hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30308.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ55030.1
Accession:      [none]
Description:    tfus0 AAZ55030.1 GIB00263CH01 "Lipoate-protein ligase B"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050375  Class II aaRS and biotin synthetases           214.3      6e-65   1
0050295  Class II aaRS and biotin synthetases           123.9    2.7e-35   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0050295    1/1       9   218 ..     1   241 []   123.9  2.7e-35
0050375    1/1       9   228 ..     1   216 []   214.3    6e-65

Alignments of top-scoring domains:
0050295: domain 1 of 1, from 9 to 218: score 123.9, E = 2.7e-35
                   *->lrlidlgsldpaenlaleeallrlvaag..ptllflwwnpptvvlGr
                       +++  ++++++e ++l++ l++ + a+++p++++l++++p+++ G+
  AAZ55030.1     9    YHWLGESPVPYMEGWELQRQLHKRRVADqvPDTVLLLEHEPVYTAGK 55   

                   nqnplpevnlellkengipvvrRpsGGgavyhdpgnlnyslilp..lpld
                   +  p++      l + g pv+  ++GG +++h+pg+l+ ++i++  +pld
  AAZ55030.1    56 RTGPWDR----PLTDPGAPVIDIDRGGKITWHGPGQLTAYPIVKlpAPLD 101  

                   irelyrlleelvidalkelgie.aeisgrnDlvvdg........kKisGi
                   + +++r+lee++i+++ ++g+   ++ gr+++++  + +    ++Ki++i
  AAZ55030.1   102 VVAYVRMLEEAIIRVIGDFGLSgMRVEGRTGVWLAAapdrglpeRKIAAI 151  

                   AqrrsrgvvlhhgtllvdtdlellakilpvpyekleskgvksvrsrvtsL
                   + r+ +gv++h+++l+++ dl+++ +i+p+++++ +          vtsL
  AAZ55030.1   152 GCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAG----------VTSL 191  

                   kellgrdlsveeliealleafeellglleeyelteeelelieklleekys
                     +l+r++ v +++ea  ++++ +lg                        
  AAZ55030.1   192 TAELDRTVGVGDILEATEHHLAAVLGA----------------------- 218  

                   swewnyGlllsldllllellvidlglvdyeealaleeallearldgt.pdtlll
                                 ++++  ++v+y+e ++l++ l+++r+++++pdt+ll
  AAZ55030.1     9    -----------YHWLGESPVPYMEGWELQRQLHKRRVADQvPDTVLL 44   

                   lehppvytlGrnqnaedllnl..gipvvrrdrGGgatyhgpGqlvaYsll
                   leh+pvyt+G+++ ++d  +++ g+pv+++drGG++t+hgpGql+aY+++
  AAZ55030.1    45 LEHEPVYTAGKRTGPWDRPLTdpGAPVIDIDRGGKITWHGPGQLTAYPIV 94   

                   dlkrgldvreyvrlleeavidaLaelgikaervsgrtgvwv.....dggl
                    l+ +ldv++yvr+leea+i++++++g++++rv+grtgvw++++ + g +
  AAZ55030.1    95 KLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLaaapdRGLP 144  

                   erKiaaiglrvrrgvtlHGlaLnvdtdlspfsrilpcgieglrvtslsel
                   erKiaaig+r+ +gvt+HG+aLn++ dls+f+ri+pcgi++++vtsl ++
  AAZ55030.1   145 ERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAE 194  

                   lgldvtveevaellleafaellglll.......p