3   0.0    2.3  1  PF00379  Insect cuticle protein
         76    5.9   0.2    1.6e+02    4.8   0.1    1.5  1  PF08140  Crustacean cuticle protein repeat
         99    5.5   0.0    1.9e+02    4.6   0.0    1.4  1  PF07765  KIP1-like protein
    1.1e+02    5.1   0.0    1.7e+02    4.4   0.0    1.2  1  PF09201  SRX
    1.4e+02    5.6   6.8         30    7.7   0.6    2.6  1  PF06280  Fn3-like domain (DUF1034)
    1.6e+02    4.8   0.0    2.8e+02    4.0   0.0    1.3  1  PF10177  Uncharacterised conserved protein (DUF2371)
    1.7e+02    4.5   0.2    3.3e+02    3.6   0.1    1.4  1  PF10831  Protein of unknown function (DUF2556)
    1.8e+02    4.2   0.0    3.1e+02    3.4   0.0    1.3  1  PF01973  Protein of unknown function DUF115
    1.8e+02    4.7   0.0    3.7e+02    3.7   0.0    1.5  1  PF04715  Anthranilate synthase component I, N terminal regio
    1.9e+02    3.6   0.1    2.5e+02    3.2   0.1    1.2  1  PF06800  Sugar transport protein
      2e+02    4.3   0.1    4.5e+02    3.2   0.1    1.5  1  PF05480  Staphylococcus haemolytic protein
    2.2e+02    4.3   0.0    3.8e+02    3.5   0.0    1.3  1  PF05656  Protein of unknown function (DUF805)
    2.3e+02    4.6   0.2    4.7e+02    3.6   0.2    1.4  1  PF07571  Protein of unknown function (DUF1546)
    3.4e+02    3.8   2.5    8.6e+02    2.5   1.7    1.6  1  PF11127  Protein of unknown function (DUF2892)
    4.3e+02    3.1   0.1    8.1e+02    2.3   0.1    1.3  1  PF11848  Domain of unknown function (DUF3368)
    7.8e+02    2.9   2.3    1.5e+03    1.9   1.6    1.4  1  PF11282  Protein of unknown function (DUF3082)
      9e+02    2.5   3.0    1.5e+03    1.8   0.0    2.8  1  PF04671  Erythrocyte membrane-associated giant protein antig
    1.2e+03    1.9   0.0    1.7e+03    1.4   0.0    1.4  1  PF08615  Ribonuclease H2 non-catalytic subunit (Ylr154p-like
    1.6e+03    2.2   4.4    3.2e+03    1.3   3.1    1.4  1  PF03733  Domain of unknown function (DUF307)
    2.2e+03    0.9   5.5    3.9e+03    0.1   3.8    1.3  1  PF09976  Uncharacterized protein conserved in bacteria (DUF2
    2.3e+03    0.6   3.3    3.5e+03    0.1   2.3    1.2  1  PF04156  IncA protein
    5.8e+03    0.2   8.1    1.9e+03    1.8   0.5    3.0  2  PF06715  Gp5 C-terminal repeat (3 copies)


Domain and alignment annotation for each model:
>> PF06097  Bacterial protein of unknown function (DUF945)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   0.1   0.00015      0.41     140     222 ..     144     225 ..     133     264 .. 0.89

  Alignments for each domain:
  == domain 1    score: 12.0 bits;  conditional E-value: 0.00015
     PF06097 140 ysgstdseltlaafdyeedegtklsfsglslegdvdkdlkavslsvnapslqlkleqkeqlalknlkld.gdlkkgksdlwlGd 222
                  +g++d++   a +d+   ++++++  ++++e+++  +++ +++ ++ ps+ ++  + ++++l++++++ ++   +++ + +G+
  AAZ54369.1 144 VTGDVDVTGVSARVDA-STDTGEIRLADVTGEITAESATGRITAAGSGPSAVVTS-DTGEINLEDFQAAdVQATSAIGAIRIGS 225
                 5799999999999999.**************************************.**********998555555555577775 PP

>> PF07210  Protein of unknown function (DUF1416)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.8    0.0068        19       9      42 ..     148     181 ..     139     243 .. 0.92

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0068
     PF07210   9 tviqGrvlrdgepvagayvRLLdssgeFtaevvt 42 
                 + ++G+  r +++  ++ +RL d +ge tae  t
  AAZ54369.1 148 VDVTGVSARVDASTDTGEIRLADVTGEITAESAT 181
                 55899999999999*****************665 PP

>> PF04335  VirB8 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0039        11       2      41 ..       5      46 ..       4      92 .. 0.73

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0039
                ----------------------..------------------ CS
     PF04335  2 arqfeadrigsarrqrrrawlv..aivalliavlavlavvvl 41
                ar ++a+  ++ r +r r+wlv  aiv+l+   + vl++ + 
  AAZ54369.1  5 ARGLYASSSKEPRGRRGRWWLVigAIVGLAALGTGVLGILTT 46
                67778888899999********44444444444444444443 PP

>> PF11940  Domain of unknown function (DUF3458)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0043        12      74     113 ..      57      97 ..      55     117 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0043
                 ---SSSEEE----HHHHHHHHHH-S-HH.HHHHHHHHHHHH CS
     PF11940  74 gFSAPVkleydlsdeellfLlahdsDpf.nRweagqqLakr 113
                 +F AP +le d ++e  ++L+a d+D + +R +   +++++
  AAZ54369.1  57 EFPAPSRLEIDNNTEGSVTLVAEDTDTVtVRVDVWSSMMSQ 97 
                 799***********************973577777777766 PP

>> PF06532  Protein of unknown function (DUF1109)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0    0.0052        14      71     105 ..      12      46 ..       2      57 .. 0.77

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0052
     PF06532  71 rlsrPggerrrallllalplallwlaallellaap 105
                     P+g+r+r++l++ +++ l++l + +  +++ 
  AAZ54369.1  12 SSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILTT 46 
                 5668****************999998876665553 PP

>> PF10099  Anti-sigma-K factor rskA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.1     0.002       5.5      26      97 ..      15      88 ..       4      99 .. 0.50
   2 ?    0.5   0.1         1   2.9e+03      67      67 ..     176     176 ..     104     217 .. 0.59

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.002
     PF10099 26 arlwrrlrrWrglal.aaaAaaavlalalllv...qataaaaqpaaapalvavlasadgqpalvvsvdadkgaltl 97
                +++ rr r W  +++ + + aa+   ++++l+   ++t++  ++  +++   ++ ++  + +++v+ d d+ ++++
  AAZ54369.1 15 EPRGRRGRWWLVIGAiV-GLAALGTGVLGILTtavSETTTDTTEF-PAPSRLEIDNNTEGSVTLVAEDTDTVTVRV 88
                33333556677666643.333333333333333533333333333.333334444446666666666656555544 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 1
     PF10099  67 a 67 
                 +
  AAZ54369.1 176 T 176
                 1 PP

>> PF11367  Protein of unknown function (DUF3168)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.015        41      49      63 ..      79      93 ..      70      97 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.015
     PF11367 49 pdadrvrvQidvyat 63
                +d+d v+v++dv+++
  AAZ54369.1 79 EDTDTVTVRVDVWSS 93
                599**********86 PP

>> PF09990  Predicted membrane protein (DUF2231)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.2      0.02        55       5      38 ..      21      54 ..      19      59 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.02
     PF09990  5 swwnllaalvigflavaaGlvelllaepsiraks 38
                + w l++++++g++a  +G++ +l+   s++ ++
  AAZ54369.1 21 GRWWLVIGAIVGLAALGTGVLGILTTAVSETTTD 54
                6799****************99998866665555 PP

>> PF07131  Protein of unknown function (DUF1382)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1     0.017        46      29      44 ..     239     254 ..     234     261 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.017
     PF07131  29 iPvvtDeEFatLaail 44 
                 i v tD EF+tL a  
  AAZ54369.1 239 ITVTTDTEFQTLHATT 254
                 789*********8864 PP

>> PF11772  DNA-directed RNA polymerase subunit beta
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.4     0.017        48      12      26 ..      25      39 ..      23      47 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.017
     PF11772 12 lviGlmvGYgviGdG 26
                lviG++vG +++G G
  AAZ54369.1 25 LVIGAIVGLAALGTG 39
                8************99 PP

>> PF12279  Protein of unknown function (DUF3619)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.017        48      59     104 ..      12      57 ..       2      60 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.017
     PF12279  59 sggallerggswlrrlalalplaaLvagLvginvwqdqqrieelae 104
                 s ++   r+g w+  ++ ++ laaL  g++gi  +   + +++++e
  AAZ54369.1  12 SSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILTTAVSETTTDTTE 57 
                 3444447899**********************99999888888776 PP

>> PF11249  Protein of unknown function (DUF3047)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1     0.037     1e+02     159     183 .]     237     261 ..     227     261 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.037
     PF11249 159 vgvalmtDsdntgeeatayygdiel 183
                  ++++ tD++++  +at+ +g+iel
  AAZ54369.1 237 GAITVTTDTEFQTLHATTAIGNIEL 261
                 5799*******************97 PP

>> PF06749  Protein of unknown function (DUF1218)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.042   1.2e+02      22      64 ..      10      52 ..       1      64 [. 0.81

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.042
     PF06749 22 cgkalspkakrrralavvlfviswvlfvvavalllagalrnae 64
                 +++  p+  r r++ v+ +++ + +++++v+ +l+ a++++ 
  AAZ54369.1 10 ASSSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILTTAVSETT 52
                455566778999**************************99986 PP

>> PF12555  Thiamine pyrophosphokinase C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.043   1.2e+02      16      29 ..      22      35 ..       8      38 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.043
     PF12555 16 llllvlAaLvAlav 29
                 ++lv++a+v la+
  AAZ54369.1 22 RWWLVIGAIVGLAA 35
                59********9998 PP

>> PF00379  Insect cuticle protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0      0.12   3.2e+02      23      42 ..      67      86 ..      60      87 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.12
     PF00379 23 ggvvkGsYsyvdpdGkvrtV 42
                + ++ Gs ++v++d  ++tV
  AAZ54369.1 67 DNNTEGSVTLVAEDTDTVTV 86
                56899**************9 PP

>> PF08140  Crustacean cuticle protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1     0.059   1.6e+02      25      34 ..     189     198 ..     180     201 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.059
     PF08140  25 iGpSGaVlsd 34 
                  GpS++V+sd
  AAZ54369.1 189 SGPSAVVTSD 198
                 7********9 PP

>> PF07765  KIP1-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.067   1.9e+02      22      47 ..      65      90 ..      48      95 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.067
     PF07765 22 eldekvkemlklieeeadsfakrAem 47
                e+d++++  + l+ e++d+++ r ++
  AAZ54369.1 65 EIDNNTEGSVTLVAEDTDTVTVRVDV 90
                89******************999876 PP

>> PF09201  SRX
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.062   1.7e+02      86     131 ..      71     116 ..      61     122 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.062
                 S--HHHHHHHHHHHHHHHHHHHHTTHHHHHHHHT---TT--TTS-- CS
     PF09201  86 eesleLnneaeqvldlalkLWdsLdlnesilknakGkakknehnyv 131
                 e s++L +e  +++++ + +W s+  + s   +++G + + + n++
  AAZ54369.1  71 EGSVTLVAEDTDTVTVRVDVWSSMMSQPSWDTETEGDTLRLAANCS 116
                 6899*******************98777776677777777666666 PP

>> PF06280  Fn3-like domain (DUF1034)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.6     0.011        30      35      82 ..      45      92 ..      36     100 .. 0.70

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.011
     PF06280 35 tdlaakeegslilkaaspeakavtfepstvtvpanssatvtvtldlps 82
                t+ + ++ + +++ +a  + +  ++++ +vt+ a+ + tvtv +d+ s
  AAZ54369.1 45 TTAVSETTTDTTEFPAPSRLEIDNNTEGSVTLVAEDTDTVTVRVDVWS 92
                44443444444444444444467888899****************966 PP

>> PF10177  Uncharacterised conserved protein (DUF2371)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0       0.1   2.8e+02      43      95 ..      25      77 ..      20      86 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.1
     PF10177 43 lilGvlvllvGiamavlGYwpksaeatspaatnlsssesselrsesegvlvrl 95
                l++G++v l+ ++  vlG   +  ++t++ +t+  +++  e+ +++eg+++ +
  AAZ54369.1 25 LVIGAIVGLAALGTGVLGILTTAVSETTTDTTEFPAPSRLEIDNNTEGSVTLV 77
                799*******************9999999999999999999999999887754 PP

>> PF10831  Protein of unknown function (DUF2556)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1      0.12   3.3e+02       3      13 ..      20      30 ..      19      36 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.12
     PF10831  3 rkyWWlvvfav 13
                r  WWlv+ a+
  AAZ54369.1 20 RGRWWLVIGAI 30
                557*****987 PP

>> PF01973  Protein of unknown function DUF115
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.11   3.1e+02      53      91 ..     175     213 ..     173     225 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.11
     PF01973  53 iaadtalkaLlkegIkPDivvslDrqeityevfkeakke 91 
                 i+a +a+     +g  P  vv+ D  ei+ e+f+ a+ +
  AAZ54369.1 175 ITAESATGRITAAGSGPSAVVTSDTGEINLEDFQAADVQ 213
                 789999999**********************99988765 PP

>> PF04715  Anthranilate synthase component I, N terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.13   3.7e+02      25      63 ..     178     216 ..     167     258 .. 0.77

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.13
     PF04715  25 eggegrysfigadplatlkakdgeislegdegekleeee 63 
                 e++ gr    g  p a++++ +gei le+ +  ++++++
  AAZ54369.1 178 ESATGRITAAGSGPSAVVTSDTGEINLEDFQAADVQATS 216
                 35569************************5555555544 PP

>> PF06800  Sugar transport protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1     0.089   2.5e+02      97     131 ..      23      57 ..      20      97 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.089
     PF06800  97 WstsvqvilGllaliliiiGvvltslkekkeakle 131
                 W   +  i+Gl+al   + G++ t+++e++ +++e
  AAZ54369.1  23 WWLVIGAIVGLAALGTGVLGILTTAVSETTTDTTE 57 
                 77788899******************999887654 PP

>> PF05480  Staphylococcus haemolytic protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.16   4.5e+02      21      36 ..      34      49 ..      33      51 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.16
     PF05480 21 akLGtSIvdIvanGvd 36
                a LGt++++I+  +v+
  AAZ54369.1 34 AALGTGVLGILTTAVS 49
                68*********99997 PP

>> PF05656  Protein of unknown function (DUF805)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.14   3.8e+02      10      36 ..      19      47 ..      14      76 .. 0.59

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.14
     PF05656 10 sRseywwfllfnillsivllildill..s 36
                +R  +w+++ +++ l+++ +++  +l  +
  AAZ54369.1 19 RRGRWWLVIGAIVGLAALGTGVLGILttA 47
                44555555555555555555555555230 PP

>> PF07571  Protein of unknown function (DUF1546)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.2      0.17   4.7e+02      67      81 ..      27      41 ..      23      48 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.17
     PF07571 67 yGAilGLsalgseav 81
                 GAi+GL+alg+ ++
  AAZ54369.1 27 IGAIVGLAALGTGVL 41
                6**********9776 PP

>> PF11127  Protein of unknown function (DUF2892)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   1.7      0.31   8.6e+02      31      50 ..      23      42 ..      17      48 .. 0.70

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.31
     PF11127 31 awgwllglvGavllvtgitg 50
                +w+++ ++vG++ l tg++g
  AAZ54369.1 23 WWLVIGAIVGLAALGTGVLG 42
                45777777777777777766 PP

>> PF11848  Domain of unknown function (DUF3368)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.29   8.1e+02       3      15 ..      38      50 ..      38      54 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.29
     PF11848  3 tGTLGvLllAkrk 15
                tG+LG+L  A+++
  AAZ54369.1 38 TGVLGILTTAVSE 50
                8******999976 PP

>> PF11282  Protein of unknown function (DUF3082)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   1.6      0.55   1.5e+03      55      70 ..      30      45 ..      26      48 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.55
     PF11282 55 vvGlcfLatfvfafva 70
                +vGl++L+t+v ++++
  AAZ54369.1 30 IVGLAALGTGVLGILT 45
                89***********987 PP

>> PF04671  Erythrocyte membrane-associated giant protein antigen 332
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.53   1.5e+03       7      17 ..     292     302 ..     292     302 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.53
     PF04671   7 iVEegSvTEEi 17 
                 ++E  S+T++i
  AAZ54369.1 292 VIEARSDTGDI 302
                 89*******98 PP

>> PF08615  Ribonuclease H2 non-catalytic subunit (Ylr154p-like)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0       0.6   1.7e+03      47     100 ..     123     176 ..      52     252 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.6
     PF08615  47 GrklvGqelslpegyrgivlsttnrpnkgsddeqeeeddedgegeetartksle 100
                 Gr+ v  e+++peg + +v ++t  + ++  +++ + ++++ge    ++t +++
  AAZ54369.1 123 GRCSVDYEVAVPEGTEVSVHTVTGDVDVTGVSARVDASTDTGEIRLADVTGEIT 176
                 667777788999999999999998888775555555555556666665555543 PP

>> PF03733  Domain of unknown function (DUF307)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   3.1       1.2   3.2e+03       7      30 ..      23      46 ..      23      53 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 1.2
     PF03733  7 WfilfGlwlalghllaglllfiti 30
                W++++G ++ l++l +g+l ++t 
  AAZ54369.1 23 WWLVIGAIVGLAALGTGVLGILTT 46
                9*****************988886 PP

>> PF09976  Uncharacterized protein conserved in bacteria (DUF2133)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   3.8       1.4   3.9e+03      16      29 ..      24      37 ..      23      38 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.4
     PF09976 16 wiivgavlalagva 29
                w+++ga+++la+++
  AAZ54369.1 24 WLVIGAIVGLAALG 37
                99*********985 PP

>> PF04156  IncA protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   2.3       1.2   3.5e+03      18      38 ..      25      45 ..      24      51 .. 0.56

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.2
     PF04156 18 liasGiallvlfasslgvlis 38
                l++++i++l++++++  ++++
  AAZ54369.1 25 LVIGAIVGLAALGTGVLGILT 45
                566666666666666333333 PP

>> PF06715  Gp5 C-terminal repeat (3 copies)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   1.0       1.3   3.5e+03       1      15 [.      72      86 ..      72      90 .. 0.87
   2 ?    1.8   0.5      0.67   1.9e+03       5      14 ..     142     151 ..     139     151 .. 0.79

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 1.3
                -------SS------ CS
     PF06715  1 GnetltVkGNrTvtV 15
                G++tl+ +++ TvtV
  AAZ54369.1 72 GSVTLVAEDTDTVTV 86
                789999999999999 PP

  == domain 2    score: 1.8 bits;  conditional E-value: 0.67
                 ---SS----- CS
     PF06715   5 ltVkGNrTvt 14 
                 +tV+G++ vt
  AAZ54369.1 142 HTVTGDVDVT 151
                 8999998887 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (307 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       423  (0.0355104); expected 238.2 (0.02)
Passed bias filter:                      271  (0.0227502); expected 238.2 (0.02)
Passed Vit filter:                        36  (0.00302216); expected 11.9 (0.001)
Passed Fwd filter:                        36  (0.00302216); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              36  [number of targets reported over threshold]
# CPU time: 0.25u 0.05s 00:00:00.30 Elapsed: 00:00:00
# Mc/sec: 2651.13
//