hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30303.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ54538.1
Accession:      [none]
Description:    tfus0 AAZ54538.1 GIB00263CH01 "Tyrosine protein kinase:Serine/threonine protein.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0038659  Protein kinase-like (PK-like)                  203.6      2e-64   1
0041927  Protein kinase-like (PK-like)                  218.3    4.5e-64   1
0040302  Protein kinase-like (PK-like)                  201.8    2.2e-63   1
0044924  Protein kinase-like (PK-like)                  196.4    2.9e-61   1
0037714  Protein kinase-like (PK-like)                  202.3    1.1e-60   1
0041710  Protein kinase-like (PK-like)                  213.5    1.5e-60   1
0034801  Protein kinase-like (PK-like)                  195.7    8.1e-60   1
0040179  Protein kinase-like (PK-like)                  212.5    9.4e-60   1
0040180  Protein kinase-like (PK-like)                  209.3    9.6e-60   1
0037369  Protein kinase-like (PK-like)                  197.0    1.1e-59   1
0049348  Protein kinase-like (PK-like)                  203.3    2.7e-59   1
0035157  Protein kinase-like (PK-like)                  207.1    4.6e-58   1
0038373  Protein kinase-like (PK-like)                  193.0    5.7e-58   1
0035371  Protein kinase-like (PK-like)                  191.8    3.6e-57   1
0044036  Protein kinase-like (PK-like)                  197.7    8.5e-57   1
0039145  Protein kinase-like (PK-like)                  192.1    9.5e-57   1
0043074  Protein kinase-like (PK-like)                  185.8    1.7e-56   1
0036031  Protein kinase-like (PK-like)                  189.0    4.9e-56   1
0049347  Protein kinase-like (PK-like)                  199.3      1e-55   1
0040670  Protein kinase-like (PK-like)                  186.0    1.8e-55   1
0039603  Protein kinase-like (PK-like)                  192.8    1.9e-55   1
0042707  Protein kinase-like (PK-like)                  185.7    2.1e-55   1
0050990  Protein kinase-like (PK-like)                  193.3    6.7e-55   1
0047088  Protein kinase-like (PK-like)                  180.8    9.4e-55   1
0041719  Protein kinase-like (PK-like)                  190.3    1.4e-54   1
0042918  Protein kinase-like (PK-like)                  186.1    2.9e-54   1
0047734  Protein kinase-like (PK-like)                  180.1    3.2e-54   1
0041048  Protein kinase-like (PK-like)                  183.3    3.9e-54   1
0046180  Protein kinase-like (PK-like)                  182.4    4.2e-54   1
0048785  Protein kinase-like (PK-like)                  187.1    9.6e-54   1
0044407  Protein kinase-like (PK-like)                  192.1    1.5e-53   1
0039686  Protein kinase-like (PK-like)                  191.7      2e-53   1
0037668  Protein kinase-like (PK-like)                  186.7    2.1e-53   1
0049795  Protein kinase-like (PK-like)                  187.9    2.2e-53   1
0037572  Protein kinase-like (PK-like)                  184.0    2.4e-53   1
0048206  Protein kinase-like (PK-like)                  180.2      3e-53   1
0037803  Protein kinase-like (PK-like)                  178.5      3e-53   1
0044907  Protein kinase-like (PK-like)                  182.1    3.2e-53   1
0046998  Protein kinase-like (PK-like)                  185.1    3.4e-53   1
0044203  Protein kinase-like (PK-like)                  185.0    4.1e-53   1
0038477  Protein kinase-like (PK-like)                  190.2      5e-53   1
0038940  Protein kinase-like (PK-like)                  183.3    6.3e-53   1
0035615  Protein kinase-like (PK-like)                  182.7    6.4e-53   1
0051877  Protein kinase-like (PK-like)                  185.8    1.2e-52   1
0053164  Protein kinase-like (PK-like)                  177.7    1.3e-52   1
0042315  Protein kinase-like (PK-like)                  181.5    1.7e-52   1
0044547  Protein kinase-like (PK-like)                  184.9    2.8e-52   1
0041767  Protein kinase-like (PK-like)                  181.0    2.9e-52   1
0051133  Protein kinase-like (PK-like)                  183.4    3.2e-52   1
0049786  Protein kinase-like (PK-like)                  181.0    3.9e-52   1
0052889  Protein kinase-like (PK-like)                  184.0    4.3e-52   1
0040727  Protein kinase-like (PK-like)                  187.1    4.7e-52   1
0041095  Protein kinase-like (PK-like)                  182.4    2.3e-51   1
0049538  Protein kinase-like (PK-like)                  168.2    2.4e-51   1
0050905  Protein kinase-like (PK-like)                  174.1    4.1e-51   1
0042354  Protein kinase-like (PK-like)                  180.9      6e-51   1
0037731  Protein kinase-like (PK-like)                  177.9    8.8e-51   1
0043269  Protein kinase-like (PK-like)                  173.4    9.5e-51   1
0049834  Protein kinase-like (PK-like)                  177.5    1.2e-50   1
0046210  Protein kinase-like (PK-like)                  165.5    1.8e-50   1
0048011  Protein kinase-like (PK-like)                  173.9    1.8e-50   1
0039792  Protein kinase-like (PK-like)                  178.2    2.2e-49   1
0046042  Protein kinase-like (PK-like)                  169.2    3.4e-49   1
0038413  Protein kinase-like (PK-like)                  174.9    4.8e-49   1
0043658  Protein kinase-like (PK-like)                  176.8    5.8e-49   1
0039870  Protein kinase-like (PK-like)                  169.4    1.4e-47   1
0044090  Protein kinase-like (PK-like)                  147.2    8.5e-42   1
0041315  Protein kinase-like (PK-like)                   83.4    1.8e-23   1
0039408  Protein kinase-like (PK-like)                   76.7    3.4e-22   1
0041592  Protein kinase-like (PK-like)                   43.1    9.5e-13   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0035157    1/1       3   338 ..     1   341 []   207.1  4.6e-58
0035371    1/1       6   291 ..     1   326 []   191.8  3.6e-57
0040180    1/1       6   352 ..     1   353 []   209.3  9.6e-60
0043074    1/1       8   306 ..     1   311 []   185.8  1.7e-56
0039686    1/1       9   295 ..     1   299 []   191.7    2e-53
0040179    1/1       9   352 ..     1   350 []   212.5  9.4e-60
0044924    1/1      11   307 ..     1   322 []   196.4  2.9e-61
0042354    1/1      14   283 ..     1   303 []   180.9    6e-51
0037369    1/1      15   306 ..     1   294 []   197.0  1.1e-59
0038477    1/1      15   281 ..     1   352 []   190.2    5e-53
0046180    1/1      17   281 ..     1   346 []   182.4  4.2e-54
0052889    1/1      17   281 ..     1   348 []   184.0  4.3e-52
0037668    1/1      18   300 ..     1   285 []   186.7  2.1e-53
0040302    1/1      18   343 ..     1   340 []   201.8  2.2e-63
0051877    1/1      18   281 ..     1   355 []   185.8  1.2e-52
0037731    1/1      19   289 ..     1   275 []   177.9  8.8e-51
0039408    1/1      19   206 ..     1   263 []    76.7  3.4e-22
0042707    1/1      19   298 ..     1   282 []   185.7  2.1e-55
0044407    1/1      19   281 ..     1   355 []   192.1  1.5e-53
0040727    1/1      20   335 ..     1   325 []   187.1  4.7e-52
0049795    1/1      20   324 ..     1   309 []   187.9  2.2e-53
0039145    1/1      21   303 ..     1   303 []   192.1  9.5e-57
0037572    1/1      22   291 ..     1   299 []   184.0  2.4e-53
0038659    1/1      22   314 ..     1   362 []   203.6    2e-64
0040670    1/1      22   283 ..     1   301 []   186.0  1.8e-55
0042918    1/1      22   291 ..     1   272 []   186.1  2.9e-54
0044907    1/1      22   291 ..     1   299 []   182.1  3.2e-53
0046998    1/1      22   290 ..     1   298 []   185.1  3.4e-53
0041315    1/1      24   223 ..     1   255 []    83.4  1.8e-23
0049347    1/1      24   307 ..     1   334 []   199.3    1e-55
0049538    1/1      24   282 ..     1   270 []   168.2  2.4e-51
0037803    1/1      25   312 ..     1   309 []   178.5    3e-53
0038373    1/1      25   308 ..     1   289 []   193.0  5.7e-58
0039603    1/1      25   304 ..     1   293 []   192.8  1.9e-55
0034801    1/1      26   325 ..     1   307 []   195.7  8.1e-60
0044203    1/1      27   287 ..     1   273 []   185.0  4.1e-53
0044547    1/1      27   292 ..     1   276 []   184.9  2.8e-52
0047734    1/1      27   282 ..     1   299 []   180.1  3.2e-54
0048785    1/1      27   281 ..     1   345 []   187.1  9.6e-54
0049786    1/1      27   309 ..     1   285 []   181.0  3.9e-52
0035615    1/1      28   294 ..     1   305 []   182.7  6.4e-53
0036031    1/1      28   306 ..     1   299 []   189.0  4.9e-56
0041048    1/1      28   299 ..     1   283 []   183.3  3.9e-54
0041719    1/1      28   290 ..     1   277 []   190.3  1.4e-54
0038940    1/1      29   296 ..     1   275 []   183.3  6.3e-53
0046042    1/1      29   291 ..     1   262 []   169.2  3.4e-49
0049348    1/1      29   306 ..     1   322 []   203.3  2.7e-59
0041710    1/1      30   358 ..     1   337 []   213.5  1.5e-60
0043658    1/1      30   290 ..     1   263 []   176.8  5.8e-49
0044036    1/1      30   341 ..     1   321 []   197.7  8.5e-57
0048206    1/1      30   293 ..     1   273 []   180.2    3e-53
0050905    1/1      30   305 ..     1   277 []   174.1  4.1e-51
0037714    1/1      31   341 ..     1   316 []   202.3  1.1e-60
0039870    1/1      31   283 ..     1   258 []   169.4  1.4e-47
0041095    1/1      31   283 ..     1   261 []   182.4  2.3e-51
0041927    1/1      31   381 ..     1   364 []   218.3  4.5e-64
0051133    1/1      31   300 ..     1   273 []   183.4  3.2e-52
0053164    1/1      31   280 ..     1   269 []   177.7  1.3e-52
0042315    1/1      32   283 ..     1   277 []   181.5  1.7e-52
0039792    1/1      33   298 ..    35   336 .]   178.2  2.2e-49
0041767    1/1      33   281 ..     1   286 []   181.0  2.9e-52
0043269    1/1      33   283 ..    36   325 .]   173.4  9.5e-51
0047088    1/1      33   297 ..     1   298 []   180.8  9.4e-55
0048011    1/1      33   292 ..     1   327 []   173.9  1.8e-50
0050990    1/1      33   347 ..     1   320 []   193.3  6.7e-55
0038413    1/1      34   281 ..     1   286 []   174.9  4.8e-49
0046210    1/1      34   284 ..     1   293 []   165.5  1.8e-50
0041592    1/1      35   180 ..     1   275 [.    43.1  9.5e-13
0044090    1/1      35   219 ..     1   192 []   147.2  8.5e-42
0049834    1/1      37   301 ..     1   299 []   177.5  1.2e-50

Alignments of top-scoring domains:
0035157: domain 1 of 1, from 3 to 338: score 207.1, E = 4.6e-58
                   *->sssllllllllllllllllllllllelelllddyellkllGeGgfGk
                        s+ +   ++++  ++  + +l+ + + ++++y+ll++lG+Gg G+
  AAZ54538.1     3    AASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGV 49   

                   VylardkstgrlvAvKvlkkellldekllerflrEieilkrlnhpnivkl
                   Vyl+   ++g +vAvK+l+++ l  ++l+e++  E+e+ +r+      ++
  AAZ54538.1    50 VYLGSA-PDGARVAVKTLHRDALDLPGLREQLAEEVEMARRVARFCTAQV 98   

                   lgvfedegelylvmEyveggsLfdllrkrgplseeealrialqillaLey
                   l + +d ++ y+v Eyveg sL  ++r+rgpl  + + r+a++ l aL+ 
  AAZ54538.1    99 LAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAVGTLTALAA 148  

                   LHskgiiHRDlKpeNiLldedgvvklaDFGlarllgdg...lttvvgtpg
                   +H+ gi+HRD Kp+N+L+ + g ++++DFG+ar l+ +++ +++++gtp+
  AAZ54538.1   149 IHQAGIVHRDFKPANVLMAPGG-PRVIDFGIARALEGTailTSRIAGTPA 197  

                   YmAPEvllggpyspksDvWSlGvvlyelltgrppfpglsplelllkilkg
                   YmAPE++ ggp++p++D++++G +l + + gr pf + s +++++++++ 
  AAZ54538.1   198 YMAPEQITGGPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND 247  

                   llplpeglspelkdlilkclqkdpekRptsaevvaeellehpfflgllll
                   ++++  +ls  l++++++cl+kd ++Rpt     a+e l      + +++
  AAZ54538.1   248 EPDF-GELSGTLREIAERCLNKDAAQRPT-----AAETLMLVLGIEGPPP 291  

                   llllllllppllplllslldlslldllllsllllllllsssssllsgssllsllllllllllllllsllelelatddfellellGeGgfGtVyk
                      +++ + ++++  ++  + + +++    +++++ll +lG+Gg G+Vy+
  AAZ54538.1     6    QDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYL 52   

                   arl.tgelvAvKvlk......kellkeflrEieilelkrlrhpnivrllg
                   +   +g +vAvK+l+ ++ + ++l++++  E+e+   +r+      ++l 
  AAZ54538.1    53 GSApDGARVAVKTLHrdaldlPGLREQLAEEVEM--ARRVARFCTAQVLA 100  

                   vcldedggllelylvmEympggsLldllrk.gplseeerlkialqiargL
                   + ld d    ++y+v Ey++g sL+ ++r+ gpl  + + ++a++++ +L
  AAZ54538.1   101 ADLDAD----PPYVVSEYVEGPSLQAVVRErGPLRGASLERLAVGTLTAL 146  

                   ayLHelllgllgskgiiHrDlKpeNiLldedgvvklaDFGlarllssdet
                   a +H        + gi+HrD Kp+N+L+ + g ++++DFG+ar l+ +  
  AAZ54538.1   147 AAIH--------QAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI 187  

                   tlllllttvvgtpgYmAPEvllgglgllllkyttksDvwSlGvvlyellt
                       l+++++gtp+YmAPE++ gg      ++++++D++++G +l + + 
  AAZ54538.1   188 ----LTSRIAGTPAYMAPEQITGG------PLGPAVDMFAWGATLVYAAN 227  

                   grppfdglsplelllkilkgllllpeevlplllslrllelldplllpell
                   gr pf + s  ++++++++ ++ +                        +l
  AAZ54538.1   228 GRGPFGHGSLKAVVQRVINDEPDFG-----------------------EL 254  

                   seelldlilkclakdpekRptasevlehlfflelllelsslslllsllllllllllsllelelltddyellkvLGeGgfGvVyl
                      +++ + ++++  ++  + + + + + ++++y+ll++LG+Gg GvVyl
  AAZ54538.1     6    QDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYL 52   

                   ardlltgrlvAvKvlkke...sekllerflrEieilkrlnhpnivkllgv
                   +   ++g +vAvK+l++++ + + l+e++  E+e+ +r+      ++l +
  AAZ54538.1    53 GS-APDGARVAVKTLHRDaldLPGLREQLAEEVEMARRVARFCTAQVLAA 101  

                   fedddelylvmEyveggsLldllkkrglplseeealrialqilsgLeyLH
                    +d d  y+v Eyveg sL+ ++++rg pl  + + r+a+++l +L+ +H
  AAZ54538.1   102 DLDADPPYVVSEYVEGPSLQAVVRERG-PLRGASLERLAVGTLTALAAIH 150  

                   slgiiHrDlKpeNiLldeddlgvvklaDFGlarllsdd.tllttvvgTpg
                   + gi+HrD Kp+N+L+ +   g ++++DFG+ar l+ ++ l+++++gTp+
  AAZ54538.1   151 QAGIVHRDFKPANVLMAP---GGPRVIDFGIARALEGTaILTSRIAGTPA 197  

                   YmAPEvllggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkg
                   YmAPE++ ggp++p++D++++G +l + + gr pf + s  ++++++++ 
  AAZ54538.1   198 YMAPEQITGGPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND 247  

                   lglppeelppglspelkdlilkclqkdpekRptaeellehpflkglllll
                   ++ +      +ls  l++++++cl+kd ++Rpta+e l      + ++++
  AAZ54538.1   248 EPDF-----GELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPT 292  

                   lllllppllplllslldtslfdllllslllslslslsslllssslslsll
                   +++ + + +p+ ++ l++  +    + +  s+   + s+++ +++++s++
  AAZ54538.1   293 EEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSNV 342  

                   ssllslssdsssslslllllllllllfsllelelatddyellellGeGgfGtVykar
                      +++ ++++  ++  + + +++    +++y+ll +lG+Gg G+Vy++ 
  AAZ54538.1     8    NDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS 54   

                   lkdtgllgrlvAvKvlkksl..seelleeflrEieilsrlrhpnivkllg
                     d    g +vAvK+l++++ + ++l+e++  E+e+ +r+      ++l 
  AAZ54538.1    55 APD----GARVAVKTLHRDAldLPGLREQLAEEVEMARRVARFCTAQVLA 100  

                   vcldeedelylvmEympggsLldllrkrggplseelrlkialqiargLay
                   + l + d++y+v Ey++g sL+ ++r+rg pl    + ++a++ + +La 
  AAZ54538.1   101 ADL-DADPPYVVSEYVEGPSLQAVVRERG-PLRGASLERLAVGTLTALAA 148  

                   LhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllllttvv
                   +h+ gi+HrD Kp+N+L+ + g ++++DFG+ar l+ +      l+++++
  AAZ54538.1   149 IHQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI----LTSRIA 193  

                   gtpgYmAPEvllggkyttksDvwSfGvvlyelltlgrppfdglsplelle
                   gtp+YmAPE++ gg++++++D+++ G +l   +  gr pf + s+  +++
  AAZ54538.1   194 GTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQ 242  

                   lilkglrlplpeelspelldlilkclqkdpekRptasevlehlfflllll
                   ++++ +  p + els  l++++++cl+kd+++Rpta+e l     ++ ++
  AAZ54538.1   243 RVINDE--PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPP 290  

                   ellllllllllllplessslllllllllllllsllelelatddfellellGeGgfGtVylarl
                      +++++++  ++  + +++++    +++++ll +lG+Gg G+Vyl+  
  AAZ54538.1     9    DGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA 55   

                   kllsstgrlvAvKvlkksl..seelleeflrEveilsrlrhpnivrllgv
                       ++g +vAvK+l++++ + ++l+e++  Eve+ +r+      ++l +
  AAZ54538.1    56 ----PDGARVAVKTLHRDAldLPGLREQLAEEVEMARRVARFCTAQVLAA 101  

                   cldedelylvmEymeggsLldllrkrkgplseelalkialqiargLayLh
                    ld d+ y+v Ey+eg sL+ ++r+r gpl  + + ++a++++ +La +h
  AAZ54538.1   102 DLDADPPYVVSEYVEGPSLQAVVRER-GPLRGASLERLAVGTLTALAAIH 150  

                   slgiiHrDlKpeNiLldedgvvklaDFGlarllsssellllllllttvvg
                   + gi+HrD Kp+N+L+   g ++++DFG+ar l+ +       l+++++g
  AAZ54538.1   151 QAGIVHRDFKPANVLMAPGG-PRVIDFGIARALEGTAI-----LTSRIAG 194  

                   tpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsllellll
                   tp+YmAPE++ gg++++++D++++G +l + +  gr pf + sl  ++++
  AAZ54538.1   195 TPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQR 243  

                   ilkglrlplpeelspelldlilkclqkdpekRptasevlehlffllldlp
                   +++ +  p   els  l++++++cl+kd+++Rpta+e l     ++ ++p
  AAZ54538.1   244 VINDE--PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPP 291  

                   lleplsssssllllllllllsllelelllddyellkvlGeGgfGvVylard
                       +++s++  ++  + + + + + ++++y+ll++lG+Gg GvVyl+  
  AAZ54538.1     9    DGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA 55   

                   kltgrlvAvKvlkke...sekllerflrEieilkrlnhpnivrllgvfed
                    ++g +vAvK+l++++ + + l+e++  E+e+ +r+      ++l + +d
  AAZ54538.1    56 -PDGARVAVKTLHRDaldLPGLREQLAEEVEMARRVARFCTAQVLAADLD 104  

                   ddelylvmEympggsLfdllkkrggplseeealkialqilsgLayLHslg
                    d  y+v Ey++g sL  ++++r gpl  + + ++a+++l +La +H+ g
  AAZ54538.1   105 ADPPYVVSEYVEGPSLQAVVRER-GPLRGASLERLAVGTLTALAAIHQAG 153  

                   iiHRDlKpeNiLldedllgvvklaDFGlarllsdg.tllttvvgTpgYmA
                   i+HRD Kp+N+L+ +   g ++++DFG+ar l+ ++ l+++++gTp+YmA
  AAZ54538.1   154 IVHRDFKPANVLMAP---GGPRVIDFGIARALEGTaILTSRIAGTPAYMA 200  

                   PEvllggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkglgl
                   PE++ ggp++p++D++++G +l + + gr pf + s+ ++++++++ ++ 
  AAZ54538.1   201 PEQITGGPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPD 250  

                   pplelppglspelldlilkclqkdpekRptaeellehpflkgllllllll
                        + +ls  l++++++cl+kd ++Rpta+e l      + +++++++
  AAZ54538.1   251 -----FGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEP 295  

                   llllppllpllssllslslllllllssslslslsssslssssllssssls
                    + +++++ ++  +     +     ++s    + s+++ +++++s+++  
  AAZ54538.1   296 STDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSNVAAQ 345  

                   llsslsndssllllllllllllllelllllddyellkllGeGgfGvVylarlkl
                      ++s++  ++  + +l+ + + ++++y+ll++lG+Gg GvVyl+    
  AAZ54538.1    11    GPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-- 55   

                   lsstgrlvAvKvlkksllllseellerflrEieilkrlrghpnivkllgv
                     ++g +vAvK+l+++ l   ++l+e++  E+e+ +r+       ++l++
  AAZ54538.1    56 --PDGARVAVKTLHRDALD-LPGLREQLAEEVEMARRVA-RFCTAQVLAA 101  

                   fededelylvmEyveggsLfdllkkrgplseeealrialqillaLeyLHs
                    +d d +y+v Eyveg sL+ ++++rgpl  + + r+a++ l aL+ +H+
  AAZ54538.1   102 DLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQ 151  

                   lgiiHRDlKpeNiLldedgvvklaDFGlarllssdeltllttvvgtpgYm
                    gi+HRD Kp+N+L+   g ++++DFG+ar l+ +   l+++++gtp+Ym
  AAZ54538.1   152 AGIVHRDFKPANVLMAPGG-PRVIDFGIARALEGTAI-LTSRIAGTPAYM 199  

                   APEvllggplyyspksDvwSlGvvlyelltgrppfdglsplellllilkg
                   APE++ ggp  ++p++D++++G +l + + gr pf + s+ ++++++++ 
  AAZ54538.1   200 APEQITGGP--LGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND 247  

                   lltpplplppglspelldlilkclqkdpekRptmaevvaeellehpfflg
                   +     p + +ls  l++++++cl+kd ++Rpt     a+e l      +
  AAZ54538.1   248 E-----PDFGELSGTLREIAERCLNKDAAQRPT-----AAETLMLVLGIE 287  

                   lllllllllllllpllllllsdlddsllllslllllsllelelatddyellellGeGgfGkVykarlkgllg
                      ++  +   + + +++    +++y+ll++lG+Gg G+Vy++       
  AAZ54538.1    14    QSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA----- 55   

                   sltgrlvAvKvlkksl..seellkeflrEieilsklsrhpnivrllgvcl
                    ++g +vAvK+l++++ + + l++++  E+e+ +++       ++l + l
  AAZ54538.1    56 -PDGARVAVKTLHRDAldLPGLREQLAEEVEMARRV-ARFCTAQVLAADL 103  

                   eegelylvmEymeggsLldllrkrgllllllllllllllllllplseell
                   + +++y+v Ey+eg sL+ ++r+rg                  pl  + l
  AAZ54538.1   104 DADPPYVVSEYVEGPSLQAVVRERG------------------PLRGASL 135  

                   lkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllss
                    ++a++ + +La +h+ gi+HrD Kp+N+L+   g ++++DFG+ar l+ 
  AAZ54538.1   136 ERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEG 184  

                   getllllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrpp
                   +    l+++++gtp+YmAPE++ gg++++++D++++G +l + +  gr p
  AAZ54538.1   185 TAI--LTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGP 231  

                   fpglsllelllkildgllrpplppllspelldlilkclqkdpekRptase
                   f + sl  +++++++ +   p + +ls  l++++++cl+kd+++Rpta+e
  AAZ54538.1   232 FGHGSLKAVVQRVINDE---PDFGELSGTLREIAERCLNKDAAQRPTAAE 278  

                   vlehlflksslllllllllllelllllddyellellGeGgfGvVylarlkltgrl
                      s+ ++  + +l+++   ++++y+ll++lG+Gg GvVyl+   ++g +
  AAZ54538.1    15    SGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGAR 60   

                   vAvKvlkke...seellerflrEieilkrlnhpnivkllgvfldddelyl
                   vAvK+l++++ + + l+e++  E+e+ +r+      ++l + ld d  y+
  AAZ54538.1    61 VAVKTLHRDaldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYV 110  

                   vmEyveggsLldllkk.gplseelalkialqilsaLaylhslgiiHrDlK
                   v Eyveg sL+ ++++ gpl  + + ++a+++l aLa +h+ gi+HrD K
  AAZ54538.1   111 VSEYVEGPSLQAVVRErGPLRGASLERLAVGTLTALAAIHQAGIVHRDFK 160  

                   peNiLldedgvvklaDFGlarllssdetllttvvgtpgYmAPEvllgggy
                   p+N+L+ + g ++++DFG+ar l+ +  l++ ++gtp+YmAPE+++gg++
  AAZ54538.1   161 PANVLMAPGG-PRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPL 209  

                   spksDvwSlGvvlyelltgrppfdglsllellllilkglglllplpplls
                   +p++D++++G +l++ + gr pf + sl ++++++++ +    p +  ls
  AAZ54538.1   210 GPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDE----PDFGELS 255  

                   pelldlilkclqkdpekRptasellehlfflllllpllllllllllllld
                     l++++++cl+kd+++Rpta+e l     ++ ++p+ ++ + + +++++
  AAZ54538.1   256 GTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDTAIPVTH 305  

                   ssslllelllfsllelelatdryellkvlGeGgfGtVylarlketgrl
                      s+ ++  + + +++    +++y+ll++lG+Gg G+Vyl+   ++g +
  AAZ54538.1    15    SGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGAR 60   

                   vAvKvlkkdk.......eeflrEieilkrlnhpnivrllgvfldedelsg
                   vAvK l++d  +     e++  E+e+ +r+      ++l + ld d+   
  AAZ54538.1    61 VAVKTLHRDAldlpglrEQLAEEVEMARRVARFCTAQVLAADLDADP--- 107  

                   llllylvmEympggsLldllkglrkkgplseeealkialqilrgLayLHs
                       y+v Ey++g sL  ++   r++gpl  + + ++a++ l +La +H+
  AAZ54538.1   108 ---PYVVSEYVEGPSLQAVV---RERGPLRGASLERLAVGTLTALAAIHQ 151  

                   lgiiHrDlKpeNiLldedlgvvklaDFGlarllsdg.tllttvvgTpgYm
                    gi+HrD Kp+N+L+ +  g ++++DFG+ar l+ ++ l+++++gTp Ym
  AAZ54538.1   152 AGIVHRDFKPANVLMAP--GGPRVIDFGIARALEGTaILTSRIAGTPAYM 199  

                   APEvllgglkyttksDvWSlGvvlyelltgrppfdgeselelllkilkgl
                   APE++ gg ++++++D+++ G +l + + gr pf + s   +++++++  
  AAZ54538.1   200 APEQITGG-PLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND- 247  

                   gtpslellllvlsllllglllelldprlllplppelspelldlllkclqk
                                                 p + els  l++++++cl+k
  AAZ54538.1   248 -----------------------------EPDFGELSGTLREIAERCLNK 268  

                   dpekRptaeevlehpflkellllllllllppllplllsllllsllsllll
                   d ++Rpta+e l                                      
  AAZ54538.1   269 DAAQRPTAAETLM------------------------------------- 281  

                   slllllsllssddesgllplsllselgeildryellkklGeGgfgtVylardkktgelvA
                       +   p +l+++ +  +++y+ll +lG+Gg g+Vyl+    +g +vA
  AAZ54538.1    17    GPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVA 62   

                   vKvlkksl.lseellerflrEieilkklnhpnivkllgvfedesllgllg
                   vK+l+++  + + l+e++  E+e+ +++   +  ++l +  d       +
  AAZ54538.1    63 VKTLHRDAlDLPGLREQLAEEVEMARRVARFCTAQVLAADLDA------D 106  

                   ylylvmEyc.ggsLldll.kkgplseeeilrialqilsaLeyLHskgiiH
                    +y+v Ey++g sL+ ++ ++gpl    + r+a++ l aL+ +H+ gi+H
  AAZ54538.1   107 PPYVVSEYVeGPSLQAVVrERGPLRGASLERLAVGTLTALAAIHQAGIVH 156  

                   rDlKpeNilldedgvvkliDFGlarllddd...lttlvgtpgYmAPEvll
                   rD Kp+N+l+   g +++iDFG+ar l+ +++ ++ + gtp+YmAPE++ 
  AAZ54538.1   157 RDFKPANVLM-APGGPRVIDFGIARALEGTailTSRIAGTPAYMAPEQIT 205  

                   glgpyspksDvwslGvilyelltgkppfdgesplellekilkllgtpple
                   g gp++p++D++++G +l + + g+ pf + s + +++++++        
  AAZ54538.1   206 G-GPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIN-------- 246  

                   lllklllllllllldllllllgllrlplpenlspelkdlilkllqkdpek
                                           + p +  ls  l+++ +++l+kd ++
  AAZ54538.1   247 ------------------------DEPDFGELSGTLREIAERCLNKDAAQ 272  

                   Rptaeellehpflkgldlplllllllllplllellslllsnlkellleel
                   Rpta+e l                                          
  AAZ54538.1   273 RPTAAETLM----------------------------------------- 281  

                   lsllplldllglllllllellldryellkllGeGgfGvVylardlktgrlvA
                       +   + +l+ + +  +++y+ll++lG+Gg GvVyl+    +g +vA
  AAZ54538.1    17    GPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVA 62   

                   vKvlkkell.seellerflrEikilkklnhpnivklldvfededslgslg
                   vK l+++ l+ ++l+e++  E+++ +++      ++l + +d       +
  AAZ54538.1    63 VKTLHRDALdLPGLREQLAEEVEMARRVARFCTAQVLAADLDA------D 106  

                   elylvmEyl.ggdLldllkk.gplseeealkialqillgLaylHslgiiH
                     y+v Ey++g +L+ ++++ gpl    + ++a++ l +La +H++gi+H
  AAZ54538.1   107 PPYVVSEYVeGPSLQAVVRErGPLRGASLERLAVGTLTALAAIHQAGIVH 156  

                   RDlKpeNiLldedgvvklaDFGlArllddt...lttvvgTpgYmAPEvll
                   RD Kp+N+L+   g ++++DFG+Ar l++t++ +++++gTp+YmAPE++ 
  AAZ54538.1   157 RDFKPANVLM-APGGPRVIDFGIARALEGTailTSRIAGTPAYMAPEQIT 205  

                   glkgydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppee
                   g ++ +++vD+++ G +l + + gr pf + s+  +++++++ ++ +   
  AAZ54538.1   206 G-GPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDF--- 251  

                   lllllllllllllllllllvdpllllllppllspelldlllkllqkdpek
                                                 +ls  l+++++++l+kd ++
  AAZ54538.1   252 -----------------------------GELSGTLREIAERCLNKDAAQ 272  

                   Rptaeellehpflkgllllllllllppllllllllllllslllllllsel
                   Rpta+e l                                          
  AAZ54538.1   273 RPTAAETLM----------------------------------------- 281  

                   lsllpllsssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvK
                      +   + + +++    +++y+ll++lG+Gg GvVyl+   +g +vAvK
  AAZ54538.1    18    PMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVK 64   

                   vlkk....seelleeflrEieilkrlrhpnivrllgvc.eddelylvmEy
                   +l++++ + + l+e++  E+e+ +r+      ++l +  + d++y+v Ey
  AAZ54538.1    65 TLHRdaldLPGLREQLAEEVEMARRVARFCTAQVLAADlDADPPYVVSEY 114  

                   meggsLldllrkrrggplseelllrialqiargLayLhslgiiHrDlKps
                   +eg sL+ ++r+r  gpl  + l r+a++++ +La +h+ gi+HrD Kp+
  AAZ54538.1   115 VEGPSLQAVVRER--GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPA 162  

                   NiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllggkyt
                   N+L+  +g ++++DFG+ar l+ + + l+++++gtp+YmAPE++ gg+++
  AAZ54538.1   163 NVLMAPGG-PRVIDFGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLG 210  

                   tksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspe
                   +++D++++G +l++ +  gr pf + sl  +++++++ +  p + +ls  
  AAZ54538.1   211 PAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGT 257  

                   lldlilkclakdpekRptasevlehlfflllllellllllllpddellllsllelellldryellkllGeGgfGvVylardlltgrlvAv
                      +   + + + + + ++++y+ll++lG+Gg GvVyl+   ++g +vAv
  AAZ54538.1    18    PMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAV 63   

                   Kvlkke........erflrEieilkrlsnhpnivrllgvfedlldgegel
                   K+l++++ +     e++  E+e+ +r+       ++l + +d     +++
  AAZ54538.1    64 KTLHRDaldlpglrEQLAEEVEMARRV-ARFCTAQVLAADLD----ADPP 108  

                   ylvmEyveggsLfdllkkrgglplseeealrialqilsaLeyLHslgiiH
                   y+v Eyveg sL+ ++++rg  pl  + + r+a++ l aL+ +H+ gi+H
  AAZ54538.1   109 YVVSEYVEGPSLQAVVRERG--PLRGASLERLAVGTLTALAAIHQAGIVH 156  

                   RDlKpeNiLldsldsdgvvklaDFGlarllsdg.tllttvvgtpgYmAPE
                   RD Kp+N+L+      g ++++DFG+ar l+ ++ l++ ++gtp+YmAPE
  AAZ54538.1   157 RDFKPANVLMA----PGGPRVIDFGIARALEGTaILTSRIAGTPAYMAPE 202  

                   vllgkpytpksDvWSlGvvlyelltgrppfpglsplelllkilkglgtpd
                   ++ g+p++p++D++++G +l + + gr pf + s+ ++++++++      
  AAZ54538.1   203 QITGGPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND----- 247  

                   lllrlplppglspelkdlilkclakdpekRptaeellehpflkgllllll
                        p + +ls  l++++++cl+kd ++Rpta+e l    + g+  +++
  AAZ54538.1   248 ----EPDFGELSGTLREIAERCLNKDAAQRPTAAETLM--LVLGIEGPPP 291  

                   llllllppllplllsllllslllllllssllslsslslsllsssssssls
                     ++ +   +p+++++l+   + +  + ++ s   l+ s+++++++++++
  AAZ54538.1   292 TEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSN 341  

                   spldllgllsllllellldryellkllGeGgfGvVylardlktgrlvAi
                      +   + + +++ +  +++y+ll++lG+Gg GvVyl+    +g +vA+
  AAZ54538.1    18    PMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAV 63   

                   Kvlkksll.dekllerflrEikilkklnhpnivklldvfededslgllgh
                   K l+++ l+ ++l+e++  E+++ +++      ++l + +d       + 
  AAZ54538.1    64 KTLHRDALdLPGLREQLAEEVEMARRVARFCTAQVLAADLDA------DP 107  

                   lylvmEyl.ggdLfdllk..gplseeealkialqillgLaylHslgiiHR
                   +y+v Ey++g +L+ ++++ gpl  + + ++a++ l +La +H++gi+HR
  AAZ54538.1   108 PYVVSEYVeGPSLQAVVRerGPLRGASLERLAVGTLTALAAIHQAGIVHR 157  

                   DlKPeNiLldsdgvvklaDFGlArllsdd.tllttvvgTpgYmAPEvllg
                   D KP+N+L+ + g ++++DFG+Ar l++++ l+++++gTp+YmAPE++ g
  AAZ54538.1   158 DFKPANVLM-APGGPRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITG 206  

                   kpydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppeell
                   +p +++vD+++ G +l + + gr pf + s  ++++++++          
  AAZ54538.1   207 GPLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND--------- 247  

                   lsllllllllllllllllllllllllllldlllllelppllspelldlll
                                                      + + +ls  l+++++
  AAZ54538.1   248 ----------------------------------EPDFGELSGTLREIAE 263  

                   kllqkdpekRptaeellehpflkgllllllllllllllllllllllllls
                   ++l+kd ++Rpta+e l                                 
  AAZ54538.1   264 RCLNKDAAQRPTAAETLM-------------------------------- 281  

                   slllellleelllssllllsllelllatddyellellGeGgfGvVylavlkltgrlvAvK
                      +  + + +++    +++y+ll++lG+Gg GvVyl+   ++g  vAvK
  AAZ54538.1    19    MADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVK 64   

                   vlkk....seelleeflrEieilkrlrhpnivkllgvcldedelylvmEy
                   +l++++ + + l+e++  E+e+ +r+      ++l + ld d+ y+v Ey
  AAZ54538.1    65 TLHRdaldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEY 114  

                   mpggsLldllrkrkggplseelllrialqiasglayLhslgiiHrDlKpe
                   ++g sL+ ++r+r  gpl  + l r+a++++ +la +h+ gi+HrD Kp+
  AAZ54538.1   115 VEGPSLQAVVRER--GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPA 162  

                   NiLldedgvvklaDFGlarlllsgellllttvvgtpgYmAPEvllggkys
                   N+L+  +g ++++DFG+ar l+ + + l+++++gtp+YmAPE+++gg+++
  AAZ54538.1   163 NVLMAPGG-PRVIDFGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLG 210  

                   tksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspe
                   +++D++++G +l + +  gr pf + sl  +++++++ +  p + +ls  
  AAZ54538.1   211 PAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGT 257  

                   lldlilkclqldpekRptasevlehlffldldMsvlt..idelfellggyeivellgggsfnkvylvtl.dggkvvlKv
                      M+     id   + +g+y ++ +lg+g  + vyl+++ dg +v++K 
  AAZ54538.1    19    MADPAplIDTDPARIGEYTLLGRLGQGGQGVVYLGSApDGARVAVKT 65   

                   lrpg...vseeaedlerEarilerlakgvpvPkvlgfgegdgypylvmey
                   l++++ ++ + +e+l +E+++ +r+a+   + +vl+++ + ++py v ey
  AAZ54538.1    66 LHRDaldLPGLREQLAEEVEMARRVARFCTA-QVLAADLDADPPYVVSEY 114  

                   leGgtladll.....lseellkellrqlaealaklHsidlsdlpfagsle
                   +eG +l ++  +   l+  +l++l+   ++ala++H++            
  AAZ54538.1   115 VEGPSLQAVVrergpLRGASLERLAVGTLTALAAIHQA------------ 152  

                   lslaellalleellvdlalsdllklllldlleelldlleallpdlplvli
                                                                  +++
  AAZ54538.1   153 -----------------------------------------------GIV 155  

                   HgDlhpgNilvddgkvsgliDfglag............lgdpayDlafll
                   H+D++p N+l+ +g+   +iDfg a++ + +++ +  + g p        
  AAZ54538.1   156 HRDFKPANVLMAPGGP-RVIDFGIARalegtailtsriAGTP-------- 196  

                   rslafdyldpelaeeflegygidvdldrlslyalllelfssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvKv
                      +  + + +++    +++y+ll++lG+Gg GvVyl+   +g +vAvK+
  AAZ54538.1    19    MADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKT 65   

                   lkk....seelleeflrEieilkrlrhpnivkllgvf.eedelylvmEym
                   l++++ + + l+e++  E+e+ +r+      ++l +  + d++y+v Ey+
  AAZ54538.1    66 LHRdaldLPGLREQLAEEVEMARRVARFCTAQVLAADlDADPPYVVSEYV 115  

                   eggsLldllrkrkggplseelllrialqiargLayLhslgiiHrDlKpeN
                   eg sL+ ++r+r  gpl  + l r+a++++ +La +h+ gi+HrD Kp+N
  AAZ54538.1   116 EGPSLQAVVRER--GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPAN 163  

                   iLldedgvvklaDFGlarllssdellllttvvgtpgYmAPEvllggkytt
                   +L+  +g ++++DFG+ar l+ + + l+++++gtp+YmAPE+++gg++++
  AAZ54538.1   164 VLMAPGG-PRVIDFGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLGP 211  

                   ksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspel
                   ++D++++G +l + +  gr pf + sl  +++++++ +  p + +ls  l
  AAZ54538.1   212 AVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTL 258  

                   ldlilkclakdpekRptasevlehlfllllllellllplpdslrlfsllelelltdryellkllGeGgfGvVylardkktgrlvAvK
                         + + +++ +  +++y+ll++lG+Gg GvVyl+   ++g +vAvK
  AAZ54538.1    19    MADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVK 64   

                   vlkkell.dekllerflrEieilkrlnhpnivrllgvfededslglllel
                   +l+++ l+ ++l+e++  E+e+ +r+      ++l + +d d       +
  AAZ54538.1    65 TLHRDALdLPGLREQLAEEVEMARRVARFCTAQVLAADLDAD------PP 108  

                   ylvmEym.ggsLldll..kgplseeevlkialqilsgLayLHslgiiHRD
                   y+v Ey++g sL  ++ ++gpl  + + ++a++ l +La +H+ gi+HRD
  AAZ54538.1   109 YVVSEYVeGPSLQAVVreRGPLRGASLERLAVGTLTALAAIHQAGIVHRD 158  

                   lKpeNiLldsdgvvklaDFGlarllsdg.tllttvvgTpgYmAPEvllgg
                    Kp+N+L+ + g ++++DFG+ar l+ ++ l+++++gTp YmAPE++ gg
  AAZ54538.1   159 FKPANVLM-APGGPRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITGG 207  

                   pystksDvWSlGvvlyelltgrppfpgeselelllkilkglgtpplelll
                   p+++++D++++G +l + + gr pf + s   +++++++           
  AAZ54538.1   208 PLGPAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND---------- 247  

                   lllllllllllllllllllllglllllldlllllplppelspelldlllk
                                                     p + els  l++++++
  AAZ54538.1   248 ---------------------------------EPDFGELSGTLREIAER 264  

                   clqkdpekRptaeellehpflkgllllllllllppllplllsllllslls
                   cl+kd ++Rpta+e l                                  
  AAZ54538.1   265 CLNKDAAQRPTAAETLM--------------------------------- 281  

                   sllslllsslsdpglklfsleelelatddyellkllGeGgfGtVykarlkltgellellv
                        + + +++    +++y+ll++lG+Gg G+Vy++   ++g +    v
  AAZ54538.1    20    ADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGAR----V 61   

                   AvKvlkkel..seelleeflrEieilkrlrhpnivrllgvfldgd.lylv
                   AvK+l++++ + + l+e++  E+e+ +r+      ++l + ld d  y+v
  AAZ54538.1    62 AVKTLHRDAldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADpPYVV 111  

                   mEympggsLldllrkrkgplseelalrialqiargLayLhskgiiHrDlK
                    Ey++g sL+ ++r+r gpl  + + r+a++++ +La +h+ gi+HrD K
  AAZ54538.1   112 SEYVEGPSLQAVVRER-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFK 160  

                   peNiLldedgvvklaDFGlarllssgettlllttvvgtpgYmAPEvllgg
                   p+N+L+ + g ++++DFG+ar l+ +    l+++++gtp+YmAPE++ gg
  AAZ54538.1   161 PANVLM-APGGPRVIDFGIARALEGTAI--LTSRIAGTPAYMAPEQITGG 207  

                   kyteksDvwSlGvvlyelltlgrppfdglsplellekilkglrlplpedl
                   ++++++D++++G +l + +  gr pf + s+  +++++++ +  p   +l
  AAZ54538.1   208 PLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGEL 254  

                   spelldlilkclqkdpekRptasellehlfflllllllllllllllllll
                   s  l++++++cl+kd+++Rpta+e l     +  ++++ ++ + + +++ 
  AAZ54538.1   255 SGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDTAIPVT 304  

                   lllllllllsllllllllllllsllllsllellllfsleelllalddyellkllGeGgfGvVylardlltgrlvAvKv
                        +   +++    +++y+ll++lG+Gg GvVyl+   ++g  vAvK+
  AAZ54538.1    20    ADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKT 65   

                   lkkslllseellerflrEieilsrlnhpnivkllgvfedegelylvmEyv
                   l+++ l  ++l+e++  E+e+ +r+      ++l + +d +  y+v Eyv
  AAZ54538.1    66 LHRDALDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYV 115  

                   eggsLldllkkrgplseeealkialqillgLaylhslgiiHRDlKpeNiL
                   eg sL+ ++++rgpl  + + ++a+++l +La +h+ gi+HRD Kp+N+L
  AAZ54538.1   116 EGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVL 165  

                   ldedgvvklaDFGlarllssd....ttvvgtpgYmAPEvllllgggkyde
                   + + g ++++DFG+ar l+ +++ +++++gtp+YmAPE++    gg++++
  AAZ54538.1   166 M-APGGPRVIDFGIARALEGTailtSRIAGTPAYMAPEQIT---GGPLGP 211  

                   ksDvwSlGvvlyelltgrppfdglsllellllilkgllrpllppllspel
                   ++D++++G++l + + gr pf + sl ++++++++ ++    +  ls  l
  AAZ54538.1   212 AVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPD---FGELSGTL 258  

                   kdlilkclqkdpekRpsaeellehlfflllllllllllllllllllllll
                   ++++++cl+kd ++Rp+a+e l     ++ ++++ ++ + + +++ +++l
  AAZ54538.1   259 REIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDTAIPVTHQTL 308  

                   lllllsllsllllllplklfsleelelatddyellellGeGgfGvVylarlklllgsltgrlv
                       + + +++    +++y+ll++lG+Gg GvVyl+         +g +v
  AAZ54538.1    21    DPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAP------DGARV 61   

                   AvKvlkksl..seelleeflrEveilkrlrhpnivrllgvcldgdelylv
                   AvK+l++++ + + l+e++  Eve+ +r+      ++l + ld d++y+v
  AAZ54538.1    62 AVKTLHRDAldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVV 111  

                   mEymeggsLldllrkrgllllllslglplseelllrialqiargLayLhs
                    Ey+eg sL+ ++r+rg          pl  + l r+a++++ +La +h+
  AAZ54538.1   112 SEYVEGPSLQAVVRERG----------PLRGASLERLAVGTLTALAAIHQ 151  

                   kgiiHrDLKpeNiLldedgvvklaDFGlarllssgeltlllttvvgtpgY
                    gi+HrD Kp+N+L+   g ++++DFG+ar l+ +    l+++++gtp+Y
  AAZ54538.1   152 AGIVHRDFKPANVLMAPGG-PRVIDFGIARALEGTAI--LTSRIAGTPAY 198  

                   mAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsplellelilkg
                   mAPE++ gg++++++D++++G +l + +  gr pf + s+  +++++++ 
  AAZ54538.1   199 MAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVIND 247  

                   lrlplpellspelldlilkclqkdpekRptasevlehlfflllllellll
                   +  p + +ls  l++++++cl+kd+++Rpta+e l     ++ ++++ ++
  AAZ54538.1   248 E--PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEP 295  

                   llllplleklfslselelatddyellellGeGgfGvVylarlkllsllllstgrl
                      + + +++    +++y+ll++lG+Gg GvVyl+          ++g +
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA--------PDGAR 60   

                   vAvKvlkksl..seellkeflrEieilsklsrhpnivrllgvcleddely
                   vAvK+l++++ + ++l++++  E+e+ +++       ++l + l+ d+ y
  AAZ54538.1    61 VAVKTLHRDAldLPGLREQLAEEVEMARRV-ARFCTAQVLAADLDADPPY 109  

                   lvmEymeggsLldllrkrgllllllllllllslglplseelllkialqia
                   +v Ey+eg sL+ ++r+rg                pl  + l ++a++ +
  AAZ54538.1   110 VVSEYVEGPSLQAVVRERG----------------PLRGASLERLAVGTL 143  

                   rgLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgestlllt
                    +La +h+ gi+HrD Kp+N+L+   g ++++DFG+ar l+ +    l++
  AAZ54538.1   144 TALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI--LTS 190  

                   tvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsple
                   +++gtp+YmAPE++ gg++++++D+++ G +l + +  gr pf + s+  
  AAZ54538.1   191 RIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKA 239  

                   llllilkglrlplpellspelldlilkclqkdpekRptasevlehlffle
                   +++++++ +  p + +ls  l++++++cl+kd+++Rpta+e l     +e
  AAZ54538.1   240 VVQRVINDE--PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIE 287  

                   ldleglfsllelelltdryellkklGeGgfGtVylardlltgrlvAvKvlk
                      + + +++ +  +++y+ll++lG+Gg G+Vyl+   ++g +vAvK l+
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLH 67   

                   k....sekllerflrEieilkrlseldlslllllghpnivrllgvfeegd
                   +++ + ++l+e++  E+e+ +r+              +  ++l + ++ d
  AAZ54538.1    68 RdaldLPGLREQLAEEVEMARRVA-----------RFCTAQVLAADLDAD 106  

                   snglhlylvmEyl.ggsLfdllkklkggplseeevlrialqilraLeyLH
                         y+v Ey++g sL+ ++++  +gpl  + + r+a++ l aL+ +H
  AAZ54538.1   107 ----PPYVVSEYVeGPSLQAVVRE--RGPLRGASLERLAVGTLTALAAIH 150  

                   sklgiiHrDlKPeNiLldlldslledgvvklaDFGlarllddt...lttv
                   +  gi+HrD KP+N+L+         g ++++DFG+ar l+ t++ ++++
  AAZ54538.1   151 QA-GIVHRDFKPANVLM-------APGGPRVIDFGIARALEGTailTSRI 192  

                   vgtpgYmAPEvllggpyspksDvWSlGvilyelltgrppfdglsasdlll
                   +gtp+YmAPE++ ggp++p++D++++G +l + + gr pf + s      
  AAZ54538.1   193 AGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAANGRGPFGHGS------ 236  

                   eldqlalilellgtpplellllllllrlllllllllllllglllelldki
                                                             l ++++++
  AAZ54538.1   237 ------------------------------------------LKAVVQRV 244  

                   lngrlplppdlspelldlllkclqkdpekRptaeellehpflkglllpll
                   +n+++++  +ls  l++++++cl+kd ++Rpta+e l    + g+  p++
  AAZ54538.1   245 INDEPDF-GELSGTLREIAERCLNKDAAQRPTAAETLM--LVLGIEGPPP 291  

                   lpppplplllslldlsllsssldklfsleelelatddyellellGeGgfGvVykarlklllgsstgrlvA
                      + + +++    +++y+ll++lG+Gg GvVy++        ++g  vA
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA------PDGARVA 62   

                   vKvlkksl..seellkeflrEieilsrlrhpnivrllgvcleggelylvm
                   vK+l++++ + ++l++++  E+e+ +r+      ++l + l+ +++y+v 
  AAZ54538.1    63 VKTLHRDAldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVS 112  

                   EympggsLldllrkrgllllllllllllllllllllllllplseelrlki
                   Ey++g sL+ ++r+rg                        pl  + + ++
  AAZ54538.1   113 EYVEGPSLQAVVRERG------------------------PLRGASLERL 138  

                   alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssges
                   a++++ +La +h+ gi+HrD Kp+N+L+   g ++++DFG+ar l+ +  
  AAZ54538.1   139 AVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PRVIDFGIARALEGTAI 187  

                   llllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpg
                     l+++++gtp+YmAPE++ gg++++++D++++G +l + +  gr pf +
  AAZ54538.1   188 --LTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGH 234  

                   lsplellllilkglrlplpedlspelldlilrclakdpekRptasevleh
                    s   +++++++ +  p   +ls  l++++ rcl+kd+++Rpta+e l  
  AAZ54538.1   235 GSLKAVVQRVINDE--PDFGELSGTLREIAERCLNKDAAQRPTAAETLML 282  

                   lfflelklfslselllatddyellellGeGgfGvVylavlktgrlvAvKvlkk
                      + + +++    +++y+ll++lG+Gg GvVyl+   +g  vAvK+l++
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHR 68   

                   ....seelleeflrEieilkrlrhpnivrllgvc.eddelylvmEymegg
                   ++ + + l+e++  E+e+ +r+      ++l +  + d++y+v Ey+eg 
  AAZ54538.1    69 daldLPGLREQLAEEVEMARRVARFCTAQVLAADlDADPPYVVSEYVEGP 118  

                   sLldllrkrgglplseelllrialqiargLayLhslgiiHrDlKpeNiLl
                   sL+ ++r+rg  pl  + l r+a++++ +La +h+ gi+HrD Kp+N+L+
  AAZ54538.1   119 SLQAVVRERG--PLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM 166  

                   dedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllggkyttksD
                     +g ++++DFG+ar l+ + + l+++++gtp+YmAPE++ gg++++++D
  AAZ54538.1   167 APGG-PRVIDFGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLGPAVD 214  

                   vwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldl
                   ++++G +l++ +  gr pf + sl  +++++++ +  p + +ls  l+++
  AAZ54538.1   215 MFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREI 261  

                   ilkclaldpekRptasevlehlflllldleklfsleelelatddyellellGeGgfGvVykarllllldlltgrlvA
                      + + +++    +++y+ll++lG+Gg GvVy++        ++g +vA
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGS------APDGARVA 62   

                   vKvlkksl..seellkeflrEieilsrlsrhpnivrllgvcleglgelyl
                   vK+l++++ + ++l++++  E+e+ +r+       ++l + l+  ++ y+
  AAZ54538.1    63 VKTLHRDAldLPGLREQLAEEVEMARRV-ARFCTAQVLAADLDA-DPPYV 110  

                   vmEymeggsLldllrkrgllllllllllllllllplseelllkialqiar
                   v Ey+eg sL+ ++r+rg                pl  + l ++a++ + 
  AAZ54538.1   111 VSEYVEGPSLQAVVRERG----------------PLRGASLERLAVGTLT 144  

                   gLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgeltllltt
                   +La +h+ gi+HrD Kp+N+L+   g ++++DFG+ar l+ +    l+++
  AAZ54538.1   145 ALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI--LTSR 191  

                   vvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsllel
                   ++gtp YmAPE++ gg++++++D+++ G +l + +  gr pf + sl  +
  AAZ54538.1   192 IAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAV 240  

                   lllilkgllrpplppllspelldlilkclqkdpekRptasevlehlffle
                   ++++++ +   p + +ls  l++++++cl+kd ++Rpta+e l     +e
  AAZ54538.1   241 VQRVINDE---PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIE 287  

                   ldleelpllseleillddyellkllGeGgfgtVylardkglldllsktgel
                        pl++     +++y+ll++lG+Gg g+Vyl+          ++g +
  AAZ54538.1    22    PAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSA--------PDGAR 60   

                   vavKvlkksl..seellerflrEieilkrlsnhpnivkllgvfededely
                   vavK+l++++ + + l+e++  E+e+ +r+    +  ++l++ +d d++y
  AAZ54538.1    61 VAVKTLHRDAldLPGLREQLAEEVEMARRV-ARFCTAQVLAADLDADPPY 109  

                   lvmeyleggsLldllkkrgklllllllllllllllvlseeevlkialqil
                   +v ey+eg sL+ ++++rg+                l  + + ++a++ l
  AAZ54538.1   110 VVSEYVEGPSLQAVVRERGP----------------LRGASLERLAVGTL 143  

                   saLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllsddeltlllt
                    aL+ +H+ gi+HrD Kp+N+l+   g +++iDFG+ar l+ +    l++
  AAZ54538.1   144 TALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI--LTS 190  

                   tlvgtpgYmaPEvllggpyspksDvwslGvilyelltlgklpfdglsple
                   +++gtp+YmaPE++ ggp++p++D++++G +l + +  g+ pf + s + 
  AAZ54538.1   191 RIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKA 239  

                   llekilkglrlplpedlspelkdlilkclqkdpekRpsaeellehlfkll
                   +++++++    p + +ls  l++++++cl+kd ++Rp+a+e l + + + 
  AAZ54538.1   240 VVQRVIN--DEPDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIE 287  

                   dlsellaellpllggllvlevlgggssnrvyrvttddggdyvlKvappg.
                       l+++ ++  g++++l +lg+g+ + vy+  ++dg ++++K +++++
  AAZ54538.1    24    PLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRDa 70   

                   .....aaedlerEarllraLaeagvpvPrvlavgedggrpwlvmeylpGe
                    +    +e+l++E+++ r++a+     ++vla++ d++ p+ v ey++G 
  AAZ54538.1    71 ldlpgLREQLAEEVEMARRVARFCT--AQVLAADLDADPPYVVSEYVEGP 118  

                   tladlll........dpaalaralaealarLHaldpadcpflgrlvtyle
                   +l++++++      ++ ++la   + ala++H+++               
  AAZ54538.1   119 SLQAVVRergplrgaSLERLAVGTLTALAAIHQAG--------------- 153  

                   rllarleallaalddlleedllalleellelllallpdslplvlvHgDlh
                                                              +vH+D++
  AAZ54538.1   154 -------------------------------------------IVHRDFK 160  

                   pgNilvddgrvvgliDfglagvgdpayDLalllrdlshplaee...llar
                   p N+l+ +g+++ +iDfg+a+                    e++++l  r
  AAZ54538.1   161 PANVLMAPGGPR-VIDFGIAR------------------ALEGtaiLTSR 191  

                   ylaaygllapdl.......arldlyallvalrfsleelllalddyellellGeGgfGvVylardlktgrlvAvKvlkks
                        +++ +  +++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++
  AAZ54538.1    24    PLIDTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRD 69   

                   l..degllerflrEieilarlnhpnivklygvfedegelylvmEyleggs
                     + +gl+e++  E+e+ +r+      +++ + +d + +y+v Ey+eg s
  AAZ54538.1    70 AldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPS 119  

                   LldllkkrgplseeealkialqilrgLaylHsklgiiHrDlKPeNiLlde
                   L+ ++++rgpl  + + ++a+++l +La +H+  gi+HrD KP+N+L+ +
  AAZ54538.1   120 LQAVVRERGPLRGASLERLAVGTLTALAAIHQA-GIVHRDFKPANVLM-A 167  

                   dgvvklaDFGlarllddd..llttvvgTpgYmAPEvllggpydtksDvwS
                    g ++++DFG+ar l+++++l+++++gTp+YmAPE++ ggp+++++D+++
  AAZ54538.1   168 PGGPRVIDFGIARALEGTaiLTSRIAGTPAYMAPEQITGGPLGPAVDMFA 217  

                   lGvvlyelltgrppfpgesllelllkilkglgtpseellplllsllllll
                   +G++l + + gr pf + sl ++++++++                     
  AAZ54538.1   218 WGATLVYAANGRGPFGHGSLKAVVQRVIND-------------------- 247  

                   llllllllllvllllleglllelldpplllplppelspelldlilkclqk
                                                 p + els  l++++++cl+k
  AAZ54538.1   248 -----------------------------EPDFGELSGTLREIAERCLNK 268  

                   dpekRpsaeellehlfflllllpllllllllllllllldspllslsegellgdyel..llgeGgfgtVylardlktgelvavKvlkks
                      +l  +++ ++g+y+l  +lg+Gg g+Vyl+   ++g +vavK+l+++
  AAZ54538.1    24    PLIDTDPARIGEYTLlgRLGQGGQGVVYLGS-APDGARVAVKTLHRD 69   

                   ll.seellerflrEieilkklnhpnivkllgvflllledgdelylvmeyl
                   +l+ + l+e++  E+e+ +++   +  ++l + l    d d +y+v ey+
  AAZ54538.1    70 ALdLPGLREQLAEEVEMARRVARFCTAQVLAADL----DADPPYVVSEYV 115  

                   eggsLldllkkrgplseeeilkialqilsaleyLHslgppiiHrDlkpeN
                   eg sL+ ++++rgpl    + ++a++ l al+ +H++g  i+HrD kp+N
  AAZ54538.1   116 EGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAG--IVHRDFKPAN 163  

                   illdedlgvvkliDfGlarllsdd..llttlvgtpgYmaPEvllg.pysp
                   +l+ +  g +++iDfG+ar l+ +++l+++++gtp+YmaPE++ g p++p
  AAZ54538.1   164 VLMAP--GGPRVIDFGIARALEGTaiLTSRIAGTPAYMAPEQITGgPLGP 211  

                   ksDvwslGvilyelltgklpfdglldldellekilelglplplpellspe
                   ++D++++G +l + + g+ pf +  +l+ +++++++  ++   +  ls  
  AAZ54538.1   212 AVDMFAWGATLVYAANGRGPFGH-GSLKAVVQRVINDEPD---FGELSGT 257  

                   lkdlilkclqldpekRpsaeellehpflksleelelatddyellellGeGgfGvVykarlkdtgssrlvAvKvlkk
                       +++    +++y+ll +lG+Gg GvVy++   d+     vAvK+l++
  AAZ54538.1    25    LIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDG---ARVAVKTLHR 68   

                   sl..seelleeflrEieilsrlsrhpnivkllgvcldegelylvmEympg
                   ++ + + l+e++  E+e+ +r+       ++l + ld ++ y+v Ey++g
  AAZ54538.1    69 DAldLPGLREQLAEEVEMARRV-ARFCTAQVLAADLDADPPYVVSEYVEG 117  

                   gsLldllrkrgllllllllllllslglplseelrlkialqiargLayLhs
                    sL+ ++r+rg                pl  + + ++a++++ +La +h+
  AAZ54538.1   118 PSLQAVVRERG----------------PLRGASLERLAVGTLTALAAIHQ 151  

                   kgiiHrDlKpeNiLldedgvvklaDFGlarllssddll.ttvvgtpgYmA
                    gi+HrD Kp+N+L+ + g ++++DFG+ar l+ +  l+++++gtp+YmA
  AAZ54538.1   152 AGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAILtSRIAGTPAYMA 200  

                   PEvllggkyteksDvwSlGvvlyelltlgrppfdglsplellelilkglr
                   PE++ gg++++++D++++G +l   +  gr pf + s+  +++++++ + 
  AAZ54538.1   201 PEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE- 248  

                   lplpedlspelldlilkclqkdpekRptasevlehlfflllllellllll
                    p + +ls  l++++++cl+kd+++Rpta+e l     +  ++++ ++  
  AAZ54538.1   249 -PDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPST 297  

                   llllllllllslldeslselllllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkel
                       +++ + ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++ 
  AAZ54538.1    25    LIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDA 70   

                   llsekllerflrEieilkrlnhpnivkllgvfldddelylvmEyveggsL
                   l  ++l+e++  E+e+ +r+      ++l + ld d  y+v Eyveg sL
  AAZ54538.1    71 LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSL 120  

                   ldllkkrgplseelalrialqilsaLeylhslgiiHrDlKpeNiLldedg
                   + ++++rgpl  + + r+a++ l aL+ +h+ gi+HrD Kp+N+L+   g
  AAZ54538.1   121 QAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG 170  

                   vvklaDFGlarllsdgelllllttvvgtpgYmAPEvllggkyspksDvwS
                    ++++DFG+ar l+ +    l+++++gtp+YmAPE+++gg+++p++D+++
  AAZ54538.1   171 -PRVIDFGIARALEGTAI--LTSRIAGTPAYMAPEQITGGPLGPAVDMFA 217  

                   lGvvlyelltgrppfdglsllellllilkgllplpeelspelldlilkcl
                   +G +l++ + gr pf + sl  +++++++ ++++  els  l++++++cl
  AAZ54538.1   218 WGATLVYAANGRGPFGHGSLKAVVQRVINDEPDF-GELSGTLREIAERCL 266  

                   akdpekRptaeellkhlfflllllpllllllllllllllldsslselelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkksl
                       +++ +  +++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++ 
  AAZ54538.1    25    LIDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDA 70   

                   ldlllsekllerflrEieilkrlnhpnivkllgvfedddelylvmEyveg
                   l   + + l+e++  E+e+ +r+      ++l + +d d  y+v Eyveg
  AAZ54538.1    71 L---DLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEG 117  

                   gsLldllkkrgplseeeallialqilsaLaylhslgiiHrDlKpeNiLld
                    sL  ++++rgpl  + + ++a++ l aLa +h+ gi+HrD Kp+N+L+ 
  AAZ54538.1   118 PSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMA 167  

                   sdglsllvvklaDFGlarllssd.tllttvvgtpgYmAPEvllggpyspk
                   ++g     ++++DFG+ar l+ ++ l+++++gtp+YmAPE+++ggp++p+
  AAZ54538.1   168 PGG-----PRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITGGPLGPA 212  

                   sDvwSlGvvlyelltgrppfpglsllellllilkglllpllelppllspe
                   +D++++G +l++ + gr pf + sl  +++++++ ++      + +ls  
  AAZ54538.1   213 VDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEP-----DFGELSGT 257  

                   lldlilkclakdpekRpsaeellehlfflllllpllllllllllllpleelelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkss.
                      +++ + ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++  
  AAZ54538.1    26    IDTDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDAl 71   

                   .degllerflrEieilkrlnhpnivkllgvfeddgelylvmEyveggsLl
                   + +gl+e++  E+e+ +r+      ++l + +d +  y+v Eyveg sL+
  AAZ54538.1    72 dLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQ 121  

                   dllkkrgplseeealrialqilsaLaylhslgiiHrDlKpeNiLllslde
                    ++++rgpl  + + r+a+++l aLa +h+ gi+HrD Kp+N+L   + +
  AAZ54538.1   122 AVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVL---MAP 168  

                   dgvvklaDFGlarlldsd.tllttvvgtpgYmAPEvllggpyspksDvwS
                    g ++++DFG+ar l+ ++ l+++++gtp+YmAPE+++ggp++p++D+++
  AAZ54538.1   169 GG-PRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITGGPLGPAVDMFA 217  

                   lGvvlyelltgrppfdglsllellllilkglllpllelppllspelldli
                   +G +l + + gr pf + sl  +++++++ ++ +      +ls  l++++
  AAZ54538.1   218 WGATLVYAANGRGPFGHGSLKAVVQRVINDEPDF-----GELSGTLREIA 262  

                   lkclqkdpekRptaeellehlffllllllllllllllllllllllllsll
                   ++cl+kd ++Rpta+e l     ++ ++++ ++ + + +++++++l+   
  AAZ54538.1   263 ERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGA 312  

                   sslllssllllspeelllatddyellellGeGgfGvVylavlkllsltgrlvAvKvlkke
                      ++ +  +++y+ll++lG+Gg GvVyl+      ++g +vAvK+l+++
  AAZ54538.1    27    DTDPARIGEYTLLGRLGQGGQGVVYLGSA----PDGARVAVKTLHRD 69   

                   lllseelleeflrEveilkklrhpnivrllgvfldgd.lylvmEymeggs
                    l  ++l+e++  Eve+ +++      ++l + ld d +y+v Ey+eg s
  AAZ54538.1    70 ALDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADpPYVVSEYVEGPS 119  

                   LldllrkrggplseelllrialqiasgLayLhslgiiHrDlKpeNiLlde
                   L+ ++r+r gpl  + l r+a++++ +La +h+ gi+HrD Kp+N+L+  
  AAZ54538.1   120 LQAVVRER-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAP 168  

                   dgvvklaDFGlarllsddlllllllttvvgtpgYmAPEvllggkystksD
                   +g ++++DFG+ar l+ +     l+++++gtp+YmAPE++ gg++++++D
  AAZ54538.1   169 GG-PRVIDFGIARALEGTAI---LTSRIAGTPAYMAPEQITGGPLGPAVD 214  

                   vwSlGvvlyelltlgrppfdglsllellllilkgllrlplppelspelld
                   ++++G +l++ +  gr pf + sl  +++++++ +   p + els  l++
  AAZ54538.1   215 MFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE---PDFGELSGTLRE 260  

                   lilkclakdpekRpsasevlehlfllgeelelatddyellellgeGgfgvVylavl..grlvAvKvlkksll.s
                      +     +++y+ll++lg+Gg gvVyl+   +g +vAvK+l++++l+ 
  AAZ54538.1    27    DTDPARIGEYTLLGRLGQGGQGVVYLGSApdGARVAVKTLHRDALdL 73   

                   eelleeflrEveilkrlrhpnivrllgvc.egdelylvmeymeggsLldl
                   ++l+e++  Eve+ +r+      ++l +  + d++y+v ey+eg sL+ +
  AAZ54538.1    74 PGLREQLAEEVEMARRVARFCTAQVLAADlDADPPYVVSEYVEGPSLQAV 123  

                   lrkrggplseelllrialqiargLayLhslgiiHrDlKpeNiLldedgvv
                   +r+r gpl  + l r+a++++ +La +h+ gi+HrD Kp+N+L+  +g +
  AAZ54538.1   124 VRER-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-P 171  

                   klaDFGlarllssslsllllttvvgtpgYmAPEvllgllggkyttksDvw
                   +++DFG+ar l+ +    l+++++gtp+YmAPE++    gg++++++D++
  AAZ54538.1   172 RVIDFGIARALEGTAI--LTSRIAGTPAYMAPEQIT---GGPLGPAVDMF 216  

                   SlGvvlyelltgrlpfdglsllellllilkglllpllllllppllspell
                   ++G +l + + gr pf + sl  +++++++ ++        + +ls  l+
  AAZ54538.1   217 AWGATLVYAANGRGPFGHGSLKAVVQRVINDEPD-------FGELSGTLR 259  

                   dlilkclakdpekRpsasevlehlflllldleeldseleialddyellkllGeGgfgtVylardkkllglltgrlvavKv
                        ++    +++y+ll++lG+Gg g+Vyl+         +g +vavK+
  AAZ54538.1    27    --DTDPARIGEYTLLGRLGQGGQGVVYLGSAP------DGARVAVKT 65   

                   lkks..lseellerflrEieilkklrhpnivkllgvfededelylvmeyl
                   l++++   + l+e++  E+e+ +++   +  ++l +  d d +y+v ey+
  AAZ54538.1    66 LHRDalDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYV 115  

                   eggsLldllkkrgrkglllllllllseeealrialqilsaLeyLHskgii
                   eg sL+ ++++rg+          l    + r+a++ l aL+ +H+ gi+
  AAZ54538.1   116 EGPSLQAVVRERGP----------LRGASLERLAVGTLTALAAIHQAGIV 155  

                   HrDlkpeNilldedgvvkliDFGlarllsdselllllttlvgtpgYmaPE
                   HrD kp+N+l+   g +++iDFG+ar l+ +  l+  ++++gtp+YmaPE
  AAZ54538.1   156 HRDFKPANVLM-APGGPRVIDFGIARALEGTAILT--SRIAGTPAYMAPE 202  

                   vllggpyspksDvwslGvvlyelltlgklpfdglsplellekilegllpp
                   ++ ggp++p++D++++G +l + +  g+ pf + s + +++++++ +  p
  AAZ54538.1   203 QITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--P 249  

                   lpedlspelkdlilkclqkdpekRpsaeellehLepllklllllldllll
                      +ls  l++++++cl+kd ++Rp+a+e l +                 
  AAZ54538.1   250 DFGELSGTLREIAERCLNKDAAQRPTAAETLML----------------- 282  

                   leslselellldryellkklGeGgfgtVylardkktgrlvAvKvlkksl..
                      ++ +  +++y+ll++lG+Gg g+Vyl+    +g +vAvK+l++++ +
  AAZ54538.1    27    DTDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDAld 72   

                   seellerflrEieilkrlnhpnivkllgvfededlnglgelylvmEyl.g
                    ++l+e++  E+e+ +r+   +  ++l +  d      + +y+v Ey++g
  AAZ54538.1    73 LPGLREQLAEEVEMARRVARFCTAQVLAADLDA-----DPPYVVSEYVeG 117  

                   gsLldllkk.gklseeealrialqilsgLeyLHskgiiHrDlKpeNilld
                    sL+ ++++ g+l  + + r+a++ l +L+ +H+ gi+HrD Kp+N+l+ 
  AAZ54538.1   118 PSLQAVVRErGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM- 166  

                   sdgvvklaDFGlarllsddeltltllttlvgtpgYmAPEvllglgpyspk
                     g ++++DFG+ar l+ +      ++ ++gtp+YmAPE++ g gp++p+
  AAZ54538.1   167 APGGPRVIDFGIARALEGTAIL---TSRIAGTPAYMAPEQITG-GPLGPA 212  

                   sDvwslGvilyelltgkppfpglsplellekilkllgtpslellllllsl
                   +D++++G +l + + g+ pf + s + +++++++                
  AAZ54538.1   213 VDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIN---------------- 246  

                   llldllkllrlldpglrlelppnlspelkdlilkclqkdpekRptaeell
                                   ++++  +ls  l+++ ++cl+kd ++Rpta+e l
  AAZ54538.1   247 ---------------DEPDF-GELSGTLREIAERCLNKDAAQRPTAAETL 280  

                   ehpflkglllpllelllppllplllslldlslldlklllleellslleel
                                                                     
  AAZ54538.1   281 M------------------------------------------------- 281  

                   llselllalddyellklllGeGgfgtVylardkktgelllvavKvlkks
                      +     +++y+ll++ lG+Gg g+Vyl+   ++g +  vavK+l+++
  AAZ54538.1    27    DTDPARIGEYTLLGR-LGQGGQGVVYLGSA-PDGAR--VAVKTLHRD 69   

                   ll..eellerflrEieilkklnhpnivkllgvf.dedelylvmeyleggs
                    l+ ++l+e++  E+e+ +++   +  ++l +  d d++y+v ey+eg s
  AAZ54538.1    70 ALdlPGLREQLAEEVEMARRVARFCTAQVLAADlDADPPYVVSEYVEGPS 119  

                   LldllkkrgkplseeevlrialqilsaLeyLHskgiiHrDlkpeNillde
                   L+ ++++rg+ l    + r+a++ l aL+ +H+ gi+HrD kp+N+l+  
  AAZ54538.1   120 LQAVVRERGP-LRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-A 167  

                   dgvvkliDFGlarllsdseltllllttlvgtpgYmaPEvllggpyspksD
                    g +++iDFG+ar l+ +      +++++gtp+YmaPE++ ggp++p++D
  AAZ54538.1   168 PGGPRVIDFGIARALEGTAIL---TSRIAGTPAYMAPEQITGGPLGPAVD 214  

                   vwslGvvlyelltlgklpfdglsllellekilkgllpplpedlspelkdl
                   ++++G +l + +  g+ pf + sl+ +++++++ +  p + +ls  l+++
  AAZ54538.1   215 MFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREI 261  

                   ilkclqldpekRpsaeelle.......pllalllslldllllllllllelelltddyellellGeGgfGvVylarlkdtsgrlvAvKvlkkell.
                      + +  +++y+ll++lG+Gg GvVyl+   d  g +vAvK+l+++ l+
  AAZ54538.1    28    TDPARIGEYTLLGRLGQGGQGVVYLGSAPD--GARVAVKTLHRDALd 72   

                   seellerflrEieilkrlselnhpnivrllgvflllllseggelylvmEy
                    ++l+e++  E+e+ +r+         ++l + l     + +  y+v Ey
  AAZ54538.1    73 LPGLREQLAEEVEMARRV---ARFCTAQVLAADL-----DADPPYVVSEY 114  

                   m.ggsLldllkkrklgplseelvlkialqilrgLayLhslgiiHrDlKpe
                   ++g sL  ++++r  gpl  + + ++a+++l +La +h+ gi+HrD Kp+
  AAZ54538.1   115 VeGPSLQAVVRER--GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPA 162  

                   NiLldedgvvklaDFGlarllssd.tllttvvgtpgYmAPEvllggkyst
                   N+L+ + g ++++DFG+ar l+ +++l+++++gtp YmAPE++ gg++++
  AAZ54538.1   163 NVLM-APGGPRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITGGPLGP 211  

                   ksDvWSlGvvlyelltgrppfdglselellllilkglgtpslelllllll
                   ++D++++G +l++ + gr pf + s   +++++++               
  AAZ54538.1   212 AVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIND-------------- 247  

                   llllllllldlllllplppllseelldlllkclqldpekRptaeevlehp
                                  p + +ls  l++++++cl++d ++Rpta+e l   
  AAZ54538.1   248 --------------EPDFGELSGTLREIAERCLNKDAAQRPTAAETLMLV 283  

                   fflelllplleelellldryellkllGeGgfGtVylardlltgrlvAvKvlkkd....
                        +  +++y+ll++lG+Gg G+Vyl+   ++g +vAvK+l++d+ + 
  AAZ54538.1    28    TDPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDaldl 73   

                   .kllerflrEieilkrlnhhpnivkllgvfleddylylvmeyl.ggsLld
                     l+e++  E+e+ +r+       ++l + l+ d  y+v ey++g sL+ 
  AAZ54538.1    74 pGLREQLAEEVEMARRVAR-FCTAQVLAADLDADPPYVVSEYVeGPSLQA 122  

                   llkkrggplseetvlrialqilsaLeylHskgiiHrDlKpeNilldllde
                   ++++r gpl  + + r+a+++l aL+ +H+ gi+HrD Kp+N+l+     
  AAZ54538.1   123 VVRER-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM----A 167  

                   dgvvklaDFGlarllldgettlllllrllttlvgtpgYmaPEvllggpys
                    g ++++DFG+ar l  +         l+++++gtp YmaPE++ ggp++
  AAZ54538.1   168 PGGPRVIDFGIARALEGTAI-------LTSRIAGTPAYMAPEQITGGPLG 210  

                   rksDvwSlGvvlyelltgrlpfpglselelllkilkglglllllllpllp
                   +++D++++G +l++ + gr pf + s   +++++++ +         + +
  AAZ54538.1   211 PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDE---------PDF 251  

                   pglspelldlllkclaldpekRpsaeellellehpffkllllllllllll
                    +ls  l++++++cl++d ++Rp+a+e    l  ++  + ++++ ++ + 
  AAZ54538.1   252 GELSGTLREIAERCLNKDAAQRPTAAET---LMLVLGIEGPPPTEEPSTD 298  

                   lllllpepelelatddyellellGeGgfGvVykavlkdtggllgrlvAvKvlkks
                        +  +++y+ll++lG+Gg GvVy++   d     g +vAvK+l+++
  AAZ54538.1    28    TDPARIGEYTLLGRLGQGGQGVVYLGSAPD-----GARVAVKTLHRD 69   

                   l..seellkeflrEieilsrlrhpnivrllgvcldddelylvmEymeggs
                   + + ++l++++  E+e+ +r+      ++l + ld d+ y+v Ey+eg s
  AAZ54538.1    70 AldLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPS 119  

                   LldllrkrkgplseelllrialqiargLayLhslgiiHrDlKpsNiLlde
                   L+ ++r+r gpl  + l r+a++++ +La +h+ gi+HrD Kp+N+L+  
  AAZ54538.1   120 LQAVVRER-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAP 168  

                   dgvvklaDFGlarllssdellllllttvvgtpgYmAPEvllggkyttksD
                   +g ++++DFG+ar l+ +     l+++++gtp+YmAPE++ gg++++++D
  AAZ54538.1   169 GG-PRVIDFGIARALEGTAI---LTSRIAGTPAYMAPEQITGGPLGPAVD 214  

                   vwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldl
                   ++++G +l + +  gr pf + sl  +++++++ +  p   +ls  l+++
  AAZ54538.1   215 MFAWGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREI 261  

                   ilrclakdpekRptasevlehlfflllllpllllllppelelllddyellkllgeGgfgvVylarlkltgrlvAvKvlkkdllld
                        + ++++y+ll++lg+Gg gvVyl+   ++g +vAvK+l++d l  
  AAZ54538.1    28    TDPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALDL 73   

                   eellerflrEveilkrlrhpnivrllgvfleedldllllylvmEyveggs
                   + l+e++  Eve+ +r+      ++l + l+ d     +y+v Eyveg s
  AAZ54538.1    74 PGLREQLAEEVEMARRVARFCTAQVLAADLDADP----PYVVSEYVEGPS 119  

                   LldllrkrgplseelalrialqilsaLeylhslgiiHrDlKpeNiLlded
                   L+ ++r+rgpl  + + r+a+++l aL+ +h+ gi+HrD Kp+N+L+  +
  AAZ54538.1   120 LQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPG 169  

                   gvvklaDFGlarllldglltllllttvvgtpgYmaPEvllggpystksDv
                   g ++++DFG+ar l  +     l+++++gtp+YmaPE+++ggp+++++D+
  AAZ54538.1   170 G-PRVIDFGIARALEGTAI---LTSRIAGTPAYMAPEQITGGPLGPAVDM 215  

                   wslGvvlyelltgrppfdglsllellllilkglllpllelppglspelld
                   +++G +l++ + gr pf + sl  +++++++ ++      + +ls  l++
  AAZ54538.1   216 FAWGATLVYAANGRGPFGHGSLKAVVQRVINDEP-----DFGELSGTLRE 260  

                   lilkclakdpekRpsaaellehlfflgldplelllddyellkllGeGgfGvVylavlkltgrlvAvKvlkksl..le
                       +  +++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++  +l+
  AAZ54538.1    29    DPARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDAldLP 74   

                   gllerflrEieilkrlnhpnivkllgvfleedllylvmEyveggsLldll
                   gl+e++  E+e+ +r+      ++l + l+ d  y+v Eyveg sL+ ++
  AAZ54538.1    75 GLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVV 124  

                   rkrgplseelalrialqilsaLaylhslgiiHrDlKpeNiLldedgvvkl
                   r+rgpl  + + r+a+++l aLa +h+ gi+HrD Kp+N+L+ + g +++
  AAZ54538.1   125 RERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRV 173  

                   aDFGlarllsdgetllllttvvgtpgYmAPEvllggpyyslksDvwSlGv
                   +DFG+ar l+ +    l+++++gtp+YmAPE++ ggp +++++D++++G 
  AAZ54538.1   174 IDFGIARALEGTAI--LTSRIAGTPAYMAPEQITGGP-LGPAVDMFAWGA 220  

                   vlyelltgrppfdglsllellllilkglllllllppllspelldlilkcl
                   +l++ + gr pf + sl  +++++++ +    + + +ls  l++++ +cl
  AAZ54538.1   221 TLVYAANGRGPFGHGSLKAVVQRVINDE----PDFGELSGTLREIAERCL 266  

                   aldpekRptasevlehlfflslllpllllpglelalddyellkllgeGgfgtVylard.tgelvavKvlk.....se
                           +++y+ll++lg+Gg g+Vyl+   +g  vavK+l+ ++ + +
  AAZ54538.1    29    -DPARIGEYTLLGRLGQGGQGVVYLGSApDGARVAVKTLHrdaldLP 74   

                   ellerflrEieilkrlnhpnivkllgvfededlelylvmeyleggsLldl
                    l+e++  E+e+ +r+   +  ++l + +d d  +y+v ey+eg sL+ +
  AAZ54538.1    75 GLREQLAEEVEMARRVARFCTAQVLAADLDAD-PPYVVSEYVEGPSLQAV 123  

                   lkklkkgplseeeilrialqilsaleyLHskgiiHrDlkpeNilldedgv
                   ++  ++gpl  + + r+a++ l al+ +H+ gi+HrD kp+N+l+   g 
  AAZ54538.1   124 VR--ERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGG 170  

                   vkliDfGl.....lsltllttlvgtpgllYmaPEvllggpyspksDvwsl
                   +++iDfG++ + + +  l+++++gtp+  YmaPE++ ggp++p++D++++
  AAZ54538.1   171 PRVIDFGIaraleGTAILTSRIAGTPA--YMAPEQITGGPLGPAVDMFAW 218  

                   Gvilyelltlgklpfdglsllellelilkglllplppelspelldlilkc
                   G +l + +  g+ pf + sl+ +++++++ +  p + els  l++++++c
  AAZ54538.1   219 GATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREIAERC 265  

                   lqldpekRpsaeellkhLeeldessllelllddyellellGeGgfGvVylardlktgrlvAvKvlkksl..de
                       + ++++y+ll++lG+Gg GvVyl+   ++g +vAvK l+++  + +
  AAZ54538.1    29    DPARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDAldLP 74   

                   gllerflrEieilarlnhpnivkllgvfeddgelylvmEyleggsLldll
                   gl+e++  E+e+ +r+      ++l + +d + +y+v Ey+eg sL+ ++
  AAZ54538.1    75 GLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVV 124  

                   kkrgplseeealkialqillaLaylhselgiiHrDlKPeNiLldsdgvvk
                   ++rgpl  + + ++a+++l aLa +h+  gi+HrD KP+N+L+ + g ++
  AAZ54538.1   125 RERGPLRGASLERLAVGTLTALAAIHQ-AGIVHRDFKPANVLM-APGGPR 172  

                   laDFGlarllddd..llttvvgTpgYmAPEvllggpydtksDvwSlGvvl
                   ++DFG+ar l+++++l+++++gTp+YmAPE++ ggp+++++D++++G++l
  AAZ54538.1   173 VIDFGIARALEGTaiLTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATL 222  

                   yelltgrppfpgesllellllilkgklslllgtpslellllllsllllll
                    + + gr pf + sl ++++++++                          
  AAZ54538.1   223 VYAANGRGPFGHGSLKAVVQRVIN-------------------------- 246  

                   llllllleglllelldpllllelppelspelldlilkclqkdpekRpsae
                                        + + els  l++++++cl+kd ++Rp+a+
  AAZ54538.1   247 -------------------DEPDFGELSGTLREIAERCLNKDAAQRPTAA 277  

                   ellehlfflllllpllllllllllllpklelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkelllsee
                      + ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++ l  ++
  AAZ54538.1    30    PARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALDLPG 75   

                   llerflrEieilkrlrhpnivkllgvfedddelylvmEyveggsLfdllk
                   l+e++  E+e+ +r+      ++l + +d d++y+v Eyveg sL  +++
  AAZ54538.1    76 LREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVR 125  

                   krgplseeealrialqilsaLeyLHskgiiHRDlKpeNiLldedgvvkla
                   +rgpl  + + r+a++ l aL+ +H+ gi+HRD Kp+N+L+ + g ++++
  AAZ54538.1   126 ERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PRVI 174  

                   DFGlarllssgetllttvvgtpgYmAPEvllggpyspksDvWSlGvvlye
                   DFG+ar l+ +  l++ ++gtp+YmAPE++ ggp++p++D++++G +l +
  AAZ54538.1   175 DFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVY 224  

                   lltgrppfdglsplelllkilkgllplpellspelkdlilkclqkdpekR
                    + gr pf + s+ ++++++++ ++++  +ls  l++++++cl+kd ++R
  AAZ54538.1   225 AANGRGPFGHGSLKAVVQRVINDEPDF-GELSGTLREIAERCLNKDAAQR 273  

                   pgsleetaeellehpfllgllllllllllllppllplllslldlslldll
                   p     ta+e l      + ++++ ++ + +++++ + + ++      + 
  AAZ54538.1   274 P-----TAAETLMLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADT 318  

                   llslllllslssssllsllllslllllsllslslsslsndelalddyellellGeGgfGvVylavlktgrlvavKvlkk....seel
                      +  +++y+ll++lG+Gg GvVyl+   +g  vavK+l++++ + + l
  AAZ54538.1    30    PARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRdaldLPGL 76   

                   lkeflrEieilsklrhpnivkllgvfleedelylvmEymeggsLldllrk
                   ++++  E+e+ +++      ++l + l+ d+ y+v Ey+eg sL+ ++r+
  AAZ54538.1    77 REQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRE 126  

                   rkgplseelllkialqiargLayLhslgiiHrDlkpeNiLldedgvvkla
                   r gpl  + l ++a++++ +La +h+ gi+HrD kp+N+L+  +g ++++
  AAZ54538.1   127 R-GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PRVI 174  

                   DFGlarllssdlllllttvvgtpgYmAPEvllggkyttksDvwSlGvvly
                   DFG+ar l+ + + l+++++gtp+YmAPE+++gg++++++D++++G +l 
  AAZ54538.1   175 DFGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLV 223  

                   elltlgrppfdglsllellllilkglrlplpellspelldlilkclakdp
                   + +  gr pf + sl  +++++++ +  p + +ls  l++++ +cl+kd 
  AAZ54538.1   224 YAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREIAERCLNKDA 270  

                   ekRptasevlehlflldldlellldryellkllGeGgfGvVylardlltgrlvAvKvlkk....sek
                      + ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l++++ + + 
  AAZ54538.1    30    PARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRdaldLPG 75   

                   llerflrEieilkrlnhpnivrllgvfedddelylvmEyveggsLldllk
                   l+e++  E+e+ +r+      ++l + +d d+ y+v Eyveg sL  +++
  AAZ54538.1    76 LREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVR 125  

                   krggplseeealrialqilsaLeyLHslgiiHrDlKpeNiLldlledgvv
                   +rg pl  + + r+a++ l aL+ +H+ gi+HrD Kp+N+L+   + g +
  AAZ54538.1   126 ERG-PLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM---APGGP 171  

                   klaDFGlarllssg.tllttvvgtpgYmAPEvllggpyspksDvWSlGvv
                   +++DFG+ar l  ++ l+++++gtp+YmAPE++ ggp++p++D++++G +
  AAZ54538.1   172 RVIDFGIARALEGTaILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGAT 221  

                   lyelltgrppfpglsllelllkilkglllpllelppglspelldlilkcl
                   l + + gr pf + sl  +++++++ ++      + +ls  l++++++cl
  AAZ54538.1   222 LVYAANGRGPFGHGSLKAVVQRVINDEPD-----FGELSGTLREIAERCL 266  

                   qkdpekRptaeellehpflkglllllllllllllllllllllllllslll
                   +kd ++Rpta+e l    + g+  +++   + +   +++ +++l+   + 
  AAZ54538.1   267 NKDAAQRPTAAETLM--LVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIA 314  

                   llllslllllsllslsllsllllsllsspelelllddyellkllgeGgfgtvylardklldktgrlvavKvlkksl
                        +  +++y+ll++lg+Gg g+vyl+      ++g +vavK+l+++ 
  AAZ54538.1    30    --PARIGEYTLLGRLGQGGQGVVYLGSA----PDGARVAVKTLHRDA 70   

                   l..eellerflrEieilkrlrhpnivkllgvfed.delylvmeyleggsL
                   l+ ++l+e++  E+e+ +r+   +  ++l +  d+d++y+v ey+eg sL
  AAZ54538.1    71 LdlPGLREQLAEEVEMARRVARFCTAQVLAADLDaDPPYVVSEYVEGPSL 120  

                   ldllkkrgkklseeevlrialqilsaleyLHskgiiHrDlkpeNillded
                   + ++++rg+ l    + r+a++ l al+ +H+ gi+HrD kp+N+l+   
  AAZ54538.1   121 QAVVRERGP-LRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-AP 168  

                   gvvkliDfGlarllsddeltllttlvgtpgYmaPEvllggpyspksDvws
                   g +++iDfG+ar l+ +    +++++gtp+YmaPE++ ggp++p++D+++
  AAZ54538.1   169 GGPRVIDFGIARALEGTAIL-TSRIAGTPAYMAPEQITGGPLGPAVDMFA 217  

                   lGvilyelltlgklpfpglsllellekileglllplpedlspelldlilk
                   +G +l + +  g+ pf + sl+ +++++++ +  p   +ls  l++++++
  AAZ54538.1   218 WGATLVYAAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREIAER 264  

                   clqldpekRpsaeellehlffllllleadleldlddyelelkllgeGgfgtVylardkktgelllvavKvlkksll
                       + ++++y+l l++lg+Gg g+Vyl+   ++g +  vavK+l++++l
  AAZ54538.1    30    -PARIGEYTL-LGRLGQGGQGVVYLGSA-PDGAR--VAVKTLHRDAL 71   

                   .deellerflrEieilkklnhpnivkllgvfe.ddelylvmeyleggsLl
                   + + l+e++  E+e+ +++   +  ++l + ++ d++y+v ey+eg sL+
  AAZ54538.1    72 dLPGLREQLAEEVEMARRVARFCTAQVLAADLdADPPYVVSEYVEGPSLQ 121  

                   dllkkrgplseeealkialqilsaLeyLHskgiiHrDlkpeNilldedgv
                    ++++rgpl    + ++a++ l aL+ +H+ gi+HrD kp+N+l+   g 
  AAZ54538.1   122 AVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGG 170  

                   vkliDfGlarllsddeltllllttlvgtpgYmaPEvllggpyspksDvws
                   +++iDfG+ar l+ +     l+++++gtp+YmaPE++ ggp++p++D+++
  AAZ54538.1   171 PRVIDFGIARALEGTAI---LTSRIAGTPAYMAPEQITGGPLGPAVDMFA 217  

                   lGvilyelltlgklpfdglsplellekilkglrpplppglspelldlilk
                   +G +l + +  g+ pf + s + +++++++    p + +ls  l++++++
  AAZ54538.1   218 WGATLVYAAN-GRGPFGHGSLKAVVQRVIND--EPDFGELSGTLREIAER 264  

                   clqldpekRpsaeel.........ellllnllldllllllllalddyellkllGeGgfGvVylarlkltgrlvAvKvlkkslllsekl
                       ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++ l  ++l
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALDLPGL 76   

                   lerflrEieilkrlnhpnivkllgvfldedelylvmEyveggsLldllrk
                   +e++  E+e+ +r+      ++l + ld d++y+v Eyveg sL  ++r+
  AAZ54538.1    77 REQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRE 126  

                   rgplseeealrialqillaLeyLHslgiiHrDlKpeNiLldedgvvklaD
                   rgpl  + + r+a+++l aL+ +H+ gi+HrD Kp+N+L+ + g ++++D
  AAZ54538.1   127 RGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PRVID 175  

                   FGlarllddg...lttvvgtpgYmAPEvllggpyteksDvWSlGvvlyel
                   FG+ar l+ +++ +++++gtp+YmAPE++ ggp+++++D++++G +l + 
  AAZ54538.1   176 FGIARALEGTailTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYA 225  

                   ltgrppfdglsplellllilkgllplpeelspelkdlilkclqkdpekRp
                   + gr pf + s  ++++++++ ++++  els  l++++ +cl+kd ++Rp
  AAZ54538.1   226 ANGRGPFGHGSLKAVVQRVINDEPDF-GELSGTLREIAERCLNKDAAQRP 274  

                   tmaevvaeellehpfllgllllllllllllllllpllllllllsllllll
                   t     a+e l      + ++++ ++ + +++++ + +l+   +      
  AAZ54538.1   275 T-----AAETLMLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTG 319  

                   lllllllllllssllllllssplalddyellellgeGgfgvVylavlktgrlvAvKvlkk....seell
                        +++y+ll++lg+Gg gvVyl+   +g +vAvK+l++++ + + l+
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRdaldLPGLR 77   

                   keflrEieilsklrhpnivkllgvfldedelylvmEymeggsLldllrkr
                   +++  E+e+ +++      ++l + ld d+ y+v Ey+eg sL+ ++r+r
  AAZ54538.1    78 EQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRER 127  

                   glplseelllkialqiargLayLhslgiiHrDlkpeNiLldedgvvklaD
                   g pl  + l ++a++++ +La +h+ gi+HrD kp+N+L+   g ++++D
  AAZ54538.1   128 G-PLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVID 175  

                   FGlarlllsdellllttvvgtpgYmaPEvllggkytlksDvwSlGvvlye
                   FG+ar l+ + + l+++++gtp+YmaPE++ gg++++++D++++G +l++
  AAZ54538.1   176 FGIARALEGTAI-LTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVY 224  

                   lltlgkppfpglsllellllilkglrlplpellseelldlilkclaldpe
                    +  g+ pf + sl  +++++++    p + +ls  l++++ +cl++d +
  AAZ54538.1   225 AAN-GRGPFGHGSLKAVVQRVINDE--PDFGELSGTLREIAERCLNKDAA 271  

                   kRptasevlkhlflqlllddyellkllgeGgfgvVylavlkltgrlvAvKvlkkslllseel
                        +++y+ll++lg+Gg gvVyl+   ++g +vAvK+l+++ l  + l
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALDLPGL 76   

                   lerflrEieilsrlnhpnivrllgvfldedllylvmEyvpggsLldllkk
                   +e++  E+e+ +r+      ++l + ld d  y+v Eyv+g sL  ++++
  AAZ54538.1    77 REQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRE 126  

                   rgplseelallialqillaLaylhslgiiHrDlKpeNiLldedgvvklaD
                   rgpl  + + ++a+++l aLa +h+ gi+HrD Kp+N+L+ ++g ++++D
  AAZ54538.1   127 RGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PRVID 175  

                   FGlarllsssl..lttvvgtpgYmaPEvllgglyslksDvwslGvvlyel
                   FG+ar l  + + +++++gtp+YmaPE++ gg++++++D++++G++l++ 
  AAZ54538.1   176 FGIARALEGTAilTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYA 225  

                   ltgrppfdglsllellllilkgllplpeelspelldlilkclaldpekRp
                   + gr pf + sl  +++++++  + +  els  l++++ +cl++d ++Rp
  AAZ54538.1   226 ANGRGPFGHGSLKAVVQRVINDEPDF-GELSGTLREIAERCLNKDAAQRP 274  

                   sasellehlflkgldllatddyellellGkGgfGvVylardkltgelvAvKvlkkelllseel
                       ++++y+ll++lG+Gg GvVyl+   ++g +vAvK+l+++ l  ++l
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALDLPGL 76   

                   lerflrEieilkrlsslnhpnivrllgvfededelylvmEyveggsLfdl
                   +e++  E+e+ +r+         ++l + +d d  y+v Eyveg sL+ +
  AAZ54538.1    77 REQLAEEVEMARRV---ARFCTAQVLAADLDADPPYVVSEYVEGPSLQAV 123  

                   lkkrgplseeealrialqilsaLeyLHslgiiHRDlKpeNiLldedgvvk
                   +++rgpl  + + r+a+++l aL+ +H+ gi+HRD Kp+N+L+ + g ++
  AAZ54538.1   124 VRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAPGG-PR 172  

                   laDFGlarllsdge..lttvvgTpgYmAPEvllggpyygpksDvWSlGvv
                   ++DFG+ar l+ + + +++++gTp+YmAPE++ ggp +gp++D++++G +
  AAZ54538.1   173 VIDFGIARALEGTAilTSRIAGTPAYMAPEQITGGP-LGPAVDMFAWGAT 221  

                   lyelltgrppfdgesplelllkilkllglplplppglspelkdlilkclq
                   l + + gr pf + s++++++++++      p +  ls  l++++++cl+
  AAZ54538.1   222 LVYAANGRGPFGHGSLKAVVQRVIN----DEPDFGELSGTLREIAERCLN 267  

                   kdpekRptmaevvaeellehpffrglllllllllllppplvpllsslldl
                   kd ++Rpt     a+e l      + +++++++ + ++++v + + +   
  AAZ54538.1   268 KDAAQRPT-----AAETLMLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGA 312  

                   ssldllllsllllllllllllslllllslllsssslsllllsssllssls
                       ++ + ++   l+++++++ ++++s +  ++s+++++++++ +++ +
  AAZ54538.1   313 IAAADTGEQESAAELYRSYPPAPPPPHSNVAAQPSPTPPPHPQTASGPQP 362  

                   sllpslssslsslpspsgslllddyellkllgeGgfgvVylardlltgrlvAiKvlkksllldlll
                        +++y+ll++lg+Gg gvVyl+   ++g  vA+K+l+++ l+    
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDALDL--- 73   

                   ekllerflrEieilkrlnlghpnivklldvfededllylvmEylesggdL
                   + l+e++  E+e+ +r+        ++l + +d d +y+v Ey+e g +L
  AAZ54538.1    74 PGLREQLAEEVEMARRVA--RFCTAQVLAADLDADPPYVVSEYVE-GPSL 120  

                   ldllkkrgrlseeeallialqillaleylhslgiiHrDlKpeNiLldled
                   + ++++rg+l    + ++a++ l al+ +h+ gi+HrD Kp+N+L+  + 
  AAZ54538.1   121 QAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM--AP 168  

                   gvvklaDFGlarlldde..llttlvgtpgYmAPEvllglpyyglkvDvws
                   g ++++DFG+ar l+++++l++ ++gtp+YmAPE++ g+p+ g++vD+++
  AAZ54538.1   169 GGPRVIDFGIARALEGTaiLTSRIAGTPAYMAPEQITGGPL-GPAVDMFA 217  

                   lGvilyelltgrlpfpglsllelllli.....lppllspelldlilkllq
                   +G +l++ + gr pf + sl+++++++++++  +  ls  l+++ +++l+
  AAZ54538.1   218 WGATLVYAANGRGPFGHGSLKAVVQRVindepDFGELSGTLREIAERCLN 267  

                   kdpekRptaeellehpffkgllllllllllllplllddyellellGeGgfgvVylardlltgrlvAvKvlkksll.seel
                        +++y+ll++lG+Gg gvVyl+    +g  vAvK+l+++ l+ + l
  AAZ54538.1    31    ARIGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDALdLPGL 76   

                   lerflrEieilaklnhpnivkllgvfldeddgllylvmEyleggsLldll
                   +e++  E+e+ +++      ++l +   +d +  y+v Ey+eg sL+ ++
  AAZ54538.1    77 REQLAEEVEMARRVARFCTAQVLAAD--LDADPPYVVSEYVEGPSLQAVV 124  

                   kkllkskgllseeeallialqillaLaylhsllslllgiiHrDlKpeNiL
                   ++    +g+l  + + ++a++ l aLa +h+      gi+HrD Kp+N+L
  AAZ54538.1   125 RE----RGPLRGASLERLAVGTLTALAAIHQA-----GIVHRDFKPANVL 165  

                   ldedgvvklaDFGlarllssdltllttvvgtpgYmAPEvllgkpydlksD
                   +   g ++++DFG+ar l+ + +l++ ++gtp+YmAPE+++g+p+++++D
  AAZ54538.1   166 M-APGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVD 214  

                   vwslGvvlyelltgrppfpglsllellllilkglllplpellspelldli
                   +++ G++l + + gr pf + sl ++++++++ ++   +  ls  l++++
  AAZ54538.1   215 MFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEP--DFGELSGTLREIA 262  

                   lkclakdpekRpsaeellehpflllddyellkllgeGgfgvVylarlkltgrlvAvKvlkkslllsllll
                       +++y+ll++lg+Gg gvVyl+   ++g +vAvK+l+++ l      
  AAZ54538.1    32    RIGEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDAL------ 71   

                   lsekllerflrEieilkrlsnhpnivkllgvfededelylvmEyveggsL
                     + l+e++  E+e+ +r+       ++l + +d d  y+v Eyveg sL
  AAZ54538.1    72 DLPGLREQLAEEVEMARRV-ARFCTAQVLAADLDADPPYVVSEYVEGPSL 120  

                   ldllkkrgplseeealkialqilsaLaylhslgiiHrDlKpeNiLldedg
                     ++++rgpl  + + ++a+++l aLa +h+ gi+HrD Kp+N+L+ + g
  AAZ54538.1   121 QAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APG 169  

                   vvklaDFGlarlldsg.tllttvvgtpgYmAPEvllgllslllgkyslks
                    ++++DFG+ar l+ +++l+++++gtp+YmAPE+++g      g++++++
  AAZ54538.1   170 GPRVIDFGIARALEGTaILTSRIAGTPAYMAPEQITG------GPLGPAV 213  

                   DvwSlGvvlyelltgrppfdglsllellllilrglllpllelppllspel
                   D++++G++l + + gr pf + sl ++++++++ ++      + +ls  l
  AAZ54538.1   214 DMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEP-----DFGELSGTL 258  

                   ldlilkclqkdpekRptaeellkhpflkdldldryellkklGeGgfGtVylardlltgelvAvKvlkk......klle
                      +++y+ll++lG+Gg G+Vyl+   ++g +vAvK+l++++ +  +l+e
  AAZ54538.1    33    IGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRdaldlpGLRE 78   

                   rflrEieilkrlnghpnivkllgvfedpnedelylvmEyleggsLldll.
                   ++  E+e+ +r+       ++l + +d   d  y+v Ey+eg sL  ++ 
  AAZ54538.1    79 QLAEEVEMARRVA-RFCTAQVLAADLD--ADPPYVVSEYVEGPSLQAVVr 125  

                   ..gklseeealkialqilsaLeyLHslgiiHrDlKpeNiLldedlgvvkl
                   + g+l    + ++a++ l aL+ +H+ gi+HrD Kp+N+L+ +  g +++
  AAZ54538.1   126 erGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLMAP--GGPRV 173  

                   aDFGlarllsdd.tllttvvgtpgYmAPEvllglgkyspksDvWSlGvvl
                   +DFG+ar l  ++ l+++++gtp YmAPE++ g g+++p++D++++G +l
  AAZ54538.1   174 IDFGIARALEGTaILTSRIAGTPAYMAPEQITG-GPLGPAVDMFAWGATL 222  

                   yelltgrppfdpgeselelllkilkglgtpslelllklllllllllllll
                    + + gr pf  + s   +++++++                         
  AAZ54538.1   223 VYAANGRGPF-GHGSLKAVVQRVIN------------------------- 246  

                   llllllelldpllllplppelspelldlllkclqkdpekRptaeellehp
                                  p + els  l++++++cl+kd ++Rpta+e l   
  AAZ54538.1   247 -------------DEPDFGELSGTLREIAERCLNKDAAQRPTAAETLMLV 283  

                   ffkglllplllpllplddyellellGeGgfGvVylarlktgrlvAvKvlkksll.seeller
                      +++y+ll++lG+Gg GvVyl+   +g +vAvK+l+++ l+ ++l+e+
  AAZ54538.1    33    IGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRDALdLPGLREQ 79   

                   flrEieilkrlnhpnivkllgvfleddllylvmEyl.ggsLldllkkrgg
                   +  E+e+ +r+      ++l + l+ d  y+v Ey++g sL  ++++r g
  AAZ54538.1    80 LAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVeGPSLQAVVRER-G 128  

                   plseelvllialqilrgLaylhslgiiHrDlKpeNiLldedgvvklaDFG
                   pl  + + ++a++ l +La +h+ gi+HrD Kp+N+L+   g ++++DFG
  AAZ54538.1   129 PLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFG 177  

                   larllssgltllttvvgtpgYmAPEvllgglkystksDvwSlGvvlyell
                   +ar l+ +  l+++++gtp YmAPE++ gg ++++++D++++G +l++ +
  AAZ54538.1   178 IARALEGTAILTSRIAGTPAYMAPEQITGG-PLGPAVDMFAWGATLVYAA 226  

                   tgrppfpglsllellllilkllgtpslelllllllllllllllllldlll
                    gr pf + sl  +++++++                              
  AAZ54538.1   227 NGRGPFGHGSLKAVVQRVIND----------------------------- 247  

                   llllppllspelldlllkclqldpekRptaeevlehpflketddyellkvlGeGgfGkVykarlklllgsstgrlvAvKvlkksl..s
                      +++y+ll +lG+Gg G+Vy++        ++g +vAvK+l++++ + 
  AAZ54538.1    33    IGEYTLLGRLGQGGQGVVYLGSA------PDGARVAVKTLHRDAldL 73   

                   eelleeflrEieilsrlsrhpnivrllgvcldedelylvmEymeggsLld
                   + l+e++  E+e+ +r+       ++l + ld d+ y+v Ey+eg sL  
  AAZ54538.1    74 PGLREQLAEEVEMARRV-ARFCTAQVLAADLDADPPYVVSEYVEGPSLQA 122  

                   llrkrglllllllllllllllllllllllplseeealkialqiargLayL
                   ++r+rg                       pl    + ++a++ + +La +
  AAZ54538.1   123 VVRERG-----------------------PLRGASLERLAVGTLTALAAI 149  

                   hskgiiHrDLKpeNiLldedgvvklaDFGlarllssgettlllttvvgtp
                   h+ gi+HrD Kp+N+L+ + g ++++DFG+ar l+ +    l+++++gtp
  AAZ54538.1   150 HQAGIVHRDFKPANVLM-APGGPRVIDFGIARALEGTAI--LTSRIAGTP 196  

                   gYmAPEvllggkyttksDvWSlGvvlyelltlgrppfpglsplellekil
                    YmAPE++ gg++++++D+++ G +l + +  gr pf + s+  ++++++
  AAZ54538.1   197 AYMAPEQITGGPLGPAVDMFAWGATLVYAAN-GRGPFGHGSLKAVVQRVI 245  

                   dgllrpplppelspelldlilkclqkdpekRptasevlehlflkelddyellellGeGgfGvVylardlltgrlvAvKvlkksll.seelle
                      +++y+ll++lG+Gg GvVyl+    +g  vAvK+l+++ l+ ++l+e
  AAZ54538.1    33    IGEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDALdLPGLRE 78   

                   rflrEikilkklnhpnivklldvfedegllylvmEyl.ggdLldllkklk
                   ++  E+++ +++      ++l + +d +  y+v Ey++g +L  +++++ 
  AAZ54538.1    79 QLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVeGPSLQAVVRER- 127  

                   ggplseelallialqillaLaylhslgiiHrDlKpeNiLldedgvvklaD
                    gpl  + + ++a++ l aLa +h+ gi+HrD Kp+N+L+   g ++++D
  AAZ54538.1   128 -GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVID 175  

                   FGlarllssdltllttvvgTpgYmAPEvllglkyystkvDvWSlGvilye
                   FG+ar l+ +  l+++++gTp+YmAPE++ g++ ++++vD+++ G++l++
  AAZ54538.1   176 FGIARALEGTAILTSRIAGTPAYMAPEQITGGP-LGPAVDMFAWGATLVY 224  

                   lltgrppfpglsllellllilkllgtpslelllllllllllllllllldp
                    + gr pf + sl  +++++++                            
  AAZ54538.1   225 AANGRGPFGHGSLKAVVQRVIND--------------------------- 247  

                   llllllppllspelldlllkllqkdpekRptaeevlehpffkelllplll
                       + + +ls  l++++ ++l+kd ++Rpta+e l      e ++p+ +
  AAZ54538.1   248 ---EPDFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEE 294  

                   lplssssllldlellllldlllllsllelellldryellkklGeGgfgtV
                                                   +++y+ll++lG+Gg g+V
  AAZ54538.1    33    -----------------------------IGEYTLLGRLGQGGQGVV 50   

                   ylardlktgrlvAvKvlkksslse......flrEieilkrlsnhpnivkl
                   yl+    +g +vAvK+l+++ l+     +++  E+e+ +r+    +  ++
  AAZ54538.1    51 YLGS-APDGARVAVKTLHRDALDLpglreqLAEEVEMARRV-ARFCTAQV 98   

                   lgvfedenldelylvmEyl.ggsLldllkkr..lseeevlrialqilsgL
                   l + +d   d +y+v Ey++g sL+ ++++r  l  + + r+a++ l +L
  AAZ54538.1    99 LAADLDA--DPPYVVSEYVeGPSLQAVVRERgpLRGASLERLAVGTLTAL 146  

                   eyLHskgiiHrDlKpeNilldledgvvklaDFGlarllsddel.lttlvg
                   + +H+ gi+HrD Kp+N+l+    g ++++DFG+ar l+ +   +++++g
  AAZ54538.1   147 AAIHQAGIVHRDFKPANVLM--APGGPRVIDFGIARALEGTAIlTSRIAG 194  

                   tpgYmAPEvllggpyyspksDvwslGvilyelltgklPlfdglsplelle
                   tp+YmAPE++ ggp ++p++D++++G +l + + g+ P f + s + +++
  AAZ54538.1   195 TPAYMAPEQITGGP-LGPAVDMFAWGATLVYAANGRGP-FGHGSLKAVVQ 242  

                   lilkglglpppelllelldlllldllllllllleelpllsllkkllldll
                   ++++ ++ + +                                      l
  AAZ54538.1   243 RVINDEPDFGE--------------------------------------L 254  

                   spelldlilkllqkdpekRptaeellehpflkeldllldslddyellkllGeGgfGvVylardkltgrlvAvKvlkksllldeklle
                      +++y+ll++lG+Gg GvVyl+    +g +vAvK+l+++ l  ++l+e
  AAZ54538.1    33    IGEYTLLGRLGQGGQGVVYLGSAP-DGARVAVKTLHRDALDLPGLRE 78   

                   rflrEieilkrllnhpnivklygvfedegllylvmEyleggdLldllkkr
                   ++  E+e+ +r +      +++ + +d +  y+v Ey+eg +L+ ++++r
  AAZ54538.1    79 QLAEEVEMARR-VARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRER 127  

                   gplseeeallialqillaLeylhslgiiHRDlKpeNiLldedgvvklaDF
                   gpl  + + ++a++ l aL+ +h+ gi+HRD Kp+N+L+ + g ++++DF
  AAZ54538.1   128 GPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVIDF 176  

                   GlarllssgetllttvvgTpgYmAPEvllgkpydakvDvWSlGvilyell
                   G+ar l+ + +l+++++gTp+YmAPE++ g+p++++vD+++ G++l + +
  AAZ54538.1   177 GIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATLVYAA 226  

                   tgrppfpgesllelllkilkgllplpedlspelkdlilkllqkdpekRpt
                    gr pf + sl ++++++++ ++++  +ls  l+++++++l+kd ++Rpt
  AAZ54538.1   227 NGRGPFGHGSLKAVVQRVINDEPDF-GELSGTLREIAERCLNKDAAQRPT 275  

                   aaeellehpfflgllllllllllllllllpllllllllslllllllllll
                   a +e l     ++ ++++ ++ + +++++ +++l+   +       ++  
  AAZ54538.1   276 A-AETLMLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESA 324  

                   llllllsllllllllllllllllddyellellGeGgfGvVylarlkltgrlvAvKvlkkdll.seeller
                      ++y+ll++lG+Gg GvVyl+   ++g +vAvK+l++d l+ ++l+e+
  AAZ54538.1    34    GEYTLLGRLGQGGQGVVYLGSA-PDGARVAVKTLHRDALdLPGLREQ 79   

                   flrEieilkrlnhpnivrllgvfleddllylvmEyle.gsLldllkkrgg
                   +  E+e+ +r+      ++l + l+ d  y+v Ey+e  sL  ++++r g
  AAZ54538.1    80 LAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEgPSLQAVVRER-G 128  

                   plseelvllialqilsgLaylhslgiiHrDlKpeNiLldedgvvklaDFG
                   pl    + ++a+++l +La +h+ gi+HrD Kp+N+L+   g ++++DFG
  AAZ54538.1   129 PLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFG 177  

                   larllsdgltllttvvgtpgYmAPEvllggkyystksDvwSlGvvlyell
                   +ar l+ +  l+++++gtp YmAPE++ gg+ +++++D++++G +l++ +
  AAZ54538.1   178 IARALEGTAILTSRIAGTPAYMAPEQITGGP-LGPAVDMFAWGATLVYAA 226  

                   tgrppflpglsllellllilkglgtpslelllllllllllllllllldll
                    gr pf  + sl  +++++++                             
  AAZ54538.1   227 NGRGPF-GHGSLKAVVQRVIND---------------------------- 247  

                   lllllppllspelldlllkclqldpekRptaeellehpflkDllggrykllkklgeGgfgtvylardlktgelvavKvlkkdsl....
                          g+y+ll +lg+Gg+g+vyl+    +g +vavK+l++d l+   
  AAZ54538.1    34    ----GEYTLLGRLGQGGQGVVYLGS-APDGARVAVKTLHRDALdlpg 75   

                   .lerllrEikilkklsdhpnivkllgyfededylylvmeyl.ggsLedll
                    +e+l  E+++ +++    +  ++l++  d d +y+v ey++g+sL+ ++
  AAZ54538.1    76 lREQLAEEVEMARRV-ARFCTAQVLAADLDADPPYVVSEYVeGPSLQAVV 124  

                   rkkggrlseeevlrialqllsaleylHskgivHrDlkpsNillglgdsde
                    +++g+l    + r+a + l al+ +H++givHrD kp N+l+       
  AAZ54538.1   125 -RERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM------A 167  

                   dgrvkliDFGlarllldpksgklityrekkslvgtpgYmapevllgkeys
                    g +++iDFG+ar l    +  l++      + gtp Ymape++ g++++
  AAZ54538.1   168 PGGPRVIDFGIARALE--GTAILTS-----RIAGTPAYMAPEQITGGPLG 210  

                   rksDiwslGvilyelltgklpfqglsdlellekikkilelklptppeell
                   +++D++++G +l++ + g+ pf + s + +++++++    ++p++     
  AAZ54538.1   211 PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVIN----DEPDFG---- 252  

                   kglpeelkdlikkllsldpeerpsyeellkllefllkslgllldllldwe
                    +l+  l+++++++l++d  +rp+++e l l                   
  AAZ54538.1   253 -ELSGTLREIAERCLNKDAAQRPTAAETLMLVL----------------- 284  

                   elgvvllvsvklgldpvlpldvfpedalelilellvplwkvlnegdlei
                                                                ++  +
  AAZ54538.1    35    ------------------------------------------EYTLL 39   

                   kriggGltnevykvelpdgllkqggeprkvllriygngte.....lidre
                    r+g+G+ + vy+++ pdg         +v+++ ++    +     ++  
  AAZ54538.1    40 GRLGQGGQGVVYLGSAPDG--------ARVAVKTLHRDALdlpglREQLA 81   

                   rEleilklLshrglvPklygffed....glvmeyiegrtltdedlldpei
                    E+e++++++++  + ++++ + d++  + v ey+eg +l++        
  AAZ54538.1    82 EEVEMARRVARFCTA-QVLAADLDadppYVVSEYVEGPSLQAVV------ 124  

                   lraiakalaklHaldppfgkpeknlfdrierwlrlleklllalisllfll
                                                        ++  +l+      
  AAZ54538.1   125 -------------------------------------RERGPLRG----- 132  

                   eellklvslddlkklieellkllealgsplvfcHnDlkpgNiLllkddss
                            + l++l+   l +l+a+++  +++H+D+kp N+L+      
  AAZ54538.1   133 ---------ASLERLAVGTLTALAAIHQA-GIVHRDFKPANVLM------ 166  

                   gsvlifddielnellrgllladdedgrlklIDFeyasryellkllgsGsfgvvylardktgrlvavKvlrkgllsflllllyll
                      +y+ll++lg+G+ gvvyl+  ++g +vavK l+++            
  AAZ54538.1    35    EYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRD------------ 69   

                   rlkllllllllerllrEarilkrlshpnipklydvf...d.lylvmeyie
                       l+l+ l+e+l  E+++++r++ +   ++++++ ++d +y+v ey+e
  AAZ54538.1    70 ---ALDLPGLREQLAEEVEMARRVARFCTAQVLAADldaDpPYVVSEYVE 116  

                   ggslldll.......eeealkilrqllealaylhsagivHrDlkpeNill
                   g sl  ++ +      + + +++   l ala++h+agivHrD+kp+N+l+
  AAZ54538.1   117 GPSLQAVVrergplrGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM 166  

                   dedgvkliDFglarlldepedlalllrdlvgtpaymaPEvllgkpygpas
                    ++g+++iDFg+ar l  +     l++ ++gtpaymaPE++ g+p gpa+
  AAZ54538.1   167 APGGPRVIDFGIARALEGTAI---LTSRIAGTPAYMAPEQITGGPLGPAV 213  

                   DiwslGellkllGeGgfGvVylarlkltgrlvAvKvlkkslllllseqllkrf
                       ll++lG+Gg GvVyl+    +g  vAvK l+++ l    ++l++++
  AAZ54538.1    37    TLLGRLGQGGQGVVYLGSAP-DGARVAVKTLHRDAL--DLPGLREQL 80   

                   lrEikilkrlnhpnivkllgvfedegllylvmEyleggdLldllkkrgll
                     E+++ +r+      ++l + +d +  y+v Ey+eg +L+ ++++rg+l
  AAZ54538.1    81 AEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPL 130  

                   seeeallialqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlA
                     + + ++a++ l aLa +h+ gi+HrD Kp+N+L+   g ++++DFG+A
  AAZ54538.1   131 RGASLERLAVGTLTALAAIHQAGIVHRDFKPANVLM-APGGPRVIDFGIA 179  

                   rllssdgtllttvvgTpgYmAPEvllglkyystkvDvWSlGvilyelltg
                   r l+ +  l+++++gTp YmAPE++ g++ ++++vD+++ G++l + + g
  AAZ54538.1   180 RALEGTAILTSRIAGTPAYMAPEQITGGP-LGPAVDMFAWGATLVYAANG 228  

                   rppfpglsllellllilkllgtpslelllsllllllllllllldllllle
                   r pf + sl  +++++++                               +
  AAZ54538.1   229 RGPFGHGSLKAVVQRVIND-----------------------------EP 249  

                   lppllspelldlllkllqkdpekRptaeevlehpffkelllpllllllll
                    + +ls  l++++ ++l+kd ++Rpta+e l      e ++p+ ++ + +
  AAZ54538.1   250 DFGELSGTLREIAERCLNKDAAQRPTAAETLMLVLGIEGPPPTEEPSTDT 299  

                   lp