# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30317.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ55924.1  [L=707]
Description: tfus0 AAZ55924.1 GIB00263CH01 "glycogen debranching enzyme GlgX"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.2e-22   81.0   0.0    8.5e-22   79.6   0.0    1.8  1  PF02922  Carbohydrate-binding module 48 (Isoamylase N-termin
    3.5e-16   62.2   0.0      3e-14   55.8   0.0    2.5  1  PF00128  Alpha amylase, catalytic domain
  ------ inclusion threshold ------
          4   10.4   0.5    1.1e+02    5.9   0.0    2.9  2  PF01816  Leucine rich repeat variant
        7.4    8.3   0.0         17    7.1   0.0    1.5  1  PF00150  Cellulase (glycosyl hydrolase family 5)
         10    8.4   0.9         31    6.9   0.6    1.8  1  PF11941  Domain of unknown function (DUF3459)
         17    8.2   0.0         51    6.6   0.0    1.8  1  PF04055  Radical SAM superfamily
         52    5.2   0.0         81    4.5   0.0    1.1  1  PF05913  Bacterial protein of unknown function (DUF871)
         69    4.5   0.0    1.2e+02    3.7   0.0    1.3  1  PF03786  D-mannonate dehydratase (UxuA)
         85    5.8   0.0    2.3e+02    4.4   0.0    1.7  1  PF08460  Bacterial SH3 domain
         86    3.4   0.0    1.2e+02    2.9   0.0    1.1  1  PF02324  Glycosyl hydrolase family 70
    1.1e+02    4.9   0.0    1.7e+02    4.3   0.0    1.2  1  PF07071  Protein of unknown function (DUF1341)
    1.1e+02    4.7   0.1    2.6e+02    3.5   0.1    1.6  1  PF09866  Uncharacterized protein conserved in bacteria (DUF2
    1.3e+02    5.3   0.1    2.8e+02    4.2   0.0    1.4  1  PF10206  Mitochondrial F1F0-ATP synthase, subunit f
    1.4e+02    4.8   0.3    3.2e+02    3.7   0.2    1.5  1  PF12151  Mannan-binding protein
    1.6e+02    3.8   0.0    2.4e+02    3.3   0.0    1.2  1  PF01824  MatK/TrnK amino terminal region
    1.6e+02    4.8   0.2    7.2e+02    2.7   0.0    2.0  1  PF04328  Protein of unknown function (DUF466)
    1.7e+02    4.7   0.1    5.8e+02    3.1   0.1    1.8  1  PF12521  Protein of unknown function (DUF3724)
      2e+02    3.8   0.0    3.1e+02    3.2   0.0    1.1  1  PF01791  DeoC/LacD family aldolase
    2.2e+02    3.8   0.0    3.5e+02    3.1   0.0    1.2  1  PF00625  Guanylate kinase
      3e+02    2.9   0.0    4.8e+02    2.2   0.0    1.2  1  PF00724  NADH:flavin oxidoreductase / NADH oxidase family
    5.1e+02    3.4   0.0    1.1e+03    2.4   0.0    1.4  1  PF09262  Peroxisome biogenesis factor 1, N-terminal
    5.2e+02    3.0   0.5    1.1e+03    2.0   0.4    1.4  1  PF10663  Virulence factor EsxB
    9.5e+02    2.1   0.4    1.9e+03    1.1   0.3    1.4  1  PF00272  Cecropin family
    1.7e+03    1.6   0.1    4.4e+03    0.3   0.0    1.5  1  PF01488  Shikimate / quinate 5-dehydrogenase


Domain and alignment annotation for each model:
>> PF02922  Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.6   0.0     2e-25   8.5e-22       1      84 []      13      99 ..      13      99 .. 0.92

  Alignments for each domain:
  == domain 1    score: 79.6 bits;  conditional E-value: 2e-25
                T-S-BE-CCCSEEEEEEE-TT-SEEEEEEEBTT.CEEEEEEEEEECT.-EEEEEECHCCHSH-EEEEEEEETE....T....EEEEET-TT- CS
     PF02922  1 plGahydaegagvtfrvwapnAtrVelvlyfnnswdaeeapmkrkreggvWevflpgdlkegvyYkyrvtgpn....g....pnklllDpya 84
                plGa+yd+   g++f+++++ At Vel+l++++   ++++p++ +++g+vW+ +lp ++ +g++Y+yrv+gp     g    pnkll+Dpya
  AAZ55924.1 13 PLGATYDGS--GTNFSLFSEVATGVELCLFDDD-GAETRVPLT-EQDGHVWHGYLP-TVGPGQRYGYRVHGPYdperGlrcnPNKLLVDPYA 99
                79****866..**********************.67*******.589*********.8888************888836677*********8 PP

>> PF00128  Alpha amylase, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.8   0.0   7.3e-18     3e-14      12     312 ..     193     532 ..     189     537 .. 0.74

  Alignments for each domain:
  == domain 1    score: 55.8 bits;  conditional E-value: 7.3e-18
                 HHHH----EEEES--EE..........CCGTTCGGSECEEEEE-TT-...--....HHHHHHHHHHHHHTT-EEEEEE-TSBEECTSHHHHHHHHCTTS CS
     PF00128  12 YlkdlGvtaiwlsPife..........spqsyhgYditdykkidpef...Gt....ledfkeLiskahekgikvilDlVvNHtsdehewfkeslkskdn 93 
                  l +lGvta+ l+Pi +            ++y+gY +  + + +  +   Gt     ++fk++++++h+ gi vilD+V+NHt++ +    ++l+  + 
  AAZ55924.1 193 HLLSLGVTAVELMPIHHflpehalvarGLTNYWGYNTLAFFAPHSGYaatGTrghqVQEFKTMVKALHQAGIEVILDVVYNHTAEGDHM-GPALSLRGI 290
                 5779**************999998865444***********99999977766333359**************************98885.899998886 PP

                 CCGCGBCEE.B-CTTSTTBBBTT-SSSCCCCTTTTE-SSCTTSEBB-TTSHHHHHHHHHHHHHHH.H------EETTGGGS-H................ CS
     PF00128  94 pyrdyyiwkdgkkepptnwkslfggsaweddeeaqehkflkslpdlnteneevvkelkkvvkfwl.dkgvDGfRlDavkhisk................ 175
                  + +yy  +   + +p  +       +++ + +            ln + ++  + + + +++w+ d+ vDGfR+D +  ++                 
  AAZ55924.1 291 DNLAYYRVR---EDNPRYY------LDYTGCGN-----------SLNVRHPHSLQLIMDSLRYWVlDMHVDGFRFDLAAALARefhdvdrlstffdivq 369
                 666666643...2233222......24444444...........499****************972566**********99999****99999999999 PP

                 ............................HHHHHHHHHHHHHT....TT---B---SS-THHHHHHHHHHCCHCHCHHBSHHHHHCHHHHHCCCSC-SSS CS
     PF00128 176 ............................efwkeftqalneyk....eevftvgEvfgasdedarvdatesymeleslldfedfdlaekvkeksqlksit 242
                                             + w+e++ +  +++    +   ++ E+ +  +  ++ ++ + +  +    ++ +++ +  ++   +l s +
  AAZ55924.1 370 qdpvisqvkliaepwdvgpggyqvgnfpPLWTEWNGKYRDTVrdfwRGYPVLPELASRISGSSDLYQADGRRPVA---SINFVTCHDGFT-LADLVSYD 464
                 999999999999999999999999999955555555555555455588889999999888888888888888776...444555555555.34556666 PP

                 HHHHHHHHHHHHHHSTTGGGEBBBSS-TTSHH....HHHHTT-CHHHHHHHHHHHHT---EBEEE---TT---- CS
     PF00128 243 akklkevlsktlselsedeeqvtflenHDqeR....vlsrfgddsaklklalallltlrGtpviYyGeEigmtg 312
                  k+ +++ +++++ ++++++      nH +e      +  + +++ +++++l+ l++++G+p+   G+Eig t 
  AAZ55924.1 465 RKHNEANGEDNRDGTDDNRS-----WNHGTEGpttdSAIATLRRR-QMRNMLTTLMLSQGVPMLSHGDEIGRTQ 532
                 55555555555555555322.....36666553332222233333.89***********************875 PP

>> PF01816  Leucine rich repeat variant
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.026   1.1e+02       2      22 ..     163     183 ..     162     188 .. 0.89
   2 ?    1.5   0.0      0.65   2.7e+03       7      16 ..     676     685 ..     675     686 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.026
                 HHHHHHHHH..S-GGGGGGGT CS
     PF01816   2 eVRaaVArrPdlPpeaLerLa 22 
                 +VR +  r+Pd Pp+ +++ a
  AAZ55924.1 163 HVRGMTIRHPDVPPPLRGTYA 183
                 8**************998776 PP

  == domain 2    score: 1.5 bits;  conditional E-value: 0.65
                 HHHH..S-GG CS
     PF01816   7 VArrPdlPpe 16 
                 VA rP lP++
  AAZ55924.1 676 VAGRPYLPAG 685
                 9*******86 PP

>> PF00150  Cellulase (glycosyl hydrolase family 5)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0    0.0042        17      57      87 ..     237     270 ..     217     287 .. 0.79

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0042
                 --TCS-CH...HHHHHHHHHHHHHHTT-EEEEEE CS
     PF00150  57 pgykidee...slerveevvdyakenGlyvildi 87 
                 +gy+ + +    ++ ++++v++  ++G+ vild+
  AAZ55924.1 237 SGYAATGTrghQVQEFKTMVKALHQAGIEVILDV 270
                 4555555566689********************7 PP

>> PF11941  Domain of unknown function (DUF3459)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.6    0.0073        31       6      38 ..     549     579 ..     545     604 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.0073
     PF11941   6 dwderereahaawlalyreLLalRrreivPrla 38 
                 dw+     ++a+ l+++r L +lRr+++v r +
  AAZ55924.1 549 DWEL--ARRNADLLDFVRTLSRLRREHPVFRRR 579
                 4555..456779***************888754 PP

>> PF04055  Radical SAM superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.012        51     119     149 ..     241     272 ..     154     281 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.012
                 HHT.CCSHHHHHHHHHHHHHHCSSETEEEEEE CS
                 xxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF04055 119 lmr.rghtfeevlealeklreagikrvvdfiv 149
                  ++ rgh ++e++  +++l++agi+++ d++ 
  AAZ55924.1 241 ATGtRGHQVQEFKTMVKALHQAGIEVILDVVY 272
                 45559********************8544444 PP

>> PF05913  Bacterial protein of unknown function (DUF871)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.02        81      43      69 ..     246     272 ..     238     285 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.02
                 --HHHHHHH---HHHHHT---EEEE-- CS
     PF05913  43 eeylerlkeliklakelglevivDisp 69 
                  ++++++k+++k+++++g+evi+D+  
  AAZ55924.1 246 GHQVQEFKTMVKALHQAGIEVILDVVY 272
                 67899*******************965 PP

>> PF03786  D-mannonate dehydratase (UxuA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.03   1.2e+02      77     115 ..     242     283 ..     238     297 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.03
     PF03786  77 teerdryienykqtirnlaklgikvv...CYnfmpvldWtrt 115
                 t++r + ++++k +++ l ++gi+v+    Yn+ +  d +  
  AAZ55924.1 242 TGTRGHQVQEFKTMVKALHQAGIEVIldvVYNHTAEGDHMGP 283
                 6789999*****************963337998887776655 PP

>> PF08460  Bacterial SH3 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.054   2.3e+02      44      57 ..      53      66 ..      50      72 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.054
                E----EEE-EE--- CS
     PF08460 44 tadGyvWlsytsys 57
                ++dG+vW +y  + 
  AAZ55924.1 53 EQDGHVWHGYLPTV 66
                89*******98665 PP

>> PF02324  Glycosyl hydrolase family 70
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.029   1.2e+02     646     669 ..     249     272 ..     228     276 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.029
     PF02324 646 kddlldalkalhakgiqaiadwvP 669
                  ++++  +kalh++gi++i d v 
  AAZ55924.1 249 VQEFKTMVKALHQAGIEVILDVVY 272
                 5788999**************996 PP

>> PF07071  Protein of unknown function (DUF1341)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0      0.04   1.7e+02     159     213 ..     220     274 ..     189     278 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.04
     PF07071 159 GlksleelkavakaaaekgltlePtGGidlenfeeivqialdagvekviPhvyss 213
                 Gl++   ++++a  a ++g +   t G +++ f+++v++  +ag+e ++  vy  
  AAZ55924.1 220 GLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNH 274
                 55555667788888888888889999**********************9999976 PP

>> PF09866  Uncharacterized protein conserved in bacteria (DUF2093)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.1     0.061   2.6e+02      19      27 ..     328     336 ..     324     339 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.061
     PF09866  19 LdeLrYWsv 27 
                 +d+LrYW  
  AAZ55924.1 328 MDSLRYWVL 336
                 79*****76 PP

>> PF10206  Mitochondrial F1F0-ATP synthase, subunit f
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.067   2.8e+02       9      22 ..      71      84 ..      66      94 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.067
     PF10206  9 eynpkvhGpydpar 22
                +y  +vhGpydp r
  AAZ55924.1 71 RYGYRVHGPYDPER 84
                7889********88 PP

>> PF12151  Mannan-binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.2     0.076   3.2e+02      17      28 ..     401     412 ..     399     413 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.076
                 -EEE-EEEEEET CS
     PF12151  17 geWnGQWtntvv 28 
                 +eWnG ++ tv+
  AAZ55924.1 401 TEWNGKYRDTVR 412
                 78******9986 PP

>> PF01824  MatK/TrnK amino terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.058   2.4e+02     147     171 ..     315     339 ..     247     366 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.058
     PF01824 147 dilipypihleilvqtlrywvkdas 171
                  +++ +p  l++++ +lrywv d  
  AAZ55924.1 315 SLNVRHPHSLQLIMDSLRYWVLDMH 339
                 577899999************9964 PP

>> PF04328  Protein of unknown function (DUF466)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.17   7.2e+02      25      45 ..     160     180 ..     158     186 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.17
     PF04328  25 YekYveHmrktHPdkpvmsee 45 
                 Ye+ v+ m  +HPd p++ + 
  AAZ55924.1 160 YEAHVRGMTIRHPDVPPPLRG 180
                 999************998665 PP

>> PF12521  Protein of unknown function (DUF3724)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.14   5.8e+02       6      14 ..     298     306 ..     297     307 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.14
     PF12521   6 vVeDYsrYt 14 
                 v+eD +rY+
  AAZ55924.1 298 VREDNPRYY 306
                 9*******9 PP

>> PF01791  DeoC/LacD family aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0     0.074   3.1e+02     105     138 ..     243     277 ..     237     288 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.074
                 TTHHHHHHHHHHHHHHHHTSEEEEEEE.EEE-CHH CS
     PF01791 105 eeeeqvlaeikavkeacheeglkvile.allrdee 138
                 +++ ++++e k++++a h++g+ vil  ++  ++e
  AAZ55924.1 243 GTRGHQVQEFKTMVKALHQAGIEVILDvVYNHTAE 277
                 567789********************955544443 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0     0.085   3.5e+02      77     105 ..     247     275 ..     240     280 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.085
                 BEE-EEHHHHHHHHH-----EEE--TTHH CS
     PF00625  77 nlygtskeaveeiaesgkiviLDvdiqgv 105
                 +   + k+ v+  ++ g++viLDv +++ 
  AAZ55924.1 247 HQVQEFKTMVKALHQAGIEVILDVVYNHT 275
                 555678999***************99996 PP

>> PF00724  NADH:flavin oxidoreductase / NADH oxidase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.11   4.8e+02      76     101 ..     246     271 ..     234     280 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.11
                 GGGHHHHHHHHHHHHHTT-EEE-EEE CS
     PF00724  76 deqveqwkklteavhengskvvvqlw 101
                  +qv+++k++++a h++g  v+++++
  AAZ55924.1 246 GHQVQEFKTMVKALHQAGIEVILDVV 271
                 589***************98887765 PP

>> PF09262  Peroxisome biogenesis factor 1, N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.25   1.1e+03       8      24 ..     544     560 ..     542     566 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.25
     PF09262   8 PltsdDWEiielhaefl 24 
                 P +  DWE+   +a +l
  AAZ55924.1 544 PISWVDWELARRNADLL 560
                 99999*********987 PP

>> PF10663  Virulence factor EsxB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.4      0.26   1.1e+03      45      57 ..     402     414 ..     400     416 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.26
     PF10663  45 kWeGktrdaflsy 57 
                 +W+Gk rd ++++
  AAZ55924.1 402 EWNGKYRDTVRDF 414
                 8*********997 PP

>> PF00272  Cecropin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.3      0.45   1.9e+03       8      15 ..     631     638 ..     631     638 .. 0.95

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.45
     PF00272   8 kvGqnvRd 15 
                 ++G+++Rd
  AAZ55924.1 631 RMGRRIRD 638
                 89*****9 PP

>> PF01488  Shikimate / quinate 5-dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0       1.1   4.4e+03      20      39 ..     183     202 ..     183     205 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 1.1
                 ------HHHHHHHH----EE CS
     PF01488  20 AGemarlvakhLlekgvkki 39 
                 AG++  ++++hLl+ gv+++
  AAZ55924.1 183 AGMAHPAIIEHLLSLGVTAV 202
                 899*************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (707 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       189  (0.0158664); expected 238.2 (0.02)
Passed bias filter:                      179  (0.0150269); expected 238.2 (0.02)
Passed Vit filter:                        25  (0.00209872); expected 11.9 (0.001)
Passed Fwd filter:                        25  (0.00209872); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              24  [number of targets reported over threshold]
# CPU time: 0.39u 0.03s 00:00:00.42 Elapsed: 00:00:00
# Mc/sec: 3913.70
//