hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30318.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ56050.1
Accession:      [none]
Description:    tfus0 AAZ56050.1 GIB00263CH01 "glyceraldehyde-3-phosphate dehydrogenase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0051902  Glyceraldehyde-3-phosphate dehydrogenase-lik   241.0    4.7e-79   1
0047176  Glyceraldehyde-3-phosphate dehydrogenase-lik   233.1    8.7e-77   1
0047635  Glyceraldehyde-3-phosphate dehydrogenase-lik   242.4    4.8e-76   1
0039315  Glyceraldehyde-3-phosphate dehydrogenase-lik   228.8    1.8e-73   1
0047085  Glyceraldehyde-3-phosphate dehydrogenase-lik   247.2    3.5e-72   1
0046978  Glyceraldehyde-3-phosphate dehydrogenase-lik   246.6    1.3e-71   1
0041771  Glyceraldehyde-3-phosphate dehydrogenase-lik   231.9    1.3e-69   1
0039896  Glyceraldehyde-3-phosphate dehydrogenase-lik   244.8      2e-69   1
0047742  NAD(P)-binding Rossmann-fold domains           214.9    3.5e-64   1
0044691  NAD(P)-binding Rossmann-fold domains           208.9    1.4e-63   1
0051901  NAD(P)-binding Rossmann-fold domains           201.5    1.7e-63   1
0035945  NAD(P)-binding Rossmann-fold domains           212.8    2.9e-63   1
0038087  NAD(P)-binding Rossmann-fold domains           207.3    3.2e-58   1
0049820  NAD(P)-binding Rossmann-fold domains           182.1    1.6e-57   1
0038853  NAD(P)-binding Rossmann-fold domains           202.4    2.8e-57   1
0041770  NAD(P)-binding Rossmann-fold domains           190.2    1.1e-56   1
0035952  NAD(P)-binding Rossmann-fold domains           197.3    1.6e-56   1
0038022  NAD(P)-binding Rossmann-fold domains           191.2    3.1e-56   1
0036579  NAD(P)-binding Rossmann-fold domains           178.4    3.4e-55   1
0039650  NAD(P)-binding Rossmann-fold domains           181.8    1.2e-52   1
0045516  NAD(P)-binding Rossmann-fold domains           171.1    4.2e-52   2
0038547  NAD(P)-binding Rossmann-fold domains           176.8    2.2e-50   1
0038051  Glyceraldehyde-3-phosphate dehydrogenase-lik   168.9    3.4e-49   1
0039314  NAD(P)-binding Rossmann-fold domains           167.0    1.1e-47   2
0035946  Glyceraldehyde-3-phosphate dehydrogenase-lik   159.2    1.5e-47   1
0036580  Glyceraldehyde-3-phosphate dehydrogenase-lik   156.8    5.6e-47   1
0038023  Glyceraldehyde-3-phosphate dehydrogenase-lik   161.5    3.4e-45   1
0038050  NAD(P)-binding Rossmann-fold domains           149.0    3.2e-44   1
0052355  Glyceraldehyde-3-phosphate dehydrogenase-lik   148.0    4.1e-44   1
0045517  Glyceraldehyde-3-phosphate dehydrogenase-lik   151.4    6.4e-44   1
0052415  NAD(P)-binding Rossmann-fold domains           121.3    1.3e-34   1
0041597  Glyceraldehyde-3-phosphate dehydrogenase-lik   128.5    2.1e-34   1
0040869  Glyceraldehyde-3-phosphate dehydrogenase-lik   102.5    1.5e-32   1
0035316  NAD(P)-binding Rossmann-fold domains           105.5    3.5e-32   1
0035953  Glyceraldehyde-3-phosphate dehydrogenase-lik    90.0    1.2e-29   1
0035390  Glyceraldehyde-3-phosphate dehydrogenase-lik   103.7    1.4e-29   1
0045894  NAD(P)-binding Rossmann-fold domains           101.7    2.2e-29   1
0042207  NAD(P)-binding Rossmann-fold domains            96.5    1.9e-27   1
0053020  Glyceraldehyde-3-phosphate dehydrogenase-lik    85.7    1.6e-22   1
0048454  NAD(P)-binding Rossmann-fold domains            61.1    1.7e-16   1
0040868  NAD(P)-binding Rossmann-fold domains            48.6    1.9e-14   1
0051575  NAD(P)-binding Rossmann-fold domains            38.7    8.5e-11   1
0052978  NAD(P)-binding Rossmann-fold domains            40.2    1.5e-10   1
0046003  Glyceraldehyde-3-phosphate dehydrogenase-lik    30.3    1.2e-08   1
0041596  NAD(P)-binding Rossmann-fold domains            30.5    1.4e-08   1
0050914  NAD(P)-binding Rossmann-fold domains            26.6    4.5e-07   1
0050938  NAD(P)-binding Rossmann-fold domains            25.5    9.8e-07   1
0053019  NAD(P)-binding Rossmann-fold domains            26.5    1.1e-06   1
0047516  NAD(P)-binding Rossmann-fold domains            19.2    7.2e-05   1
0036892  NAD(P)-binding Rossmann-fold domains            19.5    0.00011   1
0051285  NAD(P)-binding Rossmann-fold domains            16.5     0.0005   1
0044044  NAD(P)-binding Rossmann-fold domains            16.9     0.0006   1
0036785  NAD(P)-binding Rossmann-fold domains            16.5    0.00076   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0036785    1/1       1   122 [.     1    98 [.    16.5  0.00076
0038853    1/1       1   178 [.     1   190 []   202.4  2.8e-57
0045516    1/2       1   174 [.     1   171 []   166.6  1.1e-50
0047516    1/1       1   177 [.     1   133 []    19.2  7.2e-05
0047742    1/1       1   192 [.     1   191 []   214.9  3.5e-64
0048454    1/1       1   179 [.     1   158 []    61.1  1.7e-16
0051901    1/1       1   176 [.     1   167 []   201.5  1.7e-63
0052415    1/1       1   198 [.     1   171 []   121.3  1.3e-34
0053019    1/1       1   170 [.     1   145 []    26.5  1.1e-06
0035952    1/1       2   155 ..     1   172 []   197.3  1.6e-56
0036892    1/1       2   115 ..     1   108 [.    19.5  0.00011
0038022    1/1       2   171 ..     1   167 []   191.2  3.1e-56
0038050    1/1       2   175 ..     1   172 []   149.0  3.2e-44
0038087    1/1       2   179 ..     1   190 []   207.3  3.2e-58
0039650    1/1       2   171 ..     1   172 []   181.8  1.2e-52
0041596    1/1       2   166 ..     1   148 []    30.5  1.4e-08
0041770    1/1       2   176 ..     1   174 []   190.2  1.1e-56
0044044    1/1       2   125 ..     1    94 [.    16.9   0.0006
0045894    1/1       2   194 ..     1   179 []   101.7  2.2e-29
0049820    1/1       2   174 ..     1   170 []   182.1  1.6e-57
0050914    1/1       2   125 ..     1   126 []    26.6  4.5e-07
0050938    1/1       2   124 ..     1    94 [.    25.5  9.8e-07
0051285    1/1       2   125 ..     1    99 [.    16.5   0.0005
0051575    1/1       2   125 ..     1   100 [.    38.7  8.5e-11
0035316    1/1       3   170 ..     1   234 []   105.5  3.5e-32
0035945    1/1       3   171 ..     1   170 []   212.8  2.9e-63
0036579    1/1       3   176 ..     1   170 []   178.4  3.4e-55
0038547    1/1       3   173 ..     1   170 []   176.8  2.2e-50
0039314    1/2       3   174 ..     1   169 []   164.2    7e-47
0040868    1/1       3   168 ..     1   148 []    48.6  1.9e-14
0042207    1/1       3   194 ..     1   137 []    96.5  1.9e-27
0044691    1/1       3   175 ..     1   170 []   208.9  1.4e-63
0052978    1/1       3   182 ..     1   155 []    40.2  1.5e-10
0041597    1/1     152   319 ..     1   224 []   128.5  2.1e-34
0035953    1/1     153   318 ..     1   165 []    90.0  1.2e-29
0039896    1/1     153   314 ..     1   169 []   244.8    2e-69
0040869    1/1     153   318 ..     1   222 []   102.5  1.5e-32
0041771    1/1     153   314 ..     1   162 []   231.9  1.3e-69
0046003    1/1     153   268 ..     1   167 [.    30.3  1.2e-08
0052355    1/1     153   335 ..     1   162 []   148.0  4.1e-44
0053020    1/1     153   320 ..     1   190 []    85.7  1.6e-22
0035390    1/1     154   273 ..     1   162 []   103.7  1.4e-29
0035946    1/1     154   315 ..     1   162 []   159.2  1.5e-47
0036580    1/1     154   315 ..     1   164 []   156.8  5.6e-47
0038023    1/1     154   315 ..     1   164 []   161.5  3.4e-45
0038051    1/1     154   315 ..     1   163 []   168.9  3.4e-49
0039315    1/1     154   315 ..     1   164 []   228.8  1.8e-73
0045517    1/1     154   315 ..     1   164 []   151.4  6.4e-44
0046978    1/1     154   315 ..     1   169 []   246.6  1.3e-71
0047085    1/1     154   315 ..     1   169 []   247.2  3.5e-72
0047176    1/1     154   315 ..     1   163 []   233.1  8.7e-77
0047635    1/1     154   315 ..     1   163 []   242.4  4.8e-76
0051902    1/1     154   315 ..     1   166 []   241.0  4.7e-79
0039314    2/2     303   335 ..   136   169 .]     2.8      8.4
0045516    2/2     310   335 ..   146   171 .]     4.6      1.6

Alignments of top-scoring domains:
0036785: domain 1 of 1, from 1 to 122: score 16.5, E = 0.00076
                   *->kgkkvlviGaGgiGralaraLaeaGa.evt.vadrslekaealaael
                      ++++v+v G G+iGr + ra ++aG  +v +va  +l   + la +l
  AAZ56050.1     1    MTIRVGVNGFGRIGRNFWRAVQAAGGsDVEiVAVNDLTDKATLAHLL 47   

                   ......................ggveavelDvtdeasldaalgdaDvvin
                   +++++  +   ++++ ++ +++gg +  +l  +d+a l     ++D+v+ 
  AAZ56050.1    48 kydtvlgtlpgevevgedsitvGGTTMKALAQRDPAQLPWGDLGVDIVVE 97   

                   aapvglhaeiveaaleagkhvvdenmmvkvginGFGriGrlvlraavaqdlgvvdveivaindpfidlnymv
                      m+++vg+nGFGriGr+++ra+ a++ +  dveiva+nd+ +d ++++
  AAZ56050.1     1    MTIRVGVNGFGRIGRNFWRAVQAAGGS--DVEIVAVNDL-TDKATLA 44   

                   ymlkydsthgkfkgtvkaengklvingkailivagtledlilaerdPani
                   ++lkyd++ g ++g+v++ ++++++ g +++         +la+rdPa++
  AAZ56050.1    45 HLLKYDTVLGTLPGEVEVGEDSITVGGTTMK---------ALAQRDPAQL 85   

                   pwgdagadyvvestgvfttmekagahlkggakkviisapsadaaptfvmg
                   pwgd+g+d+vvestg ft++e+a++hl++gakkviisap+ ++++t+vmg
  AAZ56050.1    86 PWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMG 135  

                   vnfeeykgaslgvvsvaSctttalvpllavlsdkfaklisaydmkvkvgiiGfGriGrlvaraalnsp..dvelvaindpfidlnymaym
                      m+++vg++GfGriGr ++ra+++ +  dve+va+nd+ +d + +a++
  AAZ56050.1     1    MTIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDL-TDKATLAHL 46   

                   lkydsthgkfdgtvkaedgklvingkaisvfaeqdPanilwgdagadavl
                   lkyd++ g+ +g+v + ++ +++ g   + +a +dPa+++wgd+g+d+v+
  AAZ56050.1    47 LKYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVV 96   

                   ectgvfttaelalahlkgGakhViiskpiad.dptfvmgvnhekydnfl.
                   e+tg+ft ae a +hl++Gak+Viis+p+  +d t+vmgvn++kyd++++
  AAZ56050.1    97 ESTGFFTKAEDAKKHLDAGAKKVIISAPAKGeDLTVVMGVNDDKYDPANh 146  

                   kivsnaydtendlspraldladllavvdhgkkvgiiGlGniGkavakllk...gfgmevlaydrrpke.......
                      + ++vg+ G+G+iG+ + ++++++ g ++e++a++    +++ ++  
  AAZ56050.1     1    MTIRVGVNGFGRIGRNFWRAVQaagGSDVEIVAVNDLTDKatlahll 47   

                   ............................gavyvsldella...esDvvvl
                   +++++  +   ++++ ++ +++  +++++  + ++ +l   +  +D+vv+
  AAZ56050.1    48 kydtvlgtlpgevevgedsitvggttmkALAQRDPAQLPWgdlGVDIVVE 97   

                   capleaineealaalkkgailintsrgalvdeeallelleagkiagagld
                    ++     e a++ l++ga  +++s  a  ++  ++  ++  k   a  +
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHH 147  

                   vlsgeplgld...plleldnviltphialgmtvkvainGFGriGrlvlrallergllgddlevvaindlsidletla
                      mt++v++nGFGriGr+++ra+ + g   +d+e+va+ndl +d +tla
  AAZ56050.1     1    MTIRVGVNGFGRIGRNFWRAVQAAGG--SDVEIVAVNDL-TDKATLA 44   

                   yllkyDsvhgrfdgevevdleelslaeddtlvvngkliklvlaerdpael
                   +llkyD+v+g+++geve        +++d ++v+g+++k  la+rdpa+l
  AAZ56050.1    45 HLLKYDTVLGTLPGEVE--------VGEDSITVGGTTMK-ALAQRDPAQL 85   

                   pwgelgvdlvlestGvfttrekasahlkaGakkViisaPakgdaptiVmG
                   pwg+lgvd+v+estG+ft++e+a++hl+aGakkViisaPakg+++t+VmG
  AAZ56050.1    86 PWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMG 135  

                   vndelydpsdlkivSnAs.............ddnfghshallvlleeeel
                   vnd++ydp++++i+SnAs+++++++ ++++  +nfg+   l+++++  + 
  AAZ56050.1   136 VNDDKYDPANHHILSNAScttncvapmaktlMENFGIVKGLMTTVHAYTN 185  

                   alaallgmmkklkvaiiGaGniGlalarallalag..gaevvavadrdpekagl
                        ++++v++ G+G+iG+++ ra++a ag  ++e+vav+d+ + ++ l
  AAZ56050.1     1    --MTIRVGVNGFGRIGRNFWRAVQA-AGgsDVEIVAVNDLTDKAT-L 43   

                   alakelgatttvn.....................avddleelladp.gvD
                   a++ +++   + +  ++++ ++ +++  +++++ a +d+++l++++ gvD
  AAZ56050.1    44 AHLLKYDTVLGTLpgevevgedsitvggttmkalAQRDPAQLPWGDlGVD 93   

                   vvieatpagahaevalaaleag.khvvvekptaltveeavvpl..velve
                   +v+e+t+ ++ ae a+++l+ag+k v++  p a   + +vv+ ++ + ++
  AAZ56050.1    94 IVVESTGFFTKAEDAKKHLDAGaKKVIISAP-AKGEDLTVVMGvnDDKYD 142  

                   laeekgvvlgvgfgvrflppvvkalellasgyigeivem..kvainGfGriGrlvlrallerg..dlevvaindplidleylayl
                      m+++v++nGfGriGr+++ra+   g  d+e+va+nd l+d ++la+l
  AAZ56050.1     1    MtiRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVND-LTDKATLAHL 46   

                   lkyDsvhgrfdgevevdddllvvngklikvlserdpaelpwgelgvdlvl
                   lkyD+v+g+++gevev++d ++v+g+++k l++rdpa+lpwg+lgvd+v+
  AAZ56050.1    47 LKYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVV 96   

                   estGvfttlekasahlkagakkvlisaPskddaltiVlGvndelldpe.l
                   estG+ft+ e+a++hl+agakkv+isaP+k+++lt+V+Gvnd+++dp ++
  AAZ56050.1    97 ESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPAnH 146  

                   kivsnAsc..n...........kfgieeglealaplvkMkkikvgiiGfGriGrlvarallenk..dielvavndrnpd......
                      M+ i+vg++GfGriGr+++ra+++ +  d+e+vavnd++++++ ++ 
  AAZ56050.1     1    MT-IRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDLTDKatlahl 46   

                   .......................ngkkigvlaeddpeel.lk..gvDvvv
                    +++++  +   ++++ ++ +++ g + + la +dp++l +++ gvD+vv
  AAZ56050.1    47 lkydtvlgtlpgevevgedsitvGGTTMKALAQRDPAQLpWGdlGVDIVV 96   

                   ectggfdtakelalaalkag.kkVivsaPlkdap.tivlgvnhekldkel
                   e+tg f t +e a+++l+ag+kkVi+saP+k+ + t+v+gvn++k+d+ +
  AAZ56050.1    97 ESTGFF-TKAEDAKKHLDAGaKKVIISAPAKGEDlTVVMGVNDDKYDPAN 145  

                   kivieaslsnpsftanvlvalaravlklleeg.llgaitvldiaplllsl
                   +++++    n+s+t+n+ +++a+ +  + ++g+++g++t+++       +
  AAZ56050.1   146 HHILS----NASCTTNCVAPMAKTL--MENFGiVKGLMTTVH------AY 183  

                   tsleelld....klakmmkvavtGAtGyiGralvrlLlerg...hpvvalvrlassasa..g
                      ++++v+v G  G+iGr + r+ +++g  ++++va+  l+++a  +++
  AAZ56050.1     1    MTIRVGVNG-FGRIGRNFWRAVQAAGgsdVEIVAVNDLTDKATLahL 46   

                   kgvevvlg...........dltdldllaaala............gvdvvf
                   ++++ vlg+   ++++ ++++t+  +  +ala+ + ++    + gvd+v+
  AAZ56050.1    47 LKYDTVLGtlpgevevgedSITVGGTTMKALAqrdpaqlpwgdlGVDIVV 96   

                   laagagatlalaeaaaaagvkvidlssafraddvpyglpkvnaealllas
                    ++g  + ++ a++ ++ag+k ++ s+ +  +   ++++ vn +++  a 
  AAZ56050.1    97 ESTGFFTKAEDAKKHLDAGAKKVIISAPAKGE-DLTVVMGVNDDKYDPA- 144  

                   glniiarpgcyttplvlalaplleagmvkvaInGFGrIGrlvlraalerd..dlevvaindllpdfeallave
                      +++v++nGFGrIGr+++ra+ + +  d+e+va+ndl+          
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDLT---------- 38   

                   kgleldaetlayllkydsvhgrfkgtvedlleeddlvvdgkpikvlaerd
                        d +tla+llkyd+v g ++g+ve  + ed ++v+g+++k la+rd
  AAZ56050.1    39 -----DKATLAHLLKYDTVLGTLPGEVE--VGEDSITVGGTTMKALAQRD 81   

                   paylpwgelgvdlvvEstgvfttsekalleyelhlkagakkvvisaPeki
                   pa+lpwg+lgvd+vvEstg+ft+ e+a    ++hl+agakkv+isaP+k+
  AAZ56050.1    82 PAQLPWGDLGVDIVVESTGFFTKAEDA----KKHLDAGAKKVIISAPAKG 127  

                   daitavlgvnedlydsi.ekivsnascTsmkpikvaliGaGtvGsallellleqkeliglrlvavadskkallse
                         +i+v++ G+G++G+ +++++++ +   ++++vav d++   +  
  AAZ56050.1     2    ---TIRVGVNGFGRIGRNFWRAVQAAGGS-DVEIVAVNDLTDKATLA 44   

                   dgldldlllellaeaa..........aaelggvlltddvdelladpdidv
                   ++l++d++l  l+ ++++ ++ +++    + ++   d ++  ++d  +d+
  AAZ56050.1    45 HLLKYDTVLGTLPGEVevgedsitvgGTTMKALAQRDPAQLPWGDLGVDI 94   

                   vvdatgsaehaelylealeaGmvkvginGFGrIGrlvaraalaqd..dvevvaindfidleylayllk
                       ++vg+nGFGrIGr  +ra+ a +  dve+va+nd++d ++la+llk
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDLTDKATLAHLLK 48   

                   ydsthgkfngtvkaengklvvngklidilqerdPanikwgdlgadvvves
                   yd+++g+++g+v+++++ ++v+g++++ l++rdPa+++wgdlg+d+vves
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVES 98   

                   TgvftgrekaglhlkagakkviisapsadvaptfvagvNheellgkd..i
                   Tg+ft +e+a+ hl+agakkviisap+++ ++t+v+gvN++++++++++i
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANhhI 148  

                   vsvasctttalaplllkvldeefkkikvgiiGaGriGrellrallas..pdvelvavadrddaaalaaalk
                      +i+vg++G+GriGr++ ra++a    dve+vav+d++d a la++lk
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAggSDVEIVAVNDLTDKATLAHLLK 48   

                   ydsthgkfdgtvkaedgklvvngkligvlvvtdpaelllgdegvDvvvda
                   yd++ g ++g+v+++++ + v+g++ ++l+ +dpa+l++gd gvD+vv+ 
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVES 98   

                   tppgahaenalaaleaGvkhvivekPlaadvvellvglnreadkslgvvi
                   t+ ++ ae a+++l+aG+k+vi+++P + + +++++g+n+++++ ++++i
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHI 148  

                   vpnfscgvnlllrllkelakvggigevkvkvgingFGriGrlvlraaldrgledgkveivaindpfidlnyavy
                      +++vg+ngFGriGr+++ra+  +g  +++veiva+nd+ +d +++++
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAG--GSDVEIVAVNDL-TDKATLAH 45   

                   llkyDsthGkfkgtvkaengklailkrgrlvingkaisilyaerdPanip
                   llkyD++ G ++g+v++ ++         +++ g +++ l a+rdPa++p
  AAZ56050.1    46 LLKYDTVLGTLPGEVEVGEDS--------ITVGGTTMKAL-AQRDPAQLP 86   

                   WgdlgaeyvvestgvfttlekagahLkgGakkviisapsadaaptfvmGv
                   Wgdlg+++vvestg+ft++e a+ hL++Gakkviisap+++++ t+vmGv
  AAZ56050.1    87 WGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGV 136  

                   nhkkydnaelkivsnascttnalvplaadlvaklgvvdraaklmvkvginGfGriGrlvlraalesge.kvevvaindfidlnylvymlk
                       ++vg+nGfGriGr+++ra++  g  +ve+va+nd+ d ++l+++lk
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGGsDVEIVAVNDLTDKATLAHLLK 48   

                   ydsthgkfkgtvkaedgklvingkaikvvqerdPanikwgelgadyvvec
                   yd++ g+++g+v+++++ ++++g ++k ++ rdPa+++wg+lg+d+vve+
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVES 98   

                   tgvfttlekagahlkgGakvViisapsagdaptfvmgvnhekydsl.ltv
                   tg+ft  e a++hl++Gak+Viisap++g+++t+vmgvn++kyd++++++
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPAnHHI 148  

                   vsnaslttnalservvpladllaakygklkvgivGatGmvGsvllnll..leendFevieivflass.......
                       ++vg+ G+ G++G+ +++++++   +d+e++++ +l+ +++ ++  
  AAZ56050.1     2    TIRVGVNGF-GRIGRNFWRAVqaAGGSDVEIVAVNDLTDKatlahll 47   

                   .............rsagkkllflgkellvlldaldidalsg...vDiiil
                   +++++  +   ++++++++++++g  ++ l +     + +g+  vDi++ 
  AAZ56050.1    48 kydtvlgtlpgevEVGEDSITVGGTTMKALAQRDPAQLPWGdlgVDIVVE 97   

                   clGgdvskevapklaeagwkgvvidaasalrmeddvplvlpevnlevikd
                   ++G  +  e a+k+++ag+k+v+i+a++      +  +v+ +vn + ++ 
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIISAPAK----GEDLTVVMGVNDDKYDP 143  

                   llarglkiianpnCttslmllalgpLlvkvgingFGriGrlvlraalssgssgkvevvaindpidlnymvyml
                      +++vg+ngFGriGr+++ra+ + g  ++ve+va+nd++d ++++++l
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAG-GSDVEIVAVNDLTDKATLAHLL 47   

                   qydsthgkfngtvkaengklvingkpikilqerdPanikwgdlgvdyvve
                   +yd+++g ++g+v+++++ ++++g ++k l+ rdPa+++wgdlgvd+vve
  AAZ56050.1    48 KYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVE 97   

                   stGvfttrekagahlkgGakrviisapsadavaptfvmgvnhekldn.sl
                   stG+ft  e+a+ hl++Gak+viisap +++ + t+vmgvn++k+d++++
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIISAPAKGE-DLTVVMGVNDDKYDPaNH 146  

                   kivsnascttnalap..kllhdsfgllegaplrigivGlGrigqkahlpalaalpg..velvavvdrdpekaealae
                      ++r+g+ G Grig+  + +a++a++g +ve+vav d + +++ a   
  AAZ56050.1     2    TIRVGVNGFGRIGR-NFWRAVQAAGGsdVEIVAVNDLTDKATLAHLL 47   

                   ll.........................gvpvydsldella...dvdaVii
                   +++++  +   ++++ ++ +++  +++++ +  ++++l   + +vd+V+ 
  AAZ56050.1    48 KYdtvlgtlpgevevgedsitvggttmKALAQRDPAQLPWgdlGVDIVVE 97   

                   atptqlhaelalaaleag.khVlvEkPlpirvaviGaGriGrrvaealaelp..dvelvavvdrspdaaalaall
                       irv+v+G+GriGr++++a+++++  dve+vav+d   d+a+la+ll
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVND-LTDKATLAHLL 47   

                   kyistlgrlgglvkaeelgvpvydd............leelledvDvvvi
                   ky+ +lg+l+g+v+++e  + v ++++++ ++ + ++l + + +vD+vv+
  AAZ56050.1    48 KYDTVLGTLPGEVEVGEDSITVGGTtmkalaqrdpaqLPWGDLGVDIVVE 97   

                   atptdthaevakaaleaGvkhVlvekPlaeeaglklmvghnrrfdpa..l
                    t+ +t ae ak++l+aG+k V++++P   e +l++++g+n   ++ +++
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIISAPAKGE-DLTVVMGVNDDKYDPanH 146  

                   klielviisrdplaplldylrrsggifpvldllihdidllrlllgmlllikvginGfGriGrlvlrallkqp..dieivavndllpdlealayll
                       i+vg+nGfGriGr+++ra+ + +  d+eivav ++l d ++la+ll
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAV-NDLTDKATLAHLL 47   

                   kydsvygalddkikfeddalvingklidvlserdpedidwgklgvdlvle
                   kyd+v g+l +++ + +d + ++g+ ++ l++rdp+ ++wg+lgvd+v+e
  AAZ56050.1    48 KYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVE 97   

                   aTGkfttlenlllhlkggakkvivsapsad.iatvvlgvndeelda.kld
                   +TG+ft++e++ +hl++gakkvi+sap +++++tvv+gvnd+++d+++++
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIISAPAKGeDLTVVMGVNDDKYDPaNHH 147  

                   iisvasctttalapllklldkkygveknkkkrvaiiGaGriGsalaralleap..gfevvgvfdvdpekvgrai
                        ++rv++ G+GriG+ + ra+ +a+  ++e+v+v d   +   +++
  AAZ56050.1     2    --TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDLTDKATLAHL 46   

                   egl.........................pvlgvddleell..eggvdvvi
                     ++++  +   ++++ ++ +++  +++++l+  d ++l   + gvd+v+
  AAZ56050.1    47 LKYdtvlgtlpgevevgedsitvggttmKALAQRDPAQLPwgDLGVDIVV 96   

                   lavPaeaaqevadelleagvkvillpplarllvgaavvvrevdledllgr
                     ++  + +e a+  l+ag+k ++++++a                     
  AAZ56050.1    97 ESTGFFTKAEDAKKHLDAGAKKVIISAPA--------------------- 125  

                   llvgldletlkvgiiGlGnigralhlrallklp..gvelv.vadrdperaeklak
                      t++vg+ G+G+igr  + ra+++++  +ve+v+v d++ ++  +   
  AAZ56050.1     2    TIRVGVNGFGRIGRN-FWRAVQAAGgsDVEIVaVNDLTDKATLAHLL 47   

                   kl.........................gipkvyddleell..dpdiDaVi
                   k++++  +   ++++ ++ +++  +++++  +  d+ +l   d ++D+V+
  AAZ56050.1    48 KYdtvlgtlpgevevgedsitvggttmKAL-AQRDPAQLPwgDLGVDIVV 96   

                   iatpnslhaeialaaleag.khvlvEkPkirvgiiGlgnigrahlrallklp..gvelvavvdrdpekaedfaek
                      +irvg+ G+g+igr + ra+++ +  +ve+vav d + ++  +   k
  AAZ56050.1     2    TIRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDLTDKATLAHLLK 48   

                   lgip....................k.gvkvyddleellkdp.diDaliia
                   ++    +   ++++ ++ +++  +++++ +  d+ +l   + ++D+++ +
  AAZ56050.1    49 YDTVlgtlpgevevgedsitvggtTmKALAQRDPAQLPWGDlGVDIVVES 98   

                   tpnglhaelakkaleag.khvlvEKPlakklrvgiiGaGrigrgahlralaalp..gvlelvavadrdpekaea
                        ++rvg+ G+Grigr+ + ra++a++  +v e+vav d++ ++  a
  AAZ56050.1     2    --TIRVGVNGFGRIGRN-FWRAVQAAGgsDV-EIVAVNDLTDKATLA 44   

                   laeelgia........................kvyddleell.adpdiDa
                   +  +++ +  +   ++++ ++ +++  +++++ +  d+++l   d ++D+
  AAZ56050.1    45 HLLKYDTVlgtlpgevevgedsitvggttmkaLAQRDPAQLPwGDLGVDI 94   

                   VviatpndlhaelalaaleaG.khvlvekPlGgshdrseaTaygvvagleealkllgldlkgktvaivGfGniGrava
                                                     ++v+++GfG+iGr++ 
  AAZ56050.1     3    -------------------------------IRVGVNGFGRIGRNFW 18   

                   rllle..algakvvavsdskgalydpdgldleellallekydsvhgrfga
                   r+++++ + ++++vav+d          l+++++la+l+kyd+v+g++++
  AAZ56050.1    19 RAVQAagGSDVEIVAVND----------LTDKATLAHLLKYDTVLGTLPG 58   

                   evvsldellev...eaDvlvpcatenlinaenlkllkakivveganlptt
                   ev  +++ ++v  +  + l+ ++++ l    +++ l+++ivve+++++t 
  AAZ56050.1    59 EVEVGEDSITVggtTMKALAQRDPAQL----PWGDLGVDIVVESTGFFTK 104  

                   peailinlerg..vlvipdalanag..gvdvsnleplqnllllslenvev
                    e ++ +l++g+++++i++++++   ++v+++n++ + +++         
  AAZ56050.1   105 AEDAKKHLDAGakKVIISAPAKGEDltVVMGVNDDKYDPAN--------- 145  

                   tphlgsiasettnaiaplakelglnfleganiaallrvaeamlargvkvgingFGriGrlvlraale...gkvevvaindlidlnylayllqy
                      ++vg+ngFGriGr ++ra+ ++  ++ve+va+ndl+d ++la+ll+y
  AAZ56050.1     3    IRVGVNGFGRIGRNFWRAVQAaggSDVEIVAVNDLTDKATLAHLLKY 49   

                   dsthgkfngtvkaengklvingkpirvlqerdPanikwgdagvdyvvest
                   d+++g+++g+v+++++ ++++g +++ l++rdPa+++wgd+gvd+vvest
  AAZ56050.1    50 DTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVEST 99   

                   GvfttlekagahLkggakkviisapsaddaptlvmGvnhekydnsklkiv
                   G+ft  e+a  hL++gakkviisap+++++ t+vmGvn++kyd+++++i+
  AAZ56050.1   100 GFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHIL 149  

                   snAscgelgttnalapllkvldekflvkvginGFGriGrlvlraals...gkvevvaindpfidlnymvymlk
                      ++vg+nGFGriGr+++ra++++  ++ve+va+nd+ +d ++++++lk
  AAZ56050.1     3    IRVGVNGFGRIGRNFWRAVQAaggSDVEIVAVNDL-TDKATLAHLLK 48   

                   ydsthgkfngtvkaedgklvingkaisilaerdPanikwgdagaeyvlec
                   yd++ g  +g+v+++++ ++++g++++ la rdPa+++wgd+g+++v+e+
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVES 98   

                   tGvfttaekagahlkGGakkviisapsad.aptfvmgvnhekydns.lkv
                   tG+ft ae+a+ hl+ Gakkviisap+++++ t+vmgvn++kyd +++++
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAKGeDLTVVMGVNDDKYDPAnHHI 148  

                   vsnascttnvlaplakvlakklevvdaavkvainGfGrIGrrvaraalaqddmevevvaindpidlaylaymlky
                      ++v++nGfGrIGr+++ra+ a +  +ve+va+nd++d a+la++lky
  AAZ56050.1     3    IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKY 49   

                   dsthgkfngtvkaedgklvvngklidllaerdPanikwgdlgadvvvect
                   d++ g+++g+v+++++ ++v+g++++ la rdPa+++wgdlg+d+vve+t
  AAZ56050.1    50 DTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVEST 99   

                   gvftgaekaglylkggakaviisaesadvaptsvmglnneelal.glkiv
                   g ft ae+a+ +l++gak+viisa+ ++ + t+vmg+n+++++ ++++i+
  AAZ56050.1   100 GFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPaNHHIL 149  

                   rvascnttalarllvvlkellgveikvginGfGriGrlvlraalasg..kvelvaindpfidlnymaymlk
                      i+vg+nGfGriGr ++ra++a g  +ve+va+nd+ +d + +a++lk
  AAZ56050.1     3    IRVGVNGFGRIGRNFWRAVQAAGgsDVEIVAVNDL-TDKATLAHLLK 48   

                   ydsthgkfdgtikaedgklvingkaisilaerdPanikwgdlgadyvvec
                   yd++ g  +g+++++++ ++++g++++ la rdPa+++wgdlg+d+vve+
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVES 98   

                   tgvfttlekagahlkGGakrviisapsad.aptfvmGvnhekydna.lkv
                   tg+ft +e+a+ hl++Gak+viisap  +++ t+vmGvn++kyd a++++
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAKGeDLTVVMGVNDDKYDPAnHHI 148  

                   vsnascntnalvpllvaLakllaiedmkvaivGatGmvGsvllelLleergfevval................
                      ++v++ G  G++G+ + ++ ++  g +v ++++++ +++++ ++  +
  AAZ56050.1     3    IRVGVNG-FGRIGRNFWRAVQAAGGSDVEIVavndltdkatlahllk 48   

                   ......vrlsssrsagkalvfkgvellvvdlldlealk....gvDvvifa
                   ++++  ++ +++++++  ++++g +      +d++ l   + gvD+v+ +
  AAZ56050.1    49 ydtvlgTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPwgdlGVDIVVES 98   

                   aggdvtlklapalaeagvkrvvidsssalrmdddvplvvpevnreaikda
                   +g+ + ++ a+++++ag+k+v+i++++      +   vv++vn + +++a
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISAPAK----GEDLTVVMGVNDDKYDPA 144  

                   lakgggiianpncttillllalkpLldmkVgivGAtGrvGrllvrlllahp..gvevvavvsraeaaellkllg
                      ++Vg++G+ Gr+Gr + r+++a++  +ve+vav++ +++a+l++ll+
  AAZ56050.1     3    IRVGVNGF-GRIGRNFWRAVQAAGgsDVEIVAVNDLTDKATLAHLLK 48   

                   advvvdatppdvlaelaea...................llkagvdaVils
                   +d v++ +p++v ++ +++++  +++++ ++ + ++  ++++gvd+V++s
  AAZ56050.1    49 YDTVLGTLPGEVEVGEDSItvggttmkalaqrdpaqlpWGDLGVDIVVES 98   

                   aGfrlsdlllvellydaaggvkvv.........................i
                   +Gf+++ + + ++l ++a++v++++ ++ ++ ++++ +++++++ ++++i
  AAZ56050.1    99 TGFFTKAEDAKKHLDAGAKKVIISapakgedltvvmgvnddkydpanhhI 148  

                   aanascgvnllvplaklladafgi..........etldlellelhhvkvgingfGriGrlvlraale...gkvevvaindpidlnyavyllky
                      ++vg+ngfGriGr+++ra+  +  ++ve+va+nd++d +++++llky
  AAZ56050.1     3    IRVGVNGFGRIGRNFWRAVQAaggSDVEIVAVNDLTDKATLAHLLKY 49   

                   dsthGkfkgtvkaengkLvingkaisilqekdPanipwgdagadyvvest
                   d++ G ++g+v++ ++ ++++g ++++l+ +dPa++pwgd+g+d+vvest
  AAZ56050.1    50 DTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVEST 99   

                   gvfttlekagahLkgGakkviisapsadeaptfvmgvnhktydnaelkii
                   g+ft++e a+ hL++Gakkviisap+++e+ t+vmgvn+++yd+a+++i+
  AAZ56050.1   100 GFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHIL 149  

                   snascttnalvplaavlpelygkldvglkvaivGatGlvGqellelLeehpfpeltllllasrssagkylefv
                       ++v++ G +G +G+ + +  +      ++++++ +  ++ + + ++
  AAZ56050.1     3    -IRVGVNG-FGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLL 47   

                   gk..........................dlkvleldefdfs..dvdivff
                   + +++  +   ++++ ++ +++  ++++ l ++++ +  + + +vdiv+ 
  AAZ56050.1    48 KYdtvlgtlpgevevgedsitvggttmkALAQRDPAQLPWGdlGVDIVVE 97   

                   algsevarelapkaaeaGvvvidnssafrldpdvPlvvpevnpehldll.
                   ++g ++ +e a+k+++aG++ + +s   ++++    vv++vn++ +d  +
  AAZ56050.1    98 STGFFTKAEDAKKHLDAGAKKVIIS--APAKGEDLTVVMGVNDDKYDPAn 145  

                   gfivanPnctttalalalapLlelfgieevlvttlqlPnCttillvvalkpLhdafgiervlvsTyqAvsGaGakgveelleql
                       +Ctt+++++++k L+++fgi ++l++T++A++              
  AAZ56050.1   152    ASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYT-------------- 184  

                   gallngvelelddlasaildidqlvldllhsdllrarvfpvpiafnliPl
                                       +dq++ld++h+dl+rar    ++a+n+iP+
  AAZ56050.1   185 --------------------NDQVILDYPHKDLRRAR----AAAQNIIPT 210  

                   idgllkdngytkEelkmvaEtrKilglpdldlkvdatcvRvPvlrghsea
                   ++g++k+  ++               lp+l++k+d++++RvPv +g++ +
  AAZ56050.1   211 TTGAAKATALV---------------LPELKGKLDGLAMRVPVPDGSVTD 245  

                   ltvelkkdvsveeirellkeapglvlvvllddpeeplvptplnatgglsv
                   l+v+l+++v+ ee+++++k+a +++l+ +l ++e+p+v+ ++  t+ + +
  AAZ56050.1   246 LVVTLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCT 295  

                   fvgrlrkdllgpnllklvvvgDnllkGnCstiqlvvaLkPlhdafgikrvvvstyqavsGagkfpgpiafnl..
                      +C+t++++++ k l++ fgi + +++t++a+++++++ + ++ +l  
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLrr 199  

                   ....lpniipfidg...etkkilgvldlkvsatavrVPvllgHsesvlve
                   + ++++niip+++g++++t  +l +l++k+++ a+rVPv++g++ +++v+
  AAZ56050.1   200 araaAQNIIPTTTGaakATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekkvsveeilevlkkapgvvllddlelplypkpllavged..vgrirpd
                   le++v+ ee+++++k a           + + k++l+++ed +v+ + + 
  AAZ56050.1   250 LEREVTKEEVNAAFKAAA----------EGALKDILVYTEDpiVSSDIVG 289  

                   ldrdagldeglwvvadnlrkgaAlnavqiScTTnclaPlakvllhdnfgiveglmttvhaytadqklvdgphgkdl
                      ScTTnc+aP+ak l  +nfgiv+glmttvhayt+dq+++d ph kdl
  AAZ56050.1   153    SCTTNCVAPMAKTL-MENFGIVKGLMTTVHAYTNDQVILDYPH-KDL 197  

                   rrgraaalniiPtsTgaakAvgkvlPelngkltgmafrvPtpnvsvvdlt
                   rr+raaa+niiPt+TgaakA ++vlPel+gkl+g+a+rvP+p++sv+dl+
  AAZ56050.1   198 RRARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLV 247  

                   vllekaakyeeinkvlkeasegplkgilgytedplVssdfngdshssifd
                   v+le++++ ee+n+++k+a+eg lk+il ytedp+Vssd++g++ s++fd
  AAZ56050.1   248 VTLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFD 297  

                   agatlvlgialndnlvklisWYNCttilllvalkpLhdafgiervlvsTyqAvsGaGakgveeLlsqlg
                       Ctt+++++++k L+++fgi ++l++T++A+++              
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTN-------------- 185  

                   allngvelelddllldildidlrvaraaalsiiptstfaaplafnviPli
                             d+++ld+ ++dlr+araaa++iipt+t+aa++   v+P++
  AAZ56050.1   186 ----------DQVILDYPHKDLRRARAAAQNIIPTTTGAAKATALVLPEL 225  

                   dvfldngytkeelkmvaEtrKilglldpdlkvsatcvRvPvlrghsealt
                   +                            +k++++++RvPv +g++ +l+
  AAZ56050.1   226 K----------------------------GKLDGLAMRVPVPDGSVTDLV 247  

                   velekdvsleeirellkeapgvvlvddllvseellyptpl...datgtld
                   v+le++v+ ee+++++k+a++  l+d l+++e+ ++   ++ + a+ t+d
  AAZ56050.1   248 VTLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIvgtPASCTFD 297  

                   vlvGrlrkdllgpnllklfvvgDnllkGsCTTnclapllkvLhdafgieeglmttvhavtgdqklldgphkdlrr
                      sCTTnc+ap++k L+++fgi++glmttvha+t+dq++ld phkdlrr
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRR 199  

                   graaalniiPtstgaakavgkvlpelngkltgtavrVPtpnvsvvdltve
                   +raaa+niiPt+tgaaka+++vlpel+gkl+g+a+rVP+p++sv+dl+v+
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekeasveeinealkeasegplkgilgyteedlvsvdfigddlssifdag
                   le+e+++ee+n+a+k+a+eg lk+il yte+++vs+d++g++ s++fda+
  AAZ56050.1   250 LEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDAS 299  

                   ltivldnlvklaawyNCttilmvvaLkpLheafglervvvsTyqAvSGaGakgveelleqlg
                       Ctt ++++  k L+e+fg+ + +++T +A            +++ +
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHA------------YTNDQ 187  

                   allngveseladpasaildidrkvlellrleeleldvfpvplafnviPli
                    +l++ +++l++ + a+++i +++++++++++l            v+P +
  AAZ56050.1   188 VILDYPHKDLRRARAAAQNIIPTTTGAAKATAL------------VLPEL 225  

                   dvfldngytkEElklvnEtrKilglddelkvsatcvRvPvlrghseavtv
                   +                            k++++++RvPv +g    ++v
  AAZ56050.1   226 K---------------------------GKLDGLAMRVPVPDGSVTDLVV 248  

                   elekdvsveevrellanapgsCnTtglaralkpLhdafgiervllttrqa............dpkrf
                      sC+T++ a+++k+L+++fgi+++l+tt++a+++++++ ++ +++ r+
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHAytndqvildyphKDLRR 199  

                   grgianniiPsitgashhggkvlpvldlklttmAvrVPttlvhvvdltve
                   +r++a+niiP++tga+++   vlp+l++kl ++A+rVP+++++v dl+v+
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekpataeevlealkna.....pgillidede....dltstaelgefdvd
                   le+++t+eev++a+k+a++ + ++il+++ed+++  d+++t ++  fd++
  AAZ56050.1   250 LEREVTKEEVNAAFKAAaegalKDILVYTEDPivssDIVGTPASCTFDAS 299  

                   vgrirndlvelvvwgdslwvvgdnlrklaalnaesincttiqlvlaLkpLhdafgiervvvstyqavSgaGaegvdeLagqta
                      +ctt+++++  k L+++fgi + +++t++a++++++           
  AAZ56050.1   153    SCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQV----------- 188  

                   ellngkplepevfprplafnviPlidvflengytkeElklvaetrkilgd
                     + ++p+++ +++r++a+n+iP+ +            +++  t  +l++
  AAZ56050.1   189 --ILDYPHKDLRRARAAAQNIIPTTT------------GAAKATALVLPE 224  

                   ldlkvsatcvrvPvfrghsesvtvelekdvdveevrelladapgvvvldd
                   l+ k++++++rvPv  g+  +++v+le++v+ eev++++++a    + d 
  AAZ56050.1   225 LKGKLDGLAMRVPVPDGSVTDLVVTLEREVTKEEVNAAFKAAAEGALKDI 274  

                   p...llpptpldavgkdevlvgrirkdlsvpnglnlwvvaDnlrkGCtTngLapllkvlndkfgieevlvttvrratdpqkvkkgpi......
                      CtTn+ ap++k+l+++fgi+++l+ttv+++t++q + + p+++   +
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHkdlrra 200  

                   naivpnpitipshhgkdvkkvlpdlk..vtatavrVPvtlvhveslnvel
                   +a ++n+i++ ++++k+   vlp+lk +++++a+rVPv++++v +l+v+l
  AAZ56050.1   201 RAAAQNIIPTTTGAAKATALVLPELKgkLDGLAMRVPVPDGSVTDLVVTL 250  

                   ekevsaeevkealkeapgivliddeegltstaelielardlgrirndlle
                   e+ev++eev++a+k a +  l d                           
  AAZ56050.1   251 EREVTKEEVNAAFKAAAEGALKD--------------------------- 273  

                   lvvwedsvtvlgnellliqavhqCstiqlvvalkplldafglervlvstyqavsgaGklvdgpskllvkg
                      C+t+++++  k l+++fg++++l++t++a++ +++++d p+k+l+++
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRA 200  

                   rgiafniiPaidkaakevgkilpelnlkvtgtavrVPvlnvhvvdltvel
                   r++a+niiP+ ++aak++  +lpel++k++g a+rVPv++++v dl+v l
  AAZ56050.1   201 RAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTL 250  

                   ekpasveeikevlkqasevvlkgilgyteddvvsvgrirddlssifdagl
                   e++++ ee+++++k+a+e+ lk+il yted++vs ++++   s +fda+l
  AAZ56050.1   251 EREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDASL 300  

                   vilsdnlvkgaalndCstiilvpalkplhdkfglkevlvttyqavsgagktldglsgkllvy
                      C+t++++p +k l+++fg++++l+tt++a++ ++++ld+++ k+l++
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH-KDLRR 199  

                   grgiaqnviPaitgaakevgkilpelngkltgtavrVPvlngsvvdltve
                   +r++aqn+iP+ tgaak++  +lpel+gkl g a rVPv++gsv dl+v+
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekpasydeikealkkasggplkgilgytedevvsgdfrsdsyssifdal
                   le++++++e+++a+k a++g lk+il yted++vs+d+++ + s +fda 
  AAZ56050.1   250 LEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDAS 299  

                   alialndnlvklaalnDCstaqlvvalkplhdafglkevlvttyqavsgagktldglsgkllvf
                      C+t+++++ +k l+++fg++++l+tt++a+++++++ld+++ k+l++
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH-KDLRR 199  

                   grgiaqniiPaitgaakevgkvlpelnlkltgtavrVPvlnvhvvdltve
                   +r++aqniiP++tgaak++  vlpel++kl g a+rVPv++++v+dl+v+
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekpasyeeikkalkqasggplkdilgytedpvvssdfvgrirssifdal
                   le++++ ee+++a+k+a++g lkdil ytedp+vssd+vg   s +fda 
  AAZ56050.1   250 LEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDAS 299  

                   alialsdnlvKlaawndCttiqlvvalkplheefgleevlvttyqavsgagklldglskllvfg
                      Ctt+++++++k l+e+fg++++l+tt++a+++++++ld ++k+l+++
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRA 200  

                   rpiaqnviPaidkaakevgkilpelnlkltgtavrVPvlnvhvvdltvel
                   r++aqn+iP+ ++aak++  +lpel++kl+g a+rVPv++++v dl+v+l
  AAZ56050.1   201 RAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTL 250  

                   ekpakveeikevlkqasevplkgilgygedevvvgdirsdslssifdala
                   e++++ ee+++++k+a+e+ lk+il y+ed++v++di++++ s +fda +
  AAZ56050.1   251 EREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDASL 300  

                   livlgdnlvkgaalnDCTTnclapllkvlhdnfgieeglvttvhavtgsqktldgphgkdlrr
                      CTTnc ap++k l++nfgi++gl+ttvha+t++q +ld ph kdlrr
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH-KDLRR 199  

                   graaalniiPtstgaakavgkvipelngkltgtavrVPtpnvsvvdltve
                   +raaa+niiPt+tgaaka ++v+pel+gkl+g+a+rVP+p++sv+dl+v+
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekpvtveeikealkeasegplkgilgytedplvssdfvgrprssifdal
                   le++vt ee+++a+k+a+eg lk+il ytedp+vssd+vg+p s++fda 
  AAZ56050.1   250 LEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDAS 299  

                   ativlgdnlvklaawydCttillvpalkplhdafglkrvlvttyqavsgaGktldglsgklgvf
                      Ctt++++p +k l+++fg++++l+tt++a++ ++++ld ++ k+ ++
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH-KDLRR 199  

                   grgiafnviPhitgaakevgkvlpelnlkvtgtavrvPvlnghvvdltve
                   +r++a+n+iP+ tgaak++  vlpel++k++g+a+rvPv++g+v dl+v 
  AAZ56050.1   200 ARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVT 249  

                   lekpakydeikevlkkasgvplkdilgytedevvsgrirsdslssifdal
                   le++++ +e+++++k a++++lkdil yted++vs++i++ + s +fda 
  AAZ56050.1   250 LEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDAS 299  

                   alivlndnlvklaalndCTTnclaPlvkvllddnfgieeglmttvhaytndqklldgphskdlr
                      CTTnc+aP++k l  +nfgi++glmttvhaytndq +ld ph kdlr
  AAZ56050.1   154    CTTNCVAPMAKTL-MENFGIVKGLMTTVHAYTNDQVILDYPH-KDLR 198  

                   raraaalniiPtstgaakavgkvlPelkgkltglalrVPtpnvsvvdltv
                   raraaa+niiPt+tgaaka ++vlPelkgkl+gla+rVP+p++sv+dl+v
  AAZ56050.1   199 RARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVV 248  

                   llekevtveeinkalkeaaegplkgilgytedplvSsDfigdphssifda
                   +le+evt+ee+n+a+k+aaeg lk+il ytedp+vSsD++g+p+s++fda
  AAZ56050.1   249 TLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDA 298  

                   tativleldengnlvkllaWyDCTtnclaPlvkvllddnfgieeglmttvhaytndqklldgphgkdlr
                      CTtnc+aP++k l  +nfgi++glmttvhaytndq +ld ph kdlr
  AAZ56050.1   154    CTTNCVAPMAKTL-MENFGIVKGLMTTVHAYTNDQVILDYPH-KDLR 198  

                   rgraaalniiPtstgaakavgkvlPelkgkltglalrVPtpnvsvvdltv
                   r+raaa+niiPt+tgaaka ++vlPelkgkl+gla+rVP+p++sv+dl+v
  AAZ56050.1   199 RARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVV 248  

                   llekevtveevnealkeaaegplkgilgytedplvssdfigdphssivda
                   +le+evt+eevn+a+k+aaeg lk+il ytedp+vssd++g+p+s+++da
  AAZ56050.1   249 TLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDA 298  

                   tativleladggnlvkllaWyDCTTnclapvlkvLhdafgiekglmttvhaytgdqllldgphkdlrrg
                      CTTnc+ap++k L+++fgi+kglmttvhayt+dq++ld phkdlrr+
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRA 200  

                   raaalniiPtstgaakavgkvlpelkgkltgtavrVPtpnvslvdltvel
                   raaa+niiPt+tgaaka ++vlpelkgkl+g+a+rVP+p++s++dl+v+l
  AAZ56050.1   201 RAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTL 250  

                   ekevtveevnealkeasegllkgilgyteeplvsvdfigdphssifdala
                   e+evt+eevn+a+k+a+eg lk+il yte+p+vs+d++g p+s++fda +
  AAZ56050.1   251 EREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDASL 300  

                   tivlgdnlvkllawyDCTTnclapvlkvlddafgieeglmttvhaytndqklldgphkdlrrg
                      CTTnc+ap++k l ++fgi++glmttvhaytndq +ld phkdlrr+
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRA 200  

                   raaalniiptstgaakavgkvlPelkgkltglavrVPtpnvsvvdltvel
                   raaa+niipt+tgaaka+++vlPelkgkl+gla+rVP+p++sv+dl+v+l
  AAZ56050.1   201 RAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTL 250  

                   ekevtveevnaalkeasegplkgilgytedplvssdfvgdphssifdala
                   e+evt+eevnaa+k+a+eg lk+il ytedp+vssd+vg+p s++fda +
  AAZ56050.1   251 EREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFDASL 300  

                   tivlgdnlvkllaWyDCTTnclapvlkvlhdafgieeglmttvhaytgdqklldgphgkakdl
                      CTTnc+ap++k l+++fgi++glmttvhayt+dq++ld ph   kdl
  AAZ56050.1   154    CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH---KDL 197  

                   rrgraaalniiPtstgaakavgkvlpelngkltglavrVPtpnvslvdlt
                   rr+raaa+niiPt+tgaaka+++vlpel+gkl+gla+rVP+p++s++dl+
  AAZ56050.1   198 RRARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLV 247  

                   velekevsveeinealkeasegplkgilgyteeplvsvdfigddlssifd
                   v+le+ev++ee+n+a+k+a+eg lk+il+yte+p+vs+d++g ++s++fd
  AAZ56050.1   248 VTLEREVTKEEVNAAFKAAAEGALKDILVYTEDPIVSSDIVGTPASCTFD 297  

                   alativlgdnlvkllawyDkydnalkvvsnascntnalvpllvaLakllaiedvsnaydtendlspraldladllavvd