# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30321.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ56411.1  [L=407]
Description: tfus0 AAZ56411.1 GIB00263CH01 "dihydroorotate oxidase B, electron transfer subu.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      0.003   20.0   0.0     0.0056   19.1   0.0    1.4  1  PF06030  Bacterial protein of unknown function (DUF916)
  ------ inclusion threshold ------
      0.028   17.1   0.6       0.25   14.0   0.1    2.7  1  PF10633  NPCBM-associated, NEW3 domain of alpha-galactosidas
       0.14   15.2   0.0       0.51   13.5   0.0    1.9  1  PF06280  Fn3-like domain (DUF1034)
       0.16   13.0   0.0       0.23   12.4   0.0    1.1  1  PF06864  Pilin accessory protein (PilO)
       0.35   13.4   0.0       0.91   12.1   0.0    1.7  1  PF11614  Ubp3 associated protein Bre5
       0.67   12.6   0.0        3.5   10.3   0.0    2.2  1  PF07705  CARDB
        1.7   10.7   0.3        2.8   10.0   0.2    1.4  1  PF09594  Protein of unknown function (DUF2029)
        1.8   11.2   2.2         34    7.1   0.0    2.7  2  PF11191  Protein of unknown function (DUF2782)
        5.5    9.6   1.3         13    8.3   0.9    1.7  1  PF07811  TadE-like protein
         28    5.4   1.6         42    4.8   1.1    1.2  1  PF09606  ARC105 or Med15 subunit of Mediator complex non-fun
         32    7.0   0.0         76    5.8   0.0    1.6  1  PF04052  TolB amino-terminal domain
         34    7.1   0.8         80    5.9   0.6    1.6  1  PF11804  Protein of unknown function (DUF3325)
         36    6.8   0.0         73    5.8   0.0    1.5  1  PF04999  Cell division protein FtsL
         42    5.2   0.0         62    4.6   0.0    1.1  1  PF09545  AccI restriction endonuclease
         55    5.2   0.0         80    4.7   0.0    1.1  1  PF03239  Iron permease FTR1 family
         58    5.9   0.2    1.1e+02    4.9   0.1    1.4  1  PF06305  Protein of unknown function (DUF1049)
         59    6.0   2.5    1.2e+02    4.9   1.7    1.5  1  PF09042  Titin Z
         62    5.2   0.1      1e+02    4.5   0.1    1.3  1  PF03918  Cytochrome C biogenesis protein
         63    5.8   0.1    4.4e+02    3.0   0.0    2.1  1  PF10365  Domain of unknown function (DUF2436)
         65    5.6   0.1    1.3e+02    4.7   0.0    1.4  1  PF04893  Yip1 domain
         69    5.2   0.1    1.1e+02    4.5   0.1    1.2  1  PF09721  Transmembrane exosortase (Exosortase_EpsH)
         99    4.8   0.2    1.5e+02    4.2   0.1    1.2  1  PF03631  Ribonuclease BN-like family
      1e+02    5.2   0.0    2.5e+02    4.0   0.0    1.6  1  PF01052  Surface presentation of antigens (SPOA)
    1.1e+02    5.2   0.1    1.8e+02    4.5   0.1    1.2  1  PF04901  Receptor activity modifying family
    1.2e+02    5.0   0.1    2.7e+02    3.8   0.0    1.6  1  PF09976  Uncharacterized protein conserved in bacteria (DUF2
    1.2e+02    5.2   0.5      2e+02    4.5   0.4    1.3  1  PF10739  Protein of unknown function (DUF2550)
    1.5e+02    3.1   0.3    2.1e+02    2.6   0.2    1.1  1  PF10101  Predicted membrane protein (DUF2339)
    1.7e+02    4.8   0.2    4.2e+02    3.5   0.1    1.6  1  PF03988  Repeat of Unknown Function (DUF347)
    1.8e+02    4.7   0.3    3.3e+02    3.9   0.2    1.3  1  PF10495  Pericentrin-AKAP-450 domain of centrosomal targetin
    1.8e+02    4.8   6.1    3.9e+02    3.8   4.2    1.4  1  PF07046  Cytoplasmic repetitive antigen (CRA) like repeat
      2e+02    3.5   0.0    3.2e+02    2.8   0.0    1.2  1  PF02929  Beta galactosidase small chain
      2e+02    4.7   0.0    3.7e+02    3.9   0.0    1.3  1  PF11669  WW domain-binding protein 1
    2.1e+02    3.8   0.0    3.6e+02    3.0   0.0    1.3  1  PF07070  SpoOM protein
    2.3e+02    4.0   0.6    4.5e+02    3.1   0.4    1.4  1  PF11743  Protein of unknown function (DUF3301)
    2.5e+02    4.6   2.6      4e+02    3.9   1.8    1.3  1  PF12467  Cucumber mosaic virus 1a protein
    2.6e+02    4.2   0.4    4.2e+02    3.6   0.3    1.3  1  PF11877  Protein of unknown function (DUF3397)
    2.6e+02    4.9   6.8    7.6e+02    3.4   4.7    1.8  1  PF11748  Protein of unknown function (DUF3306)
    3.4e+02    3.2   7.7         40    6.2   1.4    2.2  1  PF08693  Transmembrane alpha-helix domain
    3.7e+02    2.4   0.1    5.2e+02    1.9   0.1    1.1  1  PF10060  Uncharacterized membrane protein (DUF2298)
    5.5e+02    3.6   0.0    9.4e+02    2.9   0.0    1.3  1  PF10796  Sigma-S stabilisation anti-adaptor protein
    5.7e+02    2.9   0.0    9.8e+02    2.2   0.0    1.3  1  PF04337  Protein of unknown function, DUF480
    6.4e+02    1.6   0.1    9.7e+02    1.0   0.0    1.2  1  PF05684  Protein of unknown function (DUF819)
    6.7e+02    2.8   2.6    1.3e+03    1.9   1.8    1.4  1  PF06150  ChaB
    7.1e+02    2.0   3.8    1.1e+03    1.4   2.7    1.1  1  PF05539  Pneumovirinae attachment membrane glycoprotein G
    7.9e+02    2.3   0.0    1.3e+03    1.6   0.0    1.2  1  PF00060  Ligand-gated ion channel
    2.2e+03    1.4   8.2    2.5e+02    4.5   2.3    1.9  1  PF10152  Predicted coiled-coil domain-containing protein (DU


Domain and alignment annotation for each model:
>> PF06030  Bacterial protein of unknown function (DUF916)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.1   0.0   2.6e-06    0.0056      15     117 ..      64     163 ..      52     167 .. 0.84

  Alignments for each domain:
  == domain 1    score: 19.1 bits;  conditional E-value: 2.6e-06
     PF06030  15 kasYFdLkvkpkqtqtlkvkikNktnkeikvkvkvnnalTndnGvieYsknkkkkdkslkyklsdlvkvpkeevtvpanesktvtvkvkmPkksfkGvi 113
                   sYF   vkp+qt +  v i+N  ++++++ v   +a+ + +G  +  +++++    l  +  ++ + +++ v+v+  e++++ +++++P+++  G  
  AAZ56411.1  64 GRSYFVHDVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFALLPADEE--PALAGTWIEIPREDQT-VEVKGGETRVIPFTITVPDNAEPGDH 159
                 379*********************************************999864..4577666666665555.**********************9998 PP

     PF06030 114 lGgl 117
                 ++g+
  AAZ56411.1 160 AAGV 163
                 8886 PP

>> PF10633  NPCBM-associated, NEW3 domain of alpha-galactosidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.0   0.1   0.00011      0.25      42      73 ..     132     163 ..     125     168 .. 0.85

  Alignments for each domain:
  == domain 1    score: 14.0 bits;  conditional E-value: 0.00011
     PF10633  42 saaslapGetveatvkVtpPagaaaGdyevta 73 
                 +  +++ Get    +++t+P++a++Gd+   +
  AAZ56411.1 132 QTVEVKGGETRVIPFTITVPDNAEPGDHAAGV 163
                 56699**********************98655 PP

>> PF06280  Fn3-like domain (DUF1034)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.5   0.0   0.00023      0.51      14      93 ..      82     161 ..      72     179 .. 0.79

  Alignments for each domain:
  == domain 1    score: 13.5 bits;  conditional E-value: 0.00023
     PF06280  14 ltlkNlsnkaatykvsandvltdlaakeegslilkaaspeak......avtfepstvtvpanssatvtvtldlpsdfdakngyfve 93 
                 + ++N+++++ t++v  +    d  ++ +gs+ l +a+ e +       +  e +tv+v+ ++++ + +t+++p +++   g  + 
  AAZ56411.1  82 VAITNYGEEPMTFSVYGT----DAFNTPDGSFALLPADEEPAlagtwiEIPREDQTVEVKGGETRVIPFTITVPDNAEP--GDHAA 161
                 789************999....444445567766666655556778999************************997766..55554 PP

>> PF06864  Pilin accessory protein (PilO)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.4   0.0   0.00011      0.23     144     214 ..     289     363 ..     263     377 .. 0.78

  Alignments for each domain:
  == domain 1    score: 12.4 bits;  conditional E-value: 0.00011
     PF06864 144 tlaLss....kalrearlsrvsrgrqlllvallvlllslawavwslwqrqkeeaevaaaaaelaarerlqskktt 214
                 + +L      ++ ++  l++v rg  ++ +  l +l+++  ++  +w+r +++ + +aa+a++ a++r+q  + +
  AAZ56411.1 289 EVTLTPqaapQSAQTPDLHPVTRGDSVIAIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQDAAHQ 363
                 44444443446777788*******999998888888888899999*********************998776655 PP

>> PF11614  Ubp3 associated protein Bre5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.0   0.00042      0.91      61      96 ..     124     159 ..     111     179 .. 0.80

  Alignments for each domain:
  == domain 1    score: 12.1 bits;  conditional E-value: 0.00042
     PF11614  61 gleiv.geqevtvaagetrevpvtvtappedlksgkt 96 
                  +ei  ++q+v+v+ getr +p+t+t+p ++  +g++
  AAZ56411.1 124 WIEIPrEDQTVEVKGGETRVIPFTITVPDNAE-PGDH 159
                 5555578999****************998877.6655 PP

>> PF07705  CARDB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.3   0.0    0.0016       3.5      11      70 ..     214     278 ..     199     301 .. 0.68

  Alignments for each domain:
  == domain 1    score: 10.3 bits;  conditional E-value: 0.0016
     PF07705  11 spseayagenvtitvtvkNqGtaasgsfkvr.......lylngelvstvtvpsLaagesttvsftwt 70 
                 ++ +++a  +vtit++v+N G+   +++  +       + l +      +vp++ +g+ ++ + t++
  AAZ56411.1 214 PWWNPFATGEVTITYQVRNAGNLRLTASGEAgaagpfgVGLGDP--VHKDVPEMLPGTVYEYTHTIP 278
                 567899999************98876665554456633333222..345677777777777666665 PP

>> PF09594  Protein of unknown function (DUF2029)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.0   0.2    0.0013       2.8     195     230 ..     316     351 ..     246     355 .. 0.58

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.0013
     PF09594 195 atlawlvlallvvalaavaalrlr.rrdrlaalaall 230
                  ++ wl  +l++++l+av+++r+r +++r+ a +a++
  AAZ56411.1 316 IAIPWLP-VLAAILLTAVLIWRRRhAKRRFQAAVAAA 351
                 4556666.55555555555555551444444444222 PP

>> PF11191  Protein of unknown function (DUF2782)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.016        34       3      35 ..      17      59 ..      14     100 .. 0.78
   2 ?    1.8   1.0      0.69   1.5e+03      12      47 ..     351     394 ..     331     401 .. 0.55

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.016
     PF11191  3 llllllaapalaaadaatdddpipspaipttp..........e 35
                lll +l++pa a+ad + d++ +pspa+++++          e
  AAZ56411.1 17 LLLYALTTPAPALADPSPDNNSAPSPAARAEQdfrwsvapsnE 59
                4556999*********99*********9999966666655441 PP

  == domain 2    score: 1.8 bits;  conditional E-value: 0.69
     PF11191  12 alaaadaatdddpipspaipttp.........eekepevtivrde 47 
                 a+a a  ++d+  +  p+++++          +e++p+   ++++
  AAZ56411.1 351 AVAEAR-KQDAAHQGAPQTTAAEapadpttdsPEQQPDSAAHQGG 394
                 222222.23333333333333334445555576777766666555 PP

>> PF07811  TadE-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.3   0.9    0.0061        13      10      42 ..     320     352 ..     317     356 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.3 bits;  conditional E-value: 0.0061
     PF07811  10 vlPvlllllfgivelgllfharqtldsAAreAA 42 
                  lPvl ++l+++v + +  ha+   ++A+++A+
  AAZ56411.1 320 WLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAV 352
                 58****************************994 PP

>> PF09606  ARC105 or Med15 subunit of Mediator complex non-fungal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   1.1     0.019        42     120     177 ..     343     400 ..     321     406 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.019
     PF09606 120 rgqaavgasgagpsqmsavaraaqggqlqgvlqqsagqqqsqqpnqqqaqqgqaqlqa 177
                 r qaav+a++a ++++ a+ ++a+++ ++    + ++ + +qqp+    q+g+a  q+
  AAZ56411.1 343 RFQAAVAAAVAEARKQDAAHQGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQT 400
                 5699999999999999999999999888765555555666666766666666665554 PP

>> PF04052  TolB amino-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.035        76      15      67 ..     131     183 ..     119     189 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.035
                 -B--EEEE------EE------B----.--SS-----HHHHHHH----EE--G CS
     PF04052  15 qleieItkgvdeplpiavvpfkgegaaaelgediseviaaDLkrSGlFrpidp 67 
                 + ++e+++g+++ +p+ ++   +++ +++++  i++v  + L+  G++  +d+
  AAZ56411.1 131 DQTVEVKGGETRVIPFTITVPDNAEPGDHAAGVIASVSHDALNAQGQLVRVDR 183
                 5699***********999999888888899999****9999*99999877776 PP

>> PF11804  Protein of unknown function (DUF3325)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.6     0.037        80      72     102 ..     323     353 ..     310     357 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.037
     PF11804  72 tlaalllvlllsyrprllrrlaaaalllall 102
                  laa+ll+++l +r r+++r + aa+++a++
  AAZ56411.1 323 VLAAILLTAVLIWRRRHAKRRFQAAVAAAVA 353
                 579***********99999888777777665 PP

>> PF04999  Cell division protein FtsL
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.034        73      18      58 ..     321     362 ..     305     364 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.034
     PF04999  18 l.llllvlvsAvgvvyvthqtRqlvselekllqerdkLeeew 58 
                 l +l+++l++Av +   +h  R+  ++   +++e++k ++ +
  AAZ56411.1 321 LpVLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQDAAH 362
                 15899*********************9999999999877665 PP

>> PF09545  AccI restriction endonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.029        62     287     329 ..     160     202 ..     153     210 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.029
     PF09545 287 ndgvifsvekdvknqnkttikinsktgvpialkvdeplhesvr 329
                   gvi sv +d+ n +   ++++ ++   + l+vd p+  s+ 
  AAZ56411.1 160 AAGVIASVSHDALNAQGQLVRVDRRIAARVYLRVDGPVRPSLH 202
                 579**********************************998876 PP

>> PF03239  Iron permease FTR1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.037        80      81     124 ..     323     363 ..     320     374 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.037
     PF03239  81 liavvviswmilwmrrvgkklkeeveqklakavaeiknrkkaaq 124
                 ++a+++++ +++w rr   ++k  ++  +a+avae   + +a q
  AAZ56411.1 323 VLAAILLTAVLIWRRR---HAKRRFQAAVAAAVAEARKQDAAHQ 363
                 6899*********999...8999999999999997744444434 PP

>> PF06305  Protein of unknown function (DUF1049)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.052   1.1e+02      44      76 ..     323     355 ..     317     360 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.052
     PF06305  44 allglllsvlfllklrlqlrrlqkqlkklekel 76 
                 +l ++ll+++ +++ r + rr q++++++ +e+
  AAZ56411.1 323 VLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEA 355
                 577899******************998887765 PP

>> PF09042  Titin Z
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   1.7     0.057   1.2e+02      14      31 ..     346     363 ..     337     372 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.057
     PF09042  14 atVVaAvDkArereplsd 31 
                 a V aAv+ Ar+++++  
  AAZ56411.1 346 AAVAAAVAEARKQDAAHQ 363
                 679**********98765 PP

>> PF03918  Cytochrome C biogenesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.048     1e+02     106     135 ..     320     352 ..     306     364 .. 0.56

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.048
     PF03918 106 lgPllllllgllvlllvlrrrrrkkae...eel 135
                 ++P+l+ +l+ +vl+++ r+ +r+ ++   +++
  AAZ56411.1 320 WLPVLAAILLTAVLIWRRRHAKRRFQAavaAAV 352
                 457776666666666666655555444343222 PP

>> PF10365  Domain of unknown function (DUF2436)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0       0.2   4.4e+02     104     128 ..     266     290 ..     260     298 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.2
     PF10365 104 ipaGtydyvitnpepddkvwiaGdG 128
                 +p+ +y+y+ t p+     wi G+ 
  AAZ56411.1 266 LPGTVYEYTHTIPDIYPLFWINGEV 290
                 79*******************9985 PP

>> PF04893  Yip1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.059   1.3e+02      53      86 ..     302     335 ..     280     354 .. 0.62

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.059
     PF04893  53 evqgltlssllgaiiggylglllgllllalllhl 86 
                 + ++l+ ++   ++i+++++ +l+++ll+++l +
  AAZ56411.1 302 QTPDLHPVTRGDSVIAIPWLPVLAAILLTAVLIW 335
                 4555666666666666666666666666555544 PP

>> PF09721  Transmembrane exosortase (Exosortase_EpsH)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.052   1.1e+02      81     115 ..     317     350 ..     305     369 .. 0.68

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.052
     PF09721  81 lllailalpllllgllllllgrkslraltfalall 115
                  + ++ +l+++ll+++l++++r + r++  a+a +
  AAZ56411.1 317 AIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVA-A 350
                 555566666667777777776666666666665.2 PP

>> PF03631  Ribonuclease BN-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.1     0.069   1.5e+02     159     198 ..     315     353 ..     290     355 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.069
     PF03631 159 lqllrllvalllltllfallyrflpnrkvkwrdalpGall 198
                 + ++++ +++l+++ll+a+l +   ++k ++ +a+ +a++
  AAZ56411.1 315 VIAIPW-LPVLAAILLTAVLIWRRRHAKRRFQAAVAAAVA 353
                 568999.79999999999999999999****999999986 PP

>> PF01052  Surface presentation of antigens (SPOA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.11   2.5e+02      52      70 ..     171     189 ..     158     196 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.11
     PF01052  52 rpiarGelgeidgrlavri 70 
                  + a+G+l+++d r+a r+
  AAZ56411.1 171 ALNAQGQLVRVDRRIAARV 189
                 56699***********998 PP

>> PF04901  Receptor activity modifying family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1     0.084   1.8e+02      86     112 ..     315     341 ..     309     344 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.084
     PF04901  86 llalivvPillilllvaLvvwrskrte 112
                 ++a+  +P+l  +ll+a+++wr ++++
  AAZ56411.1 315 VIAIPWLPVLAAILLTAVLIWRRRHAK 341
                 5666778***************98765 PP

>> PF09976  Uncharacterized protein conserved in bacteria (DUF2133)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.12   2.7e+02      15      32 ..     319     336 ..     319     347 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.12
     PF09976  15 kwiivgavlalagvaGwr 32 
                 +w+ v+a+++l +v  wr
  AAZ56411.1 319 PWLPVLAAILLTAVLIWR 336
                 5999*************9 PP

>> PF10739  Protein of unknown function (DUF2550)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.4     0.094     2e+02       1      35 [.     323     357 ..     323     364 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.094
     PF10739   1 vlvlvvlalvavlvrrrlllrrlggvecilrelpa 35 
                 vl++++l +v+++ rr +++r + +v++++ e  +
  AAZ56411.1 323 VLAAILLTAVLIWRRRHAKRRFQAAVAAAVAEARK 357
                 57778888888888888888888888888775443 PP

>> PF10101  Predicted membrane protein (DUF2339)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.2     0.097   2.1e+02     253     285 ..     320     352 ..     305     374 .. 0.63

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.097
     PF10101 253 llalllallylalalllarrarkellllaalll 285
                 +l++l+a+l++a++++ +r a+ ++  ++a+ +
  AAZ56411.1 320 WLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAV 352
                 444455555555554444443444444333333 PP

>> PF03988  Repeat of Unknown Function (DUF347)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.1      0.19   4.2e+02      35      53 ..     323     341 ..     322     343 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.19
     PF03988  35 vflallavlvaaqyrtert 53 
                 v++a+l+ +v+++ r+++ 
  AAZ56411.1 323 VLAAILLTAVLIWRRRHAK 341
                 6889999999999888875 PP

>> PF10495  Pericentrin-AKAP-450 domain of centrosomal targeting protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.2      0.15   3.3e+02      49      71 ..     336     358 ..     321     364 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.15
     PF10495  49 sqsrprrkfrsavqvviaisRmr 71 
                 +++ ++r+f++av +++a  R +
  AAZ56411.1 336 RRRHAKRRFQAAVAAAVAEARKQ 358
                 67889************988855 PP

>> PF07046  Cytoplasmic repetitive antigen (CRA) like repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   4.2      0.18   3.9e+02      20      36 ..     345     361 ..     340     364 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.18
     PF07046  20 rAAEAtKvaEaeKqkaa 36 
                 +AA A+ vaEa Kq aa
  AAZ56411.1 345 QAAVAAAVAEARKQDAA 361
                 49999999999999887 PP

>> PF02929  Beta galactosidase small chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.15   3.2e+02      98     121 ..     222     245 ..     200     252 .. 0.75

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.15
                 EEEEEEEEE-----EEEEEEEEE- CS
     PF02929  98 vevevtYtidadGeinvavdlera 121
                  ev++tY++ + G+++++ + e+ 
  AAZ56411.1 222 GEVTITYQVRNAGNLRLTASGEAG 245
                 46899************9988765 PP

>> PF11669  WW domain-binding protein 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.17   3.7e+02      25      55 ..     320     350 ..     317     376 .. 0.72

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.17
     PF11669  25 Wlvwvliiilallcayslrrkkrrlqeqqrq 55 
                 Wl    +i+l+ + +++ r++krr+q     
  AAZ56411.1 320 WLPVLAAILLTAVLIWRRRHAKRRFQAAVAA 350
                 666667899999*************765443 PP

>> PF07070  SpoOM protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.17   3.6e+02      80      99 ..     134     153 ..     125     161 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.17
     PF07070  80 ftikageereipfeldlpwe 99 
                  ++k ge+r ipf++++p +
  AAZ56411.1 134 VEVKGGETRVIPFTITVPDN 153
                 67899*************98 PP

>> PF11743  Protein of unknown function (DUF3301)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.4      0.21   4.5e+02       3      37 ..     325     359 ..     321     361 .. 0.57

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.21
     PF11743   3 llllllalvaalfwqarkirelAlaaakraCkkld 37 
                  ++ll+a++++   +a++  ++A+aaa  +++k+d
  AAZ56411.1 325 AAILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQD 359
                 33444444444444445555678888888888876 PP

>> PF12467  Cucumber mosaic virus 1a protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   1.8      0.18     4e+02      64     127 ..     340     403 ..     332     407 .] 0.73

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.18
     PF12467  64 vlkraavevedaktlraekkkkleeaaeqpvqedsveefedavdassesvrddekpekevegqt 127
                   +r + +v+ a + ++++ ++ + a +++  e +++ ++d ++++++s+ ++  +++e++ ++
  AAZ56411.1 340 AKRRFQAAVAAAVAEARKQDAAHQGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQTEPE 403
                 4568888898888888888888888888888888888788888887777776666666555544 PP

>> PF11877  Protein of unknown function (DUF3397)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.3      0.19   4.2e+02       5      36 ..     315     348 ..     313     353 .. 0.73

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.19
     PF11877   5 avaflvlvpllliilvklfrlkkrgl..aflaav 36 
                 ++a++ l +l++i+l+ ++ +++r++  +f+aav
  AAZ56411.1 315 VIAIPWLPVLAAILLTAVLIWRRRHAkrRFQAAV 348
                 6888999889999999889999996533665554 PP

>> PF11748  Protein of unknown function (DUF3306)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   4.7      0.35   7.6e+02       6      59 ..     335     387 ..     333     405 .. 0.39

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.35
     PF11748   6 WsrRklaakaaeepaeeaeeeesee........eaaeaeaaaeeeeeeaeledeelletlpd 59 
                 W rR ++  + ++++++a++e  ++        ++++aea+a+++ +++e++        pd
  AAZ56411.1 335 WRRRHAKR-RFQAAVAAAVAEARKQdaahqgapQTTAAEAPADPTTDSPEQQ--------PD 387
                 65555555.4444444443333332111223332222222222222222222........22 PP

>> PF08693  Transmembrane alpha-helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   1.4     0.018        40      22      38 ..     322     338 ..     316     340 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.018
     PF08693  22 gvIalvLlaiLflvyRR 38 
                  v+a++Ll  +++++RR
  AAZ56411.1 322 PVLAAILLTAVLIWRRR 338
                 48899999989999999 PP

>> PF10060  Uncharacterized membrane protein (DUF2298)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.24   5.2e+02     399     436 ..     315     352 ..     300     356 .. 0.80

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.24
     PF10060 399 lvgipllalllpllvaallalrkrklavgfelllialg 436
                  ++ip l +l+++l++a+l+ r+r+++ +f + ++a+ 
  AAZ56411.1 315 VIAIPWLPVLAAILLTAVLIWRRRHAKRRFQAAVAAAV 352
                 56788888888999999999888888888888888775 PP

>> PF10796  Sigma-S stabilisation anti-adaptor protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.43   9.4e+02      30      67 ..     326     363 ..     324     369 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.43
     PF10796  30 ellvsAllrtlkngkqqeliekvekaieaaldaedvpd 67 
                 ++l++A+l+     +  ++ ++v  a+++a++++  ++
  AAZ56411.1 326 AILLTAVLIWRRRHAKRRFQAAVAAAVAEARKQDAAHQ 363
                 69*********999****************99877665 PP

>> PF04337  Protein of unknown function, DUF480
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.45   9.8e+02      10      26 ..     268     284 ..     264     308 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.45
     PF04337  10 gcLlEKevttPdqYPLs 26 
                 g++ E  +t+Pd YPL 
  AAZ56411.1 268 GTVYEYTHTIPDIYPLF 284
                 7788999********94 PP

>> PF05684  Protein of unknown function (DUF819)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.44   9.7e+02       5      29 ..     328     352 ..     323     362 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.44
     PF05684   5 alaalvlwleektkvkffavvsall 29 
                  l+a+++w  ++ k +f a+v+a++
  AAZ56411.1 328 LLTAVLIWRRRHAKRRFQAAVAAAV 352
                 5789************99***9998 PP

>> PF06150  ChaB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   1.8       0.6   1.3e+03      11      38 ..     338     365 ..     337     368 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.6
     PF06150  11 ahAqriFlkaFnsaleeygdeetAhkvA 38 
                 +hA+r F++a  +a++e + +++Ah+ A
  AAZ56411.1 338 RHAKRRFQAAVAAAVAEARKQDAAHQGA 365
                 69***********************977 PP

>> PF05539  Pneumovirinae attachment membrane glycoprotein G
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   2.7      0.49   1.1e+03     176     212 ..     363     399 ..     344     405 .. 0.80

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.49
     PF05539 176 kttskpaevstPaypsqrasksdpasqgeqtatakll 212
                 + +++ + +  Pa p+ ++++++p s ++q  +a+ +
  AAZ56411.1 363 QGAPQTTAAEAPADPTTDSPEQQPDSAAHQGGSANEQ 399
                 44556666678********************999876 PP

>> PF00060  Ligand-gated ion channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0       0.6   1.3e+03       5      24 ..     320     339 ..     318     366 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.6
                 -------------------- CS
                 xxxxxxxxxxxxxxxxxxxx RF
     PF00060   5 Wlsvlaayllvsivlflver 24 
                 Wl vlaa+ll++++++   +
  AAZ56411.1 320 WLPVLAAILLTAVLIWRRRH 339
                 99************996555 PP

>> PF10152  Predicted coiled-coil domain-containing protein (DUF2360)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   2.3      0.12   2.5e+02      63      99 ..     354     390 ..     286     407 .] 0.62

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.12
     PF10152  63 paaarrsggpppppgaraeaaaqeaeaaraetpaeqe 99 
                 +a+++ + ++++p++++aea+a++++ +++++p   +
  AAZ56411.1 354 EARKQDAAHQGAPQTTAAEAPADPTTDSPEQQPDSAA 390
                 3333333334444444555555555555555554443 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (407 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       529  (0.044409); expected 238.2 (0.02)
Passed bias filter:                      367  (0.0308093); expected 238.2 (0.02)
Passed Vit filter:                        48  (0.00402955); expected 11.9 (0.001)
Passed Fwd filter:                        47  (0.0039456); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              46  [number of targets reported over threshold]
# CPU time: 0.30u 0.05s 00:00:00.35 Elapsed: 00:00:01
# Mc/sec: 2928.91
//