hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30319.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAZ56191.1
Accession:      [none]
Description:    tfus0 AAZ56191.1 GIB00263CH01 "putative long-chain-fatty-acid-CoA ligase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0042298  Acetyl-CoA synthetase-like                     525.0     1e-173   1
0043409  Acetyl-CoA synthetase-like                     532.7   3.1e-164   1
0043886  Acetyl-CoA synthetase-like                     500.3   2.5e-146   1
0040895  Acetyl-CoA synthetase-like                     499.9   3.3e-146   1
0040451  Acetyl-CoA synthetase-like                     494.9   1.1e-144   1
0044590  Acetyl-CoA synthetase-like                     491.8   9.1e-144   1
0035109  Acetyl-CoA synthetase-like                     484.0     2e-141   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043886    1/1       1   517 []     1   503 []   500.3 2.5e-146
0035109    1/1       2   517 .]     1   514 []   484.0   2e-141
0040451    1/1       2   517 .]     1   541 []   494.9 1.1e-144
0040895    1/1       2   517 .]     1   536 []   499.9 3.3e-146
0044590    1/1       2   517 .]     1   534 []   491.8 9.1e-144
0042298    1/1       3   517 .]     1   643 []   525.0   1e-173
0043409    1/1       7   516 ..     1   640 []   532.7 3.1e-164

Alignments of top-scoring domains:
0043886: domain 1 of 1, from 1 to 517: score 500.3, E = 2.5e-146
                   *->dltlldlleraaartpdrvaliflgegrrlTyaellervnrlaaaLl
                      +l+l  lle+ a+ +p+r a++f  ++ rl ya ++  +n++a+ L+
  AAZ56191.1     1    MLNLSVLLEDGARNRPERDAIVF--GDMRLNYALVNMIANQVANLLV 45   

                   algvkpgdrVaillpnspelvvallAvlkaGavyvplnpalpaerlayil
                   ++g++pgd Va+ +pn p + ++++++lkaGav+vpln+ l++++++y l
  AAZ56191.1    46 SRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPREIEYHL 95   

                   edsgakllltdd.....ellelllel..alpslklvivld..........
                   +dsgak+l++   + + +l e++ ++ +++   +l+i l++++ +++ ++
  AAZ56191.1    96 RDSGAKALFAFTgtpelPLGERAWQAfqEVAECELYIDLPaaagattsai 145  

                   ..llslddllaagsaalpavpvdpddlayilyTSGTTGkPKgvvlthrnl
                     + +++++l+ ++ +++ v+++ dd+a+i+yTSGTTG+PKg+ lth nl
  AAZ56191.1   146 pgAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNL 195  

                   lanalalaralllgltpgdrvlsflplfhdaglllellgalllGatlvll
                   l na+a  +++    +++d++l++lplfh++g++ ++ +al+  +t+vl+
  AAZ56191.1   196 LFNAVASSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLM 245  

                   sgfdperllelieeykvtvlflvPtllrlllkapeellaaldlsslrlll
                   ++fd +  l+l+e++kvt++++vPt+++ ll+a   +  +    +l++++
  AAZ56191.1   246 PRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAV 295  

                   sgGeplppellerlrelfgvrllngYGlTEttgvvtlllp....kpgsig
                   sgG+ lp+e+++++ e+fg+ +l+gYGl+Et++vv+++ p+ ++kpgsig
  AAZ56191.1   296 SGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPkrkaKPGSIG 345  

                   rplpgvevrivdpdeetgepvppgevGelvvrgppgvargYlndpeltae
                   +p++gve+++vd   e+ +  +   +Ge+ vrg ++v++gY+n+pe++a+
  AAZ56191.1   346 LPIWGVEMKLVD---ENFNTIEGEGPGEIAVRG-HCVMKGYHNRPEANAQ 391  

                   afvdgwyrTGDlgrldedgylyilGRlddqikigGeriepgeiEavllsh
                   +++dgw+rTGD++r+de+g+++i++R++d+i++gG++++p eiE+vl++h
  AAZ56191.1   392 VMRDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTH 441  

                   pavaeaavvgvpdedggerlvafvvlkpgaeldaeelraflrelrlppyk
                   p v  aavvgvp++ +ge ++afv++++ga+l+++el+a+++e rl++yk
  AAZ56191.1   442 PQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKE-RLAAYK 490  

                   vPrrivfvdelpltasgKidrralrelyellseldlllllllltlllllllltlhdlleraaartpdavalvfegr
                                            l+l  lle+ a+ +p++ a+vf++ 
  AAZ56191.1     2    ----------------------LNLSVLLEDGARNRPERDAIVFGDM 26   

                   tlTYaeldervnrlaaaLlalgvkpgdrValllpnspelvvallAvlkaG
                   +l Ya ++  +n++a+ L+++g++pgd Val +pn p + ++++++lkaG
  AAZ56191.1    27 RLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAG 76   

                   avyvplnpalpaerlayiledsgakllltdd.....dllelllelladlp
                   av+vpln+ l++++++y l+dsgak+l++   + + +l e++ ++ +++ 
  AAZ56191.1    77 AVVVPLNVLLTPREIEYHLRDSGAKALFAFTgtpelPLGERAWQAFQEVA 126  

                   vl....................lsleellaagsaalplvpvdpddlayil
                     + +++  +++ +++ ++  + +++++l  ++ +++ v+++ dd+a+i+
  AAZ56191.1   127 ECelyidlpaaagattsaipgaETFWAALNGQPGEFESVRTEGDDVAVII 176  

                   yTSGTTGlPKgvvlthrnllalalalalalg..ltpgdrvlsflplahda
                   yTSGTTG+PKg++lth nll +a+a  + ++++ +++d++l++lpl+h++
  AAZ56191.1   177 YTSGTTGQPKGAQLTHTNLLFNAVASSALFDqaPDSHDVFLTVLPLFHIF 226  

                   gl.lellaallaGatlvllsgpllfdperllelieeykvtvlflvPtllr
                   g + ++ aal+  +t+vl+++   fd +  l+l+e++kvt++++vPt++ 
  AAZ56191.1   227 GQtTMMNAALYRHGTMVLMPR---FDGDEALSLMEKEKVTIFAGVPTMYW 273  

                   lllka........dlsslrlllsgGeplppellerlre..gvrllngYGl
                    ll+a+ +++++++  +l++++sgG+ lp+e++++++e+ g+ +l+gYGl
  AAZ56191.1   274 GLLNAqgdhdikqISQTLHTAVSGGASLPAEVARKVKEkfGIEILEGYGL 323  

                   TEttvvvtlllpgdllpvkpgsigrplpgvevrivdedgrpvppgevGel
                   +Et++vv+++ p     +kpgsig p++gve+++vde+ +  +   +Ge+
  AAZ56191.1   324 SETSPVVSFNNP--KRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEI 371  

                   lvrgpgvargYlndpeltaeafvedpfspgdgwyrTGDlgrldedGylyi
                    vrg +v++gY+n+pe++a++++       dgw+rTGD++r+de+G+++i
  AAZ56191.1   372 AVRGHCVMKGYHNRPEANAQVMR-------DGWFRTGDIARRDEEGFYFI 414  

                   lGRlddqikigGeriepgeiEavllshpavaeaaVvgvpdelggerlvaf
                   ++R++d+i++gG++++p eiE+vl++hp v  aaVvgvp++ +ge ++af
  AAZ56191.1   415 IDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAF 464  

                   vvlkpg..llaeelraflrerlppykvPrrivfvdelpltasgKidrral
                   v++++g++l+++el+a+++erl++yk+Pr ++f  elp+ta+gKi++r+l
  AAZ56191.1   465 VIPAEGatLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKREL 514  

                   rellldeerllllllllltelllpgpltlhdllerqaartpdrvalifegegrr
                                         l+l  lle+ a+ +p+r a++f+  + r
  AAZ56191.1     2    -------------------LNLSVLLEDGARNRPERDAIVFG--DMR 27   

                   lTYaellervnrlaaaLlalgvkpgdrValllpnspelvvallAvlkaGa
                   l Ya ++  +n++a+ L+++g++pgd Val +pn p + ++++++lkaGa
  AAZ56191.1    28 LNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGA 77   

                   vyvplnptlpaerlayiledsgakllltdd.....dlldlllellaelps
                   v+vpln  l++++++y l+dsgak+l++   + + +l +++ ++++e+  
  AAZ56191.1    78 VVVPLNVLLTPREIEYHLRDSGAKALFAFTgtpelPLGERAWQAFQEVAE 127  

                   lklvivlddlllalllldglgvlslddllalgasaplplvpvdpddlayi
                    +l+i l  ++ a ++ +++g+ ++ ++l   ++ +++ v+++ dd+a+i
  AAZ56191.1   128 CELYIDLPAAAGA-TTSAIPGAETFWAALNG-QPGEFESVRTEGDDVAVI 175  

                   lyTSGTTGkPKgvvlthrnllanalalaeallllg..ltpgdrvlsflpl
                   +yTSGTTG+PKg++lth nll na+a  ++   ++++ +++d++l++lpl
  AAZ56191.1   176 IYTSGTTGQPKGAQLTHTNLLFNAVASSAL---FDqaPDSHDVFLTVLPL 222  

                   fhdagl.lellgallaGatlvllsgfdperllelieeykvtvlflvPtll
                   fh++g + ++ +al+  +t+vl+++fd +  l+l+e++kvt++++vPt++
  AAZ56191.1   223 FHIFGQtTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMY 272  

                   rlllkape..lagldlsslrlllsgGeplppellerlrelfpgvrllngY
                     ll+a  ++  +    +l++++sgG+ lp+e+++++ e+f g+ +l+gY
  AAZ56191.1   273 WGLLNAQGdhDIKQISQTLHTAVSGGASLPAEVARKVKEKF-GIEILEGY 321  

                   GlTEttvvvtllppg.dvkpgsigrplpgvevrivdpedgepvppgevGe
                   Gl+Et++vv+++ p    kpgsig+p++gve+++vd e+ +  +   +Ge
  AAZ56191.1   322 GLSETSPVVSFNNPKrKAKPGSIGLPIWGVEMKLVD-ENFNTIEGEGPGE 370  

                   lvvrgpgvargYlndpeltaeafvedgwyrTGDlgrldedGylyilGRld
                   + vrg +v++gY+n+pe++a+++ +dgw+rTGD++r+de+G+++i++R++
  AAZ56191.1   371 IAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSK 419  

                   dqikigGeriepgeiEavllshpavaeaaVvgvpdedggerlvafvvlkp
                   d+i++gG++++p eiE+vl++hp v  aaVvgvp++ +ge ++afv++++
  AAZ56191.1   420 DMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469  

                   gaeldeeelraflrerlppeykvPrrivfvdelpltasgKidrralrell
                   ga+l+e+el+a+++erl++ yk+Pr ++f  elp+ta+gKi++r+lr   
  AAZ56191.1   470 GATLTEDELIAWAKERLAA-YKYPRIVEFRTELPMTATGKILKRELRXX- 517  

                   adliellllsaellalllplnrtflplplltlhdllerqaartpdavalife
                                              l+l  lle+ a+ +p++ a++f+
  AAZ56191.1     2    ------------------------LNLSVLLEDGARNRPERDAIVFG 24   

                   grrlTYaellervnrlaaaLlalGvkpgdrVaillpnspelvvallAvlk
                   + rl Ya ++  +n++a+ L+++G++pgd Va+ +pn p + ++++++lk
  AAZ56191.1    25 DMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALK 74   

                   aGavyvplnpalpaeelayiledsgakllltddellellklllllellde
                   aGav+vpln  l+++e++y l+dsgak+l++  ++ el +   ++++++e
  AAZ56191.1    75 AGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQE 124  

                   lpslklvivldd........llgvlsledlla...aplplvpvdpddlay
                   +   +l i l+ ++ +++ +++g+ +++++l+ +  +++ v+++ dd+a+
  AAZ56191.1   125 VAECELYIDLPAaagattsaIPGAETFWAALNgqpGEFESVRTEGDDVAV 174  

                   ilyTSGTTGkPKgvvlthrnllanalalalal..gltpgdrvlsflplfh
                   i+yTSGTTG+PKg++lth nll na+a  + +++  +++d++l++lplfh
  AAZ56191.1   175 IIYTSGTTGQPKGAQLTHTNLLFNAVASSALFdqAPDSHDVFLTVLPLFH 224  

                   vfglsvlellgallaGatlvllsgfdperllelieeykvtvlflvPtllr
                   +fg  ++++ +al+  +t+vl+++fd +  l+l+e++kvt++++vPt++ 
  AAZ56191.1   225 IFGQ-TTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYW 273  

                   lllkapelagldls....slrlllsgGeplppellerlrelfgvrllngY
                    ll+a    ++d +++ ++l++++sgG+ lp+e++++++e+fg+ +l+gY
  AAZ56191.1   274 GLLNAQ--GDHDIKqisqTLHTAVSGGASLPAEVARKVKEKFGIEILEGY 321  

                   GlTEttvvvtlllpgldvkpgsiGrplpgvlevrivdpdgepvppgevGe
                   Gl+Et++vv+++ p    kpgsiG p++gv e+++vd++ +  +   +Ge
  AAZ56191.1   322 GLSETSPVVSFNNPKRKAKPGSIGLPIWGV-EMKLVDENFNTIEGEGPGE 370  

                   lvirgpgvargYlndpeltaeafvedgwyrTGDlgrldedGylyilGRld
                   + +rg +v++gY+n+pe++a+++ +dgw+rTGD++r+de+G+++i++R++
  AAZ56191.1   371 IAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSK 419  

                   dqikigGeriepgeiEavllshpavaeaavvgvpdedggerlvafvvlkp
                   d+i++gG++++p eiE+vl++hp v  aavvgvp++ +ge ++afv++++
  AAZ56191.1   420 DMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAE 469  

                   g.ellaeelraflrerllppykvPrrivfvdelpltasgKidrralrell
                   g++l+++el+a+++er l++yk+Pr ++f  elp+ta+gKi++r+lr   
  AAZ56191.1   470 GaTLTEDELIAWAKER-LAAYKYPRIVEFRTELPMTATGKILKRELRXX- 517  

                   adlilelpntelllpgpltlhdlleraaartpdrvalvfedegelrrlTyaell
                                l+l  lle+ a+ +p+r a+vf+d     rl ya ++
  AAZ56191.1     2    ----------LNLSVLLEDGARNRPERDAIVFGD----MRLNYALVN 34   

                   ervnrlaaaLlalgvkpgdrValllpnspelvvallAvlkaGavyvplnp
                     +n++a+ L+++g++pgd Val +pn p + ++++++lkaGav+vpln 
  AAZ56191.1    35 MIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNV 84   

                   alpaerlayiledsgakllltdd.....dllelllellaelpslklvivl
                    l++++++y l+dsgak+l++   + + +l e++ ++ +e+   +l+i l
  AAZ56191.1    85 LLTPREIEYHLRDSGAKALFAFTgtpelPLGERAWQAFQEVAECELYIDL 134  

                   d......dlallgllsledllaagp...plvpvdpddlayilyTSGTTGl
                   ++++ ++  a++g+ +++++l+ +p + + v+++ dd+a+i+yTSGTTG+
  AAZ56191.1   135 PaaagatTSAIPGAETFWAALNGQPgefESVRTEGDDVAVIIYTSGTTGQ 184  

                   PKgvvlthrnllanalalllalalgltpg..dvvlsflplfhdaglle.l
                   PKg++lth nll na+a    ++++  p+ +dv+l++lplfh++g + ++
  AAZ56191.1   185 PKGAQLTHTNLLFNAVA--SSALFDQAPDshDVFLTVLPLFHIFGQTTmM 232  

                   lgallaGatlvllsgrfdperlleliekykvtvlflvPtllrlllkape.
                    +al+  +t+vl++ rfd +  l+l+ek+kvt++++vPt++  ll+a  +
  AAZ56191.1   233 NAALYRHGTMVLMP-RFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQGd 281  

                   lagldls.slrlllsgGeplppellerlre.lgvrllngYGlTEttvvvt
                   ++    s++l++++sgG+ lp+e++++++e++g+ +l+gYGl+Et++vv+
  AAZ56191.1   282 HDIKQISqTLHTAVSGGASLPAEVARKVKEkFGIEILEGYGLSETSPVVS 331  

                   lllpglllllllldllalkpgsiGrplpgvevrivdpdgrpvppggeevG
                   ++ p +           +kpgsiG p++gve+++vd++ +  +     +G
  AAZ56191.1   332 FNNPKR----------KAKPGSIGLPIWGVEMKLVDENFNTIEGE--GPG 369  

                   elvvrgpgvargYlndpeltaeafvedgwyrTGDlgrldedGylyilGRl
                   e+ vrg +v++gY+n+pe++a+++ +dgw+rTGD++r+de+G+++i++R+
  AAZ56191.1   370 EIAVRGHCVMKGYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRS 418  

                   ddqikigGeriepgeiEavllshpavaeaavvgvpdedggerlvafvvlk
                   +d+i++gG++++p eiE+vl++hp v  aavvgvp++ +ge ++afv+++
  AAZ56191.1   419 KDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPA 468  

                   pgaeldaeelraflrerlppykvPrrivfvdelpltasgKidrraLrell
                   +ga+l+++el+a+++erl++yk+Pr ++f  elp+ta+gKi++r+Lr   
  AAZ56191.1   469 EGATLTEDELIAWAKERLAAYKYPRIVEFRTELPMTATGKILKRELRXX- 517  

                   ldlilellladpdlllsdldllslaeyelllewnvtdpelfwdelaelldwlkl
                                                                     
  AAZ56191.1     -    ----------------------------------------------- -    

                   ldlvlvldlllllpllrwflggrlntlhdllerqaartpdrpalifeddg
                                            +l  lle+ a+ +p+r a++f+d  
  AAZ56191.1     3 -------------------------NLSVLLEDGARNRPERDAIVFGD-- 25   

                   dgelrtlTYaeldervnrlAaaLralGvkpgdrVaillpnspelvvallA
                        +l Ya ++  +n++A+ L+++G++pgd Va+ +pn p + +++++
  AAZ56191.1    26 ----MRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFG 71   

                   vlkaGavyvplnptlpaerlayiledsgakllltddellellkeldlkel
                   +lkaGav+vpln  l++++++y l+dsgak+l++  ++    +el+l e 
  AAZ56191.1    72 ALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGT----PELPLGER 117  

                   vdealelaelpslktvivlddlglladlallgvlslddllaagsaelpav
                   + +a  ++e+   +  i l  ++ +   a++g+ ++ ++l+ ++ e++ v
  AAZ56191.1   118 AWQA--FQEVAECELYIDLPAAAGATTSAIPGAETFWAALNGQPGEFESV 165  

                   pvdpddlayilyTSGTTGkPKgvvlthrnllanaaallalalgltpg..d
                   +++ dd+a+i+yTSGTTG+PKg++lth nll na+a   + ++  p+ +d
  AAZ56191.1   166 RTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA-SSALFDQAPDshD 214  

                   rvlsflplahdaglllellgallaGatlvllsgapllfdperllelieey
                   ++l++lpl+h++g++ ++ +al+  +t+vl+++    fd +  l+l+e++
  AAZ56191.1   215 VFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPR----FDGDEALSLMEKE 260  

                   kvtvlflvPtllrlllkapeellapldlsslrlllsgGeplppellerlr
                   kvt++++vPt++  ll+a  ++  +    +l++++sgG+ lp+e++++++
  AAZ56191.1   261 KVTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVK 310  

                   elfpdlgvpllngYGlTEttgvvtlnppgalpvkpgsiGrplpgvevriv
                   e+f   g+ +l+gYGl+Et++vv++n p     kpgsiG p+ gve+++v
  AAZ56191.1   311 EKF---GIEILEGYGLSETSPVVSFNNPK-RKAKPGSIGLPIWGVEMKLV 356  

                   dpdgrpvppgevGeLvvrgplpgvarGYlndpeltaeafvadpdgwyrTG
                   d++ +  +   +Ge+ vrg   +v++GY+n+pe++a+++   +dgw+rTG
  AAZ56191.1   357 DENFNTIEGEGPGEIAVRG--HCVMKGYHNRPEANAQVM---RDGWFRTG 401  

                   DlgrldedGyleilGRkddqikigGeriepgeiEavLlahpavaeaavvg
                   D++r+de+G+++i++R++d+i++gG++++p eiE+vL++hp v  aavvg
  AAZ56191.1   402 DIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVG 451  

                   vpdedggerlvafvvlkpgaeldeellkelraflrerlppykvPrrivfv
                   vp++ +ge ++afv++++ga+l+e+   el+a+++erl++yk+Pr ++f 
  AAZ56191.1   452 VPHDTHGEEIKAFVIPAEGATLTED---ELIAWAKERLAAYKYPRIVEFR 498  

                   delpltasgKidrraLrelyadlieelydlsylapptaleellaaiwaadylalpelslsdlellweeeaelllvllnltavlllldlldlelll
                                                                     
  AAZ56191.1     -    ----------------------------------------------- -    

                   plakwflggllntlhdllerqaartpdrpalifedgldgelrrlTYaeld
                                   lle+ a+ +p+r a++f+d       rl Ya ++
  AAZ56191.1     7 ----------------LLEDGARNRPERDAIVFGDM------RLNYALVN 34   

                   ervnrlAaaLrsalGvkpgdrVaillpnspefvvallAvlkaGavyvpln
                     +n++A+ L+ ++G++pgd Va+ +pn p f ++++++lkaGav+vpln
  AAZ56191.1    35 MIANQVANLLV-SRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLN 83   

                   pglpaerlayiledsgakllltddellrggklidllelllealallpllk
                     l++++++y l+dsgak+l++  ++      ++l e++ +a +++   +
  AAZ56191.1    84 VLLTPREIEYHLRDSGAKALFAFTGT----PELPLGERAWQAFQEVAECE 129  

                   lvvvlddlllllllllllgllsleellaaasaalppvpvdpddlayilyT
                   l + l  ++  +++ +++g+ +++++l+ ++ +++ v+++ dd+a+i+yT
  AAZ56191.1   130 LYIDLPAAA-GATTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYT 178  

                   SGTTGkPKgVvlthrnlllalalalalalg..ltpgdvvlsflplfhdag
                   SGTTG+PKg++lth n ll +a+a  + ++++ +++dv+l++lplfh++g
  AAZ56191.1   179 SGTTGQPKGAQLTHTN-LLFNAVASSALFDqaPDSHDVFLTVLPLFHIFG 227  

                   lvlellgpllaGatlvllpglplrfdperlleliekyrvtvlflvPtllr
                   ++ ++ ++l+  +t+vl+p    rfd +  l l+ek++vt++ +vPt++ 
  AAZ56191.1   228 QTTMMNAALYRHGTMVLMP----RFDGDEALSLMEKEKVTIFAGVPTMYW 273  

                   lllkapeellakldlsslrlllsgGeplppellerfrelfglsgvrllng
                    ll+a  ++  k    +l++++sgG+ lp+e++++++e+fg   +++l+g
  AAZ56191.1   274 GLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG---IEILEG 320  

                   YGlTEttvvvtlnppglalpvkpgsiGrplpgvevrivdedtgepvpplg
                   YGl+Et++vv++n p   +  kpgsiG p++gve+++vde+  + +    
  AAZ56191.1   321 YGLSETSPVVSFNNPK--RKAKPGSIGLPIWGVEMKLVDEN-FNTIEG-E 366  

                   evGeLvirgplpgvarGYlndpeltaeafvadpdgwyrTGDlgrldedGy
                    +Ge+ +rg   +v++GY+n+pe++a++++   dgw+rTGD++r+de+G+
  AAZ56191.1   367 GPGEIAVRG--HCVMKGYHNRPEANAQVMR---DGWFRTGDIARRDEEGF 411  

                   leilGRkddqikigGeriepgeiEaaLlahpavaeaaVvgvpdelggerl
                   ++i++R++d+i++gG++++p eiE++L++hp+v  aaVvgvp++ +ge +
  AAZ56191.1   412 YFIIDRSKDMIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEI 461  

                   vafvvlkpgalldlaallllealaeelraflrerlppykvPraivfvdel
                   +afv++++ga+l+          ++el+a+++erl++yk+Pr ++f  el
  AAZ56191.1   462 KAFVIPAEGATLT----------EDELIAWAKERLAAYKYPRIVEFRTEL 501  

                   PltasgKidrraLrelyadlieelvapstlleealaeiwaevLgv