RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAZ54436.1 tfus0 AAZ54436.1 GIB00263CH01 "TatD-related
deoxyribonuclease"
         (306 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cjpA [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY          81   5e-18
3e2vB [x.x.x] 3'-5'-EXONUCLEASE                                        76   2e-16
3bq6B [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-                   72   2e-15
1bf6A [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN                      66   2e-13
3bq5A [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-                   59   1e-11
3bq6A [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-                   59   2e-11
3bq5B [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-                   57   6e-11
3e2vA [x.x.x] 3'-5'-EXONUCLEASE                                        56   2e-10
1dpmA [c.1.9] PHOSPHOTRIESTERASE                                       52   2e-09
2dvtC [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE                49   2e-08
2dvtA [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE                46   1e-07
3e3hA [x.x.x] PARATHION HYDROLASE                                      45   3e-07
2dvtB [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE                43   1e-06
2dvuC [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE                43   1e-06
3c86A [x.x.x] PHOSPHOTRIESTERASE                                       41   6e-06
2a3lA [x.x.x] AMP DEAMINASE                                            40   9e-06
2d2gA [x.x.x] PHOSPHOTRIESTERASE                                       40   1e-05
2eg6B [x.x.x] DIHYDROOROTASE                                           38   4e-05
1a4mA [c.1.9] ADENOSINE DEAMINASE                                      36   1e-04
2dvtD [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE                36   1e-04

>3cjpA [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY
          Length = 262

 Score = 80.8 bits (198), Expect = 5e-18
 Identities = 21/266 (7%), Positives = 49/266 (18%), Gaps = 54/266 (20%)

Query: 45  DVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPE 104
              E+      V       +       +        + + +      P            
Sbjct: 46  VKKEMKKLNDVVNGKTNSMIDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLS-------- 97

Query: 105 DEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGETGLDCYRTGPEGFDIQERSFR 164
           +  T                            K+  IGE      +         +    
Sbjct: 98  ENDTNSYIEENIVNN-----------------KLVGIGELTPASGQ--------IKSLKP 132

Query: 165 AHIAIAQRHGKALMIHDRDAHEDVL-----RVLEDAGAPERVVFHCFSGDAAMAKLCADR 219
                       + IH  +            + +       ++ H    +   A   A  
Sbjct: 133 IFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMGGSNWMTAVELAKE 192

Query: 220 GYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRA 279
              +    +  F  +  +               TD PF                  ++ A
Sbjct: 193 IQNLYLDTSAYF--STFVLKIVINELPLKCIFGTDMPFGDL-------------QLSIEA 237

Query: 280 LAELKGMAEDELAETVAANARRAFAL 305
           + ++           +  N  R   +
Sbjct: 238 IKKM-SNDSYVANAVLGDNISRLLNI 262


>3e2vB [x.x.x] 3'-5'-EXONUCLEASE
          Length = 362

 Score = 75.6 bits (184), Expect = 2e-16
 Identities = 47/357 (13%), Positives = 90/357 (25%), Gaps = 87/357 (24%)

Query: 34  DCHTHMDM------------QGGDVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAE- 80
           D   ++                 D  +++ +AA   V   +  G  +A S+ A++  +  
Sbjct: 6   DIGLNLTDPMFHGIYNGKQYHPADYVKLLERAAQRHVKNALVTGSSIAESQSAIELVSSV 65

Query: 81  ----HDTVWAAVALHPNEAPRIVHGVPED-EATXXXXXXXXXXXXXXXXXXXXXXXXXXX 135
                  ++  + +HP           E   A                            
Sbjct: 66  KDLSPLKLYHTIGVHPCCVNEFAEAYNESLYAKVISNPSFAQGKLKELYDLMNQQAKPHD 125

Query: 136 XKVCAIGETGLDCYRTGPEGFDIQERSFRAHI----AIAQRHGKALMIHDRDAHEDVLRV 191
               +IGE GLD  R      ++Q+  F   +       +     L +H R A +D +++
Sbjct: 126 TSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKISCLNDKLSSYPLFLHMRSACDDFVQI 185

Query: 192 LEDAG-------------------------APERVVFHCFSGDAAMAKLCADRGYYMSFA 226
           LE                               ++V H F+G A   +   +    +   
Sbjct: 186 LERFVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNLSPNIFIG 245

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRP------------------- 267
            N      ++                TDAP+   K                         
Sbjct: 246 VNGCSLRTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVRDFEYPAFKS 305

Query: 268 ---------------------NAPYLIPHTLRALAELKGMAEDELAETVAANARRAF 303
                                N P  +      ++E+K +    L +T      + F
Sbjct: 306 VKKNKLADKLNAEELYMVKGRNEPCNMEQVAIVVSEVKDVDLATLIDTTWKTTCKIF 362


>3bq6B [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
          Length = 718

 Score = 72.5 bits (177), Expect = 2e-15
 Identities = 16/245 (6%), Positives = 30/245 (12%), Gaps = 38/245 (15%)

Query: 35  CHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAE----HDTVWAAVAL 90
            H  +     +   ++              G + A               +         
Sbjct: 110 YHYLVPEIETEEFYLLENKPLEDYLFFKSKGIETAPWVIGPFTFLYLSKRNGEWIRRPNQ 169

Query: 91  HPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGETGLDCYR 150
                  +V    E                                K   + E    C  
Sbjct: 170 MEKLLESLVSVYKEVFEKLVENGC----------------------KEILVNEPAFVCDL 207

Query: 151 TGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPE-RVVFHCFSGD 209
                                     L +                        F     +
Sbjct: 208 E-----KAHWDLILNVYRELS--EFPLTVFTYYDSVSDYEACVSLPVKRLHFDFVSNEEN 260

Query: 210 AAMAKLCADRGYYMSFAGNVTFGSAQQ---LRDXXXXXXXXXXXXXTDAPFL-TPKPHRG 265
               +           AG +      +    +                 P    P     
Sbjct: 261 LKNLEKHGFPEDKKLVAGVINGRQPWKVDLRKVASLVEKLGASAISNSCPLFHLPVTLEL 320

Query: 266 RPNAP 270
             N P
Sbjct: 321 ENNLP 325


>1bf6A [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
          Length = 291

 Score = 65.6 bits (158), Expect = 2e-13
 Identities = 35/296 (11%), Positives = 69/296 (23%), Gaps = 42/296 (14%)

Query: 34  DCHTHMDMQGG------------DVAEIVAKAASVGVTPIIQVGCDVAGSRWAV---QAA 78
             H H+D+ G              + + +    + GV  +I++     G           
Sbjct: 11  HEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMR 70

Query: 79  AEHDTVWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKV 138
                V A    + +            +                              K 
Sbjct: 71  ETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTEL-----------KA 119

Query: 139 CAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDV-----LRVLE 193
             I E G    +  P     +E+ F A      + G+ +  H   +   +     L+   
Sbjct: 120 GIIAEIGTSEGKITPL----EEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHG 175

Query: 194 DAGAPERVVFHCFSGDAAMAKLCADRGYYMSFAGNVTFGS------AQQLRDXXXXXXXX 247
              +   V       +        D G Y+ F                 L          
Sbjct: 176 VDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLN 235

Query: 248 XXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRALAELKGMAEDELAETVAANARRAF 303
                 D    +     G     YL+   +  L +  G ++ ++   +  N  + F
Sbjct: 236 RVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQ-SGFSQADVDVMLRENPSQFF 290


>3bq5A [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
          Length = 709

 Score = 59.4 bits (143), Expect = 1e-11
 Identities = 19/252 (7%), Positives = 39/252 (15%), Gaps = 48/252 (19%)

Query: 34  DCHTHMDM----------QGGDVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEHDT 83
           + + H  +                E      S G+     V     G    +  +  +  
Sbjct: 107 NTNYHYLVPEIETEEFYLLENKPLEDYLFFKSKGIETAPWVI----GPFTFLYLSKRNGE 162

Query: 84  VWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGE 143
                         +V    E                                K   + E
Sbjct: 163 WIRRPNQMEKLLESLVSVYKEVFEKLVENGC----------------------KEILVNE 200

Query: 144 TGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGA-PERVV 202
               C           +     +  ++      L +                        
Sbjct: 201 PAFVCDLEK----AHWDLILNVYRELS---EFPLTVFTYYDSVSDYEACVSLPVKRLHFD 253

Query: 203 FHCFSGDAAMAKLCADRGYYMSFAGNVTFGSAQQL---RDXXXXXXXXXXXXXTDAPFL- 258
           F     +    +           AG +      ++   +                 P   
Sbjct: 254 FVSNEENLKNLEKHGFPEDKKLVAGVINGRQPWKVDLRKVASLVEKLGASAISNSCPLFH 313

Query: 259 TPKPHRGRPNAP 270
            P       N P
Sbjct: 314 LPVTLELENNLP 325


>3bq6A [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
          Length = 716

 Score = 59.1 bits (142), Expect = 2e-11
 Identities = 18/231 (7%), Positives = 35/231 (15%), Gaps = 38/231 (16%)

Query: 45  DVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPE 104
              E      S G+     V     G    +  +  +                +V    E
Sbjct: 128 KPLEDYLFFKSKGIETAPWVI----GPFTFLYLSKRNGEWIRRPNQMEKLLESLVSVYKE 183

Query: 105 DEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGETGLDCYRTGPEGFDIQERSFR 164
                                           K   + E    C     +       +  
Sbjct: 184 VFEKLVENGC----------------------KEILVNEPAFVCDL--EKAHWDLILNVY 219

Query: 165 AHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPER-VVFHCFSGDAAMAKLCADRGYYM 223
             ++        L +                        F     +    +         
Sbjct: 220 RELS-----EFPLTVFTYYDSVSDYEACVSLPVKRLHFDFVSNEENLKNLEKHGFPEDKK 274

Query: 224 SFAGNVTFGSAQQL---RDXXXXXXXXXXXXXTDAPFL-TPKPHRGRPNAP 270
             AG +      ++   +                 P    P       N P
Sbjct: 275 LVAGVINGRQPWKVDLRKVASLVEKLGASAISNSCPLFHLPVTLELENNLP 325


>3bq5B [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
          Length = 722

 Score = 57.1 bits (137), Expect = 6e-11
 Identities = 16/229 (6%), Positives = 28/229 (12%), Gaps = 40/229 (17%)

Query: 45  DVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPE 104
              E      S G+     V         +     E       +         +   V E
Sbjct: 128 KPLEDYLFFKSKGIETAPWVIGPFTFLYLSK-RNGEWIRRPNQMEKLLESLVSVYKEVFE 186

Query: 105 DEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGETGLDCYRTGPEGFDIQERSFR 164
                                           K   + E    C                
Sbjct: 187 KLV-------------------------ENGCKEILVNEPAFVCDLE-----KAHWDLIL 216

Query: 165 AHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGA--PERVVFHCFSGDAAMAKLCADRGYY 222
                       L +                                  + K        
Sbjct: 217 NVYRELSEFP--LTVFTYYDSVSDYEACVSLPVKRLHFDFVSNEENLKNLEKHGFPEDKK 274

Query: 223 MSFAGNVTFGSAQQL---RDXXXXXXXXXXXXXTDAPFLTPKPHRGRPN 268
           +  AG +      ++   +                 P     P      
Sbjct: 275 L-VAGVINGRQPWKVDLRKVASLVEKLGASAISNSCPLF-HLPVTLELE 321


>3e2vA [x.x.x] 3'-5'-EXONUCLEASE
          Length = 363

 Score = 55.6 bits (132), Expect = 2e-10
 Identities = 47/358 (13%), Positives = 89/358 (24%), Gaps = 87/358 (24%)

Query: 34  DCHTHMDMQGG------------DVAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEH 81
           D   ++                 D  +++ +AA   V   +  G  +A S+ A++  +  
Sbjct: 6   DIGLNLTDPMFHGIYNGKQYHPADYVKLLERAAQRHVKNALVTGSSIAESQSAIELVSSV 65

Query: 82  -----DTVWAAVALHPNEAPRIVHGVPED-EATXXXXXXXXXXXXXXXXXXXXXXXXXXX 135
                  ++  + +HP           E   A                            
Sbjct: 66  KDLSPLKLYHTIGVHPCCVNEFAEAYNESLYAKVISNPSFAQGKLKELYDLMNQQAKPHD 125

Query: 136 XKVCAIGETGLDCYRTGPEGFDIQERSFRAH----IAIAQRHGKALMIHDRDAHEDVLRV 191
               +IGE GLD  R      ++Q+  F           +     L +H R A +D +++
Sbjct: 126 TSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKISCLNDKLSSYPLFLHMRSACDDFVQI 185

Query: 192 LEDAGA-------------------------PERVVFHCFSGDAAMAKLCADRGYYMSFA 226
           LE                               ++V H F+G A   +   +    +   
Sbjct: 186 LERFVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNLSPNIFIG 245

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRP------------------- 267
            N      ++                TDAP+   K                         
Sbjct: 246 VNGCSLRTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVRDFEYPAFKS 305

Query: 268 ---------------------NAPYLIPHTLRALAELKGMAEDELAETVAANARRAFA 304
                                N P  +      ++E+K +    L +T      + F 
Sbjct: 306 VKKNKLADKLNAEELYMVKGRNEPCNMEQVAIVVSEVKDVDLATLIDTTWKTTCKIFG 363


>1dpmA [c.1.9] PHOSPHOTRIESTERASE
          Length = 329

 Score = 52.1 bits (123), Expect = 2e-09
 Identities = 28/207 (13%), Positives = 46/207 (22%), Gaps = 38/207 (18%)

Query: 137 KVCAIGETGLDCYR----TGPEGFDIQERSFRAHIAIAQRHGKALMIHD---RDAHEDVL 189
               I +TG+        T  +    QE   +A    +   G  +  H    +   E   
Sbjct: 120 IQYGIEDTGIRAGIIKVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQA 179

Query: 190 RVLEDAGAPER--VVFHCFSGDAA-MAKLCADRGYYMSFAGNVTFGS------------- 233
            + E  G       + H    D        A RGY +                       
Sbjct: 180 AIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPHSAIGLEDNASASALLG 239

Query: 234 -------AQQLRDXXXXXXXXXXXXXTDAPFLTPKPH-----RGRPNAPYLIPH---TLR 278
                  A  ++               D  F                 P  +      + 
Sbjct: 240 IRSWQTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVI 299

Query: 279 ALAELKGMAEDELAETVAANARRAFAL 305
                KG+ ++ LA     N  R  + 
Sbjct: 300 PFLREKGVPQETLAGITVTNPARFLSP 326


>2dvtC [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
          Length = 323

 Score = 48.8 bits (114), Expect = 2e-08
 Identities = 20/205 (9%), Positives = 36/205 (17%), Gaps = 35/205 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAG 196
                   G      G          +R      ++      +H R+      R+ +   
Sbjct: 118 GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP 177

Query: 197 APER------------------------------VVFHCFSGDAAMAKLCADRGYYMSFA 226
                                             ++ H   G   M      R  ++   
Sbjct: 178 WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP 237

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGR-----PNAPYLIPHTLRALA 281
                                     T                   + P+          
Sbjct: 238 PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF 297

Query: 282 ELKGMAEDELAETVAANARRAFALP 306
               +AE +  +    NARR F L 
Sbjct: 298 NATSIAEADRVKIGRTNARRLFKLD 322


>2dvtA [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
          Length = 325

 Score = 46.4 bits (108), Expect = 1e-07
 Identities = 20/204 (9%), Positives = 36/204 (17%), Gaps = 35/204 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAG 196
                   G      G          +R      ++      +H R+      R+ +   
Sbjct: 121 GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP 180

Query: 197 APER------------------------------VVFHCFSGDAAMAKLCADRGYYMSFA 226
                                             ++ H   G   M      R  ++   
Sbjct: 181 WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP 240

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGR-----PNAPYLIPHTLRALA 281
                                     T                   + P+          
Sbjct: 241 PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF 300

Query: 282 ELKGMAEDELAETVAANARRAFAL 305
               +AE +  +    NARR F L
Sbjct: 301 NATSIAEADRVKIGRTNARRLFKL 324


>3e3hA [x.x.x] PARATHION HYDROLASE
          Length = 335

 Score = 44.8 bits (104), Expect = 3e-07
 Identities = 23/207 (11%), Positives = 43/207 (20%), Gaps = 37/207 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDI---QERSFRAHIAIAQRHGKALMIHDRD------AHED 187
               I +TG+               QE   +A    +   G  +  H             
Sbjct: 125 IQYGIEDTGIRAGIIVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAA 184

Query: 188 VLRVLEDAGAPERVVFHCFSGDAAMAKLCADRGYYMSFAGNVTFGS-------------- 233
           +      + +   +     + D +     A RGY +                        
Sbjct: 185 IFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDRIPFSAIGLEDNASASALLGI 244

Query: 234 ------AQQLRDXXXXXXXXXXXXXTDAPFLTPK-----PHRGRPNAPYLIPHTLRALAE 282
                 A  ++               D  F                 P  +      +  
Sbjct: 245 RSWQTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIP 304

Query: 283 L---KGMAEDELAETVAANARRAFALP 306
               KG+ ++ LA     N  R  +  
Sbjct: 305 FLREKGVPQETLAGITVTNPARFLSPT 331


>2dvtB [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
          Length = 324

 Score = 43.0 bits (99), Expect = 1e-06
 Identities = 20/204 (9%), Positives = 36/204 (17%), Gaps = 35/204 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAG 196
                   G      G          +R      ++      +H R+      R+ +   
Sbjct: 121 GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP 180

Query: 197 APER------------------------------VVFHCFSGDAAMAKLCADRGYYMSFA 226
                                             ++ H   G   M      R  ++   
Sbjct: 181 WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP 240

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGR-----PNAPYLIPHTLRALA 281
                                     T                   + P+          
Sbjct: 241 PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF 300

Query: 282 ELKGMAEDELAETVAANARRAFAL 305
               +AE +  +    NARR F L
Sbjct: 301 NATSIAEADRVKIGRTNARRLFKL 324


>2dvuC [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
          Length = 324

 Score = 43.0 bits (99), Expect = 1e-06
 Identities = 20/205 (9%), Positives = 36/205 (17%), Gaps = 35/205 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAG 196
                   G      G          +R      ++      +H R+      R+ +   
Sbjct: 119 GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP 178

Query: 197 A------------------------------PERVVFHCFSGDAAMAKLCADRGYYMSFA 226
                                             ++ H   G   M      R  ++   
Sbjct: 179 WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP 238

Query: 227 GNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGR-----PNAPYLIPHTLRALA 281
                                     T                   + P+          
Sbjct: 239 PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF 298

Query: 282 ELKGMAEDELAETVAANARRAFALP 306
               +AE +  +    NARR F L 
Sbjct: 299 NATSIAEADRVKIGRTNARRLFKLD 323


>3c86A [x.x.x] PHOSPHOTRIESTERASE
          Length = 327

 Score = 40.7 bits (93), Expect = 6e-06
 Identities = 26/206 (12%), Positives = 46/206 (22%), Gaps = 37/206 (17%)

Query: 137 KVCAIGETGLDCYRTGPEGFDI---QERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLE 193
               I +TG+               QE   +A    +   G  +  H   +  D  +   
Sbjct: 121 IQHGIEDTGIRAGIIVATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAA 180

Query: 194 DA------GAPERVVFHCFSGDAAMAKLCADRGYYMSFAGNVTFGSA------------- 234
                    +   +     + D +     A RGY +                        
Sbjct: 181 IFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGLEGNASALALFGT 240

Query: 235 -------QQLRDXXXXXXXXXXXXXTDAPFLTPKPH--------RGRPNAPYLIPHTLRA 279
                    ++               D  F              R  P+    +P  +  
Sbjct: 241 RSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDVMDRINPDGMAFVPLRVIP 300

Query: 280 LAELKGMAEDELAETVAANARRAFAL 305
               KG+  + LA    AN  R  + 
Sbjct: 301 FLREKGVPPETLAGVTVANPARFLSP 326


>2a3lA [x.x.x] AMP DEAMINASE
          Length = 616

 Score = 40.0 bits (92), Expect = 9e-06
 Identities = 11/142 (7%), Positives = 27/142 (19%), Gaps = 9/142 (6%)

Query: 167 IAIAQRHGKALMIHDRDAHEDVLRVLEDAGA--PERVVFHCFSGDAAMAKLCADRGYYMS 224
                     L  H  +A +  +  L                     +  L       ++
Sbjct: 423 RESKGMTTITLRPHSGEAGD--IDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLA 480

Query: 225 FAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRALAELK 284
            +                          +    L+             +       A + 
Sbjct: 481 MSPLSNNSLFLDYHRNPFPVFFLRGLNVS----LSTDDPLQIHLTKEPLVEEYSIAASVW 536

Query: 285 GMAEDELAETVAANARRAFALP 306
            ++  +L E +A N+       
Sbjct: 537 KLSACDLCE-IARNSVYQSGFS 557


>2d2gA [x.x.x] PHOSPHOTRIESTERASE
          Length = 329

 Score = 39.7 bits (90), Expect = 1e-05
 Identities = 23/193 (11%), Positives = 43/193 (22%), Gaps = 34/193 (17%)

Query: 147 DCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLED------AGAPER 200
               T  +    QE   +A    +   G  +  H   +  D  +          + +   
Sbjct: 136 IKVATTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAAIFESEGLSPSRVC 195

Query: 201 VVFHCFSGDAAMAKLCADRGYYMSFAGNVTF--------------------GSAQQLRDX 240
           +     + D +     A RGY +                              A  ++  
Sbjct: 196 IGHSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGLEGNASALALFGTRSWQTRALLIKAL 255

Query: 241 XXXXXXXXXXXXTDAP-----FLTPKPHRGRPNAPYLIPHTL---RALAELKGMAEDELA 292
                        D       ++T          P  +             KG+  + LA
Sbjct: 256 IDRGYKDRILVSHDWLFGFSSYVTNIMDVMDRINPDGMAFVPLRVIPFLREKGVPPETLA 315

Query: 293 ETVAANARRAFAL 305
               AN  R  + 
Sbjct: 316 GVTVANPARFLSP 328


>2eg6B [x.x.x] DIHYDROOROTASE
          Length = 336

 Score = 37.8 bits (86), Expect = 4e-05
 Identities = 31/289 (10%), Positives = 56/289 (19%), Gaps = 19/289 (6%)

Query: 34  DCHTHMDMQGGDVAEIVAKAASVGVT----------PIIQVGCDVAGSRWAVQAAAEHDT 83
           D H H+    GD+ + V    S              P+  V   VA  +  + A      
Sbjct: 11  DWHLHLRD--GDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAGHD 68

Query: 84  VWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCAIGE 143
               +  +  ++                                             +  
Sbjct: 69  FTPLMTCYLTDSLDPNELERGFNEGVFTAALYPANHGVTSVDAIMPVLERMEKIGMPLLV 128

Query: 144 TGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAP---ER 200
            G   +                   + QR     ++ +    +D    + D         
Sbjct: 129 HGEVTHADIDIFDREARFIESVMEPLRQRLTALKVVFEHITTKDAADYVRDGNERLAATI 188

Query: 201 VVFHCFSGDAAMAKLCADRGYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTP 260
              H       M      R +             Q LR+               AP    
Sbjct: 189 TPQHLMFNRNHMLVG-GVRPHLYCLPILKRNIHQQALRELVASGFNRVFLGTDSAPHARH 247

Query: 261 KPHRGRPNAPYLIPHTLRALAE---LKGMAEDELAETVAANARRAFALP 306
           +       A      T          +  A        + N  + + LP
Sbjct: 248 RKESSCGCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLP 296


>1a4mA [c.1.9] ADENOSINE DEAMINASE
          Length = 349

 Score = 36.5 bits (82), Expect = 1e-04
 Identities = 14/146 (9%), Positives = 36/146 (24%), Gaps = 8/146 (5%)

Query: 163 FRAHIAIAQRHGKALMIH--DRDAHEDVLRVLEDAGAPERVVFHCFSGDAAMAKLCADRG 220
                  A ++G    +H  +  + E V   ++          +    D A+        
Sbjct: 194 HVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKEN 253

Query: 221 YYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRAL 280
            +       ++ +                    +                  +    +  
Sbjct: 254 MHFEVCPWSSYLTGAWDPK-----TTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMT 308

Query: 281 AELKGMAEDELAETVAANARRAFALP 306
            +  G  E+E  + +  NA ++  LP
Sbjct: 309 KKDMGFTEEEF-KRLNINAAKSSFLP 333


>2dvtD [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
          Length = 321

 Score = 36.2 bits (81), Expect = 1e-04
 Identities = 9/91 (9%), Positives = 18/91 (19%)

Query: 137 KVCAIGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAG 196
                   G      G          +R      ++      +H R+      R+ +   
Sbjct: 118 GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP 177

Query: 197 APERVVFHCFSGDAAMAKLCADRGYYMSFAG 227
                 +      A  A      G +     
Sbjct: 178 WLLGPTWAFAQETAVHALRLMASGLFDEHPR 208


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0421    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,543,117
Number of extensions: 1336502
Number of successful extensions: 16425
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8463
Number of HSP's successfully gapped: 371
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)