# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30318.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ56085.1  [L=399]
Description: tfus0 AAZ56085.1 GIB00263CH01 "argininosuccinate synthase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   6.6e-177  591.1   0.0   7.6e-177  590.9   0.0    1.0  1  PF00764  Arginosuccinate synthase
  ------ inclusion threshold ------
      0.025   17.0   0.0      0.046   16.2   0.0    1.4  1  PF06508  ExsB
       0.42   12.7   0.1       0.67   12.1   0.0    1.2  1  PF00733  Asparagine synthase
        1.3   10.1   0.0        1.9    9.7   0.0    1.2  1  PF03054  tRNA methyl transferase
          4    9.8   0.1         15    7.9   0.1    1.9  1  PF12123  N-acetylmuramoyl-l-alanine amidase
        6.1    9.2   0.0         13    8.2   0.0    1.5  1  PF03793  PASTA domain
         33    5.1   0.0         49    4.6   0.0    1.1  1  PF00509  Hemagglutinin
         33    7.1   0.4    1.5e+02    4.9   0.0    2.3  1  PF08369  Proto-chlorophyllide reductase 57 kD subunit
         43    6.7   0.0         81    5.8   0.0    1.4  1  PF04800  ETC complex I subunit conserved region
         49    6.9   0.0    1.6e+02    5.2   0.0    1.8  1  PF07319  Primosomal protein DnaI N-terminus
         51    6.3   0.0         82    5.7   0.0    1.3  1  PF10910  Protein of unknown function (DUF2744)
         77    5.2   0.0    1.2e+02    4.6   0.0    1.2  1  PF00314  Thaumatin family
         84    4.6   0.1    1.4e+02    3.9   0.0    1.3  1  PF02540  NAD synthase
         84    6.1   0.1    2.6e+02    4.5   0.1    1.8  1  PF11900  Domain of unknown function (DUF3420)
    1.1e+02    5.2   0.0    2.1e+02    4.3   0.0    1.5  1  PF10331  Siderophore biosynthesis protein domain
    1.2e+02    5.3   0.0    2.5e+02    4.3   0.0    1.4  1  PF07607  Protein of unknown function (DUF1570)
    1.2e+02    5.1   0.3    2.3e+02    4.2   0.2    1.4  1  PF09947  Uncharacterized protein conserved in archaea (DUF21
    1.9e+02    4.6   0.1    4.3e+02    3.5   0.1    1.5  1  PF10771  Protein of unknown function (DUF2582)
    2.9e+02    2.7   0.1    4.2e+02    2.2   0.1    1.1  1  PF04551  GcpE protein
    4.3e+02    3.4   0.0    9.6e+02    2.3   0.0    1.5  1  PF02923  Restriction endonuclease BamHI
    4.8e+02    3.4   0.1    1.6e+03    1.7   0.0    1.8  1  PF00745  Glutamyl-tRNAGlu reductase, dimerisation domain
    9.9e+02    1.1   0.0    1.7e+03    0.4   0.0    1.2  1  PF02606  Tetraacyldisaccharide-1-P 4'-kinase


Domain and alignment annotation for each model:
>> PF00764  Arginosuccinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  590.9   0.0  1.7e-180  7.6e-177       1     389 [.       6     393 ..       6     394 .. 0.99

  Alignments for each domain:
  == domain 1    score: 590.9 bits;  conditional E-value: 1.7e-180
     PF00764   1 vLaysGGlDtsviikllkeklgeeviavavdvGqeeedldeaeekalklgavksvvvDakeeFvkdyifpaikanalYedrYllstalaRPliakklve 99 
                 vLaysGGlDtsv+i +++e++g+eviava+d Gq++ed++ ++++al +gav++v+ DakeeF++dy+ pai+analY+drY+l++al+RPli+k+l e
  AAZ56085.1   6 VLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFANDYCVPAIQANALYMDRYPLVSALSRPLIVKHLAE 104
                 8************************************************************************************************** PP

     PF00764 100 vakkegaeavahGctGkGnDqvRFevsirslaPdlkviaPvReleltReeeieyakekgipvpvtkkkpysiDenllgrsieagiLedpkteppediye 198
                 +a+ +ga++vahGctGkGnDqvRFe+++++l P+lkv+aPvR+  +tR+++i++a+ekg+p++vtkk+pysiD+nl+gr++e+g+Led+++ p+ediy+
  AAZ56085.1 105 AARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELKVLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYD 203
                 *************************************************************************************************** PP

     PF00764 199 ltkdpakakdepeeveieFekGvPvsldgeklevlelikklnelagkhGvGRiDivedRlvglksReiYeapaalvLikahkdleeltlerevlkfkei 297
                 +t++pa+ + ep+ev i F +GvP +ldg++l++le+i++ln++ag++GvGRiD+vedRlvg+ksRe+Yeap+a++Li+ah++le++t+ere+++fk+ 
  AAZ56085.1 204 YTQNPAEPR-EPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLITAHQELENVTVERELARFKRW 301
                 ******998.9**************************************************************************************** PP

     PF00764 298 veekyaelvYkGlwlsPlkealdafidktqervtGtvrvklykGsvvvlgReselslYdeelvsfdeedeldqkeaeGfvkihglqaklyek 389
                 v+++++elvY+Glw+sPlk+ald+fi +++++vtG++r+ l+ G++vv+gR+se slYd +l+++d+ d++dq+ a+Gf++i+++ ak++++
  AAZ56085.1 302 VDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVTGRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIANM 393
                 ****************************************************************************************9875 PP

>> PF06508  ExsB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   16.2   0.0     1e-05     0.046       2      47 ..       5      52 ..       4      93 .. 0.75

  Alignments for each domain:
  == domain 1    score: 16.2 bits;  conditional E-value: 1e-05
                EEEE-----HHHHHHHH.HHHH-SEEEEEEEESS-T.TSHHHHHHHHH CS
     PF06508  2 avvllSGGlDSttvlal.akkegkevealtfdYgqr.hkkeleaakki 47
                +v+  SGGlD ++++ + a+++g+ev+a+ +d gq  +++e+   +++
  AAZ56085.1  5 VVLAYSGGLDTSVAIGWiAEETGAEVIAVAIDCGQGgEDMEVIRQRAL 52
                67789*****9999876256778************9777777666665 PP

>> PF00733  Asparagine synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.0   0.00015      0.67      19     124 ..       4     114 ..       2     126 .. 0.72

  Alignments for each domain:
  == domain 1    score: 12.1 bits;  conditional E-value: 0.00015
                 EE-EE-----HHHHHHHHHTT.TSSEEEEEE---TSS-..-HHHHHHHHHH---EEEE----HHHHH--.....-HHHHHHHT-----.HHHHH---HH CS
     PF00733  19 pvgvlLSGGlDSsliaalaaresskplktfsvgfeeseadeagyaelvaehlgtehveinvteeellea.....lpevikhleepdat.ddsigiplyl 111
                 +v +  SGGlD s+     a+e+  ++ +++++  + ++ + ++ ++ a ++g     i   +ee+++      +++ + +++++  +   s  + + +
  AAZ56085.1   4 RVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGE-DMEVIRQRALACGAVEAVIADAKEEFANDycvpaIQANALYMDRYPLVsALSRPLIVKH 101
                 688899********99999999***************97.77777777777777777777777777776663333333333333332236666666667 PP

                 HHHHH-.---SEE CS
     PF00733 112 asrlaresgvkVv 124
                 ++++ar +g+++v
  AAZ56085.1 102 LAEAARYHGATMV 114
                 7777777777766 PP

>> PF03054  tRNA methyl transferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.0   0.00041       1.9       2      37 ..       4      40 ..       3      77 .. 0.79

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.00041
                EEE-------HHHHHHHHHH.H---EEE--EEE-SS- CS
     PF03054  2 kvvvalSgGVDSsvaalllk.eqgyevigvfmknwee 37
                +vv a SgG D sva   ++ e g evi+v + + + 
  AAZ56085.1  4 RVVLAYSGGLDTSVAIGWIAeETGAEVIAVAIDCGQG 40
                89*************9766515679****99988776 PP

>> PF12123  N-acetylmuramoyl-l-alanine amidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.1    0.0033        15      23      40 ..     289     313 ..     288     316 .. 0.77

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0033
     PF12123  23 glsdaeLdkftaWLDrr.......g 40 
                 ++ + eL++f+ W D+r       g
  AAZ56085.1 289 VTVERELARFKRWVDQRwgelvydG 313
                 68899************76444444 PP

>> PF03793  PASTA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0028        13       7      34 ..     148     177 ..     145     185 .. 0.79

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0028
     PF03793   7 tGmsvdeAkatLkalGlkiktvee..tsdd 34 
                 +Gm+ d A+a ++++Gl+i + ++  +s d
  AAZ56085.1 148 SGMTRDKAIAFAEEKGLPIDVTKKspYSID 177
                 59***************5555555446665 PP

>> PF00509  Hemagglutinin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.011        49     320     356 ..     170     208 ..     161     212 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.011
                 BSSTSSS.-----.-B.---B-----------B--EEE- CS
     PF00509 320 rnvPeikerGlFG.Ai.AGFiEgGWeGlidGWyGfrhqn 356
                 ++ P   ++ lFG A+  GF+E+ W+G i+  y ++++ 
  AAZ56085.1 170 KKSPYSIDQNLFGrAVeTGFLEDIWNGPIEDIYDYTQNP 208
                 667777889999954457****************99765 PP

>> PF08369  Proto-chlorophyllide reductase 57 kD subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.033   1.5e+02      16      33 ..     145     164 ..     143     168 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.033
     PF08369  16 vR..kklRraaEklAreaGk 33 
                 vR  ++ R++a ++A+e+G 
  AAZ56085.1 145 VRdsGMTRDKAIAFAEEKGL 164
                 7888999***********97 PP

>> PF04800  ETC complex I subunit conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.018        81      57      78 ..     151     172 ..     143     186 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.018
     PF04800  57 tkeeAiafaerqgleykveepk 78 
                 t+++Aiafae +gl  +v+++ 
  AAZ56085.1 151 TRDKAIAFAEEKGLPIDVTKKS 172
                 89************99998876 PP

>> PF07319  Primosomal protein DnaI N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.036   1.6e+02      26      64 ..     268     305 ..     256     308 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.036
                 HHHTT-HHHHHHHHHSTTT--HHHHHHTHHHHHHHHHS- CS
     PF07319  26 kevlkdpdVqaFlkehkeeltqeeierslsklyeyveek 64 
                 +ev++ p     + +h +el++ ++er+l+++  +v+++
  AAZ56085.1 268 REVYEAPGAITLITAH-QELENVTVERELARFKRWVDQR 305
                 578888888899999*.9******************997 PP

>> PF10910  Protein of unknown function (DUF2744)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.018        82       4      55 ..     205     256 ..     203     288 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.018
     PF10910   4 tqEevdpdkPeeaflwalrnlPviaGvdavlppaylravSkhlwecGvrpvd 55 
                 tq  ++p +P+e ++    ++P+   ++ ++p ++++++ ++    Gv   d
  AAZ56085.1 205 TQNPAEPREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRID 256
                 677899***********************************99988887776 PP

>> PF00314  Thaumatin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.026   1.2e+02      75     105 ..     350     380 ..     329     395 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.026
     PF00314  75 aggkppatlaeftlkqankldfYdislvdGy 105
                 +g +  a+l ++ l+++++ d+Yd sl  G+
  AAZ56085.1 350 TGRRSEASLYDYHLATYDSGDTYDQSLARGF 380
                 5577889*********************998 PP

>> PF02540  NAD synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.031   1.4e+02      19      41 ..       3      26 ..       1      54 [. 0.75

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.031
                -EEEE------HHHHH.HHHHHHH CS
     PF02540 19 kgvvlGlSGGvDSalv.aalavka 41
                + vvl  SGG+D +++ + +a+++
  AAZ56085.1  3 ERVVLAYSGGLDTSVAiGWIAEET 26
                689*********998526676665 PP

>> PF11900  Domain of unknown function (DUF3420)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.058   2.6e+02       8      18 ..     161     171 ..     160     171 .. 0.95

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.058
     PF11900   8 eKeLPidVvkk 18 
                 eK LPidV+kk
  AAZ56085.1 161 EKGLPIDVTKK 171
                 8********97 PP

>> PF10331  Siderophore biosynthesis protein domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.047   2.1e+02       3      17 ..     289     303 ..     287     305 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.047
                 --GG.GHHHHHHHTT CS
     PF10331   3 ldperDlallhrWmn 17 
                 +++er la++ rW+ 
  AAZ56085.1 289 VTVERELARFKRWVD 303
                 7899*********96 PP

>> PF07607  Protein of unknown function (DUF1570)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.055   2.5e+02       9      31 ..     281     303 ..     276     309 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.055
     PF07607   9 atHQlafNiGlqsrladnpvWvs 31 
                 ++HQ + N+ ++  la++ +Wv 
  AAZ56085.1 281 TAHQELENVTVERELARFKRWVD 303
                 58*******************96 PP

>> PF09947  Uncharacterized protein conserved in archaea (DUF2180)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.2     0.051   2.3e+02       9      25 ..      24      40 ..      22      78 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.051
     PF09947  9 egkdtdavaiCivCGkG 25
                e+  ++++a+ i CG+G
  AAZ56085.1 24 EETGAEVIAVAIDCGQG 40
                67789**********99 PP

>> PF10771  Protein of unknown function (DUF2582)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.1     0.094   4.3e+02      38      49 ..      14      25 ..      12      31 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.094
     PF10771 38 evalAiGWLaRE 49
                ++  AiGW a E
  AAZ56085.1 14 DTSVAIGWIAEE 25
                5678******98 PP

>> PF04551  GcpE protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1     0.093   4.2e+02      41      84 ..      24      67 ..      13      82 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.093
     PF04551 41 eeaGcdivRvtvqsekeaealeeikeklkkkgieiplvadihfn 84
                ee+G++++ v+++  +  e +e i+++  + g    ++ad + +
  AAZ56085.1 24 EETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEE 67
                689************************9999999999*998644 PP

>> PF02923  Restriction endonuclease BamHI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.21   9.6e+02      54      89 ..     143     178 ..     139     189 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.21
                 HHHHHHHHHHHHTT--EEEEHHHHHHTTS----EEE CS
     PF02923  54 kPikeecmellkeygWylekkldilklekkkGPida 89 
                  P++++ m+  k   +  ek l i +++k +  id 
  AAZ56085.1 143 APVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQ 178
                 699999999999999999**9999999988888875 PP

>> PF00745  Glutamyl-tRNAGlu reductase, dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.35   1.6e+03       7      21 ..     291     305 ..     288     308 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.35
                 HHHHHHHHHHHHHHH CS
     PF00745   7 Ieeeveefeewlksl 21 
                 +e+e+++f++w++++
  AAZ56085.1 291 VERELARFKRWVDQR 305
                 89**********987 PP

>> PF02606  Tetraacyldisaccharide-1-P 4'-kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.0      0.37   1.7e+03     147     166 ..      57      76 ..      48      77 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 0.37
     PF02606 147 leivvvdaergfgngrllPa 166
                 +e v+ da++ f n++++Pa
  AAZ56085.1  57 VEAVIADAKEEFANDYCVPA 76 
                 799****************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (399 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       249  (0.0209033); expected 238.2 (0.02)
Passed bias filter:                      233  (0.0195601); expected 238.2 (0.02)
Passed Vit filter:                        22  (0.00184688); expected 11.9 (0.001)
Passed Fwd filter:                        22  (0.00184688); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              22  [number of targets reported over threshold]
# CPU time: 0.27u 0.03s 00:00:00.30 Elapsed: 00:00:00
# Mc/sec: 3190.38
//