RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAZ55697.1 tfus0 AAZ55697.1 GIB00263CH01 "ABC-type Mn/Zn
transport systems ATPase component"
         (243 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                  139   1e-35
3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               134   2e-34
3cmvH [x.x.x] PROTEIN RECA                                            132   1e-33
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA[M...   130   4e-33
3dmdC [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                    129   9e-33
2bifA [c.37.1 - c.60.1] PROTEIN (6-PHOSPHOFRUCTO-2-KINASE/FRUCTO...   124   2e-31
2dwpA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                  124   2e-31
1bifA [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTO...   124   3e-31
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                 122   1e-30
2c03B [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     121   3e-30
3cmvG [x.x.x] PROTEIN RECA                                            119   7e-30
3c95A [x.x.x] EXODEOXYRIBONUCLEASE I                                  118   2e-29
3eiuA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          117   4e-29
2c61B [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B             117   5e-29
1d1cA [c.37.1 - b.34.3] MYOSIN                                        116   9e-29
3dmdB [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                    114   3e-28
2b8wA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          113   5e-28
1aroP [e.8.1] T7 RNA POLYMERASE                                       112   1e-27
3cmvC [x.x.x] PROTEIN RECA                                            112   1e-27
1e69A [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN                     111   2e-27
2ccgA [x.x.x] THYMIDYLATE KINASE                                      110   4e-27
2ccgB [x.x.x] THYMIDYLATE KINASE                                      109   7e-27
2b8tA [x.x.x] THYMIDINE KINASE                                        109   1e-26
2akaB [x.x.x] DYNAMIN-1                                               108   2e-26
3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2                         107   3e-26
2czvA [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3                      107   4e-26
3cmvA [x.x.x] PROTEIN RECA                                            106   6e-26
2a2zD [x.x.x] DEOXYCYTIDINE KINASE                                    106   6e-26
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               106   9e-26
3dm5A [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN                       104   2e-25
2bc9A [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1          104   2e-25
3b85A [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN                  104   3e-25
1e9cA [c.37.1] THYMIDYLATE KINASE                                     104   3e-25
2c04A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     103   4e-25
2a5gA [x.x.x] ADP-RIBOSYLATION FACTOR 6                               101   2e-24
2ccjB [x.x.x] THYMIDYLATE KINASE                                      101   3e-24
2c61A [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B             101   3e-24
1e98A [c.37.1] THYMIDYLATE KINASE                                     101   3e-24
2c03A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN                     100   4e-24
3b2qA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                          100   5e-24
2b8tB [x.x.x] THYMIDINE KINASE                                         99   1e-23
3dt2A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             99   1e-23
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          99   1e-23
1cr4A [c.37.1] DNA PRIMASE/HELICASE                                    98   2e-23
3eiuB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                           98   3e-23
2axzC [x.x.x] PRGX                                                     98   3e-23
1e9fA [c.37.1] THYMIDYLATE KINASE                                      97   5e-23
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN               96   9e-23
2cckA [x.x.x] THYMIDYLATE KINASE                                       96   1e-22
4dcgA [x.x.x] VP39                                                     95   2e-22
2ctsA [x.x.x] CITRATE SYNTHASE                                         95   2e-22
2c9yA [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL              95   2e-22
3d3kA [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3                     95   2e-22
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          94   4e-22
1e0jA [c.37.1] DNA HELICASE                                            94   5e-22
3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           93   7e-22
3dt4A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             93   8e-22
1e2dA [c.37.1] THYMIDYLATE KINASE                                      93   8e-22
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING             93   9e-22
1dkiA [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN                             93   1e-21
3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B                             92   1e-21
3b2qB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN                           91   3e-21
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          91   4e-21
1e9rA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          90   5e-21
2cgtH [x.x.x] 60 KDA GROEL                                             90   5e-21
1e9dA [c.37.1] THYMIDYLATE KINASE                                      90   6e-21
2a30B [x.x.x] DEOXYCYTIDINE KINASE                                     89   1e-20
1bg0A [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE                       89   1e-20
2a30D [x.x.x] DEOXYCYTIDINE KINASE                                     89   2e-20
2bdtA [x.x.x] BH3686                                                   89   2e-20
3bb1F [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            88   2e-20
1dg3A [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED GUANYLATE-B...    88   2e-20
3czpA [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2                          88   3e-20
2d4hA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           88   4e-20
1e3aB [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT                        87   4e-20
3d7wA [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1                       87   4e-20
2d4hB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           87   5e-20
2dr3A [x.x.x] UPF0273 PROTEIN PH0284                                   87   5e-20
2a2zA [x.x.x] DEOXYCYTIDINE KINASE                                     86   9e-20
3cr7C [x.x.x] ADENYLYL-SULFATE KINASE                                  86   1e-19
2a2zB [x.x.x] DEOXYCYTIDINE KINASE                                     86   1e-19
1e0jB [c.37.1] DNA HELICASE                                            85   2e-19
2b8tC [x.x.x] THYMIDINE KINASE                                         85   2e-19
3bb1B [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            85   2e-19
2d4uA [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I                    85   2e-19
2cjwB [x.x.x] GTP-BINDING PROTEIN GEM                                  85   2e-19
1e9sF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          85   3e-19
1e9sD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          84   4e-19
1dhjA [c.71.1] DIHYDROFOLATE REDUCTASE                                 83   7e-19
3bo6B [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN                        83   9e-19
1e3mA [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR P...    82   1e-18
3bb1C [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            82   2e-18
3cmxA [x.x.x] PROTEIN RECA                                             82   2e-18
2axpA [x.x.x] HYPOTHETICAL PROTEIN BSU20280                            82   2e-18
421pA [x.x.x] H-RAS P21 PROTEIN                                        82   2e-18
3dtbB [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             81   3e-18
1e9sG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          81   3e-18
2bkiA [x.x.x] UNCONVENTIONAL MYOSIN                                    81   3e-18
1d6jB [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE                       80   5e-18
3cmtD [x.x.x] PROTEIN RECA                                             80   6e-18
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                80   6e-18
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  80   7e-18
2cckB [x.x.x] THYMIDYLATE KINASE                                       80   8e-18
2d0kA [x.x.x] DIHYDROFOLATE REDUCTASE                                  79   1e-17
2d2eA [x.x.x] SUFC PROTEIN                                             79   1e-17
1b0uA [c.37.1] HISTIDINE PERMEASE                                      79   1e-17
2a5jA [x.x.x] RAS-RELATED PROTEIN RAB-2B                               79   1e-17
3cddD [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      79   1e-17
3dt7A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             79   1e-17
2b8wB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           79   1e-17
2a30A [x.x.x] DEOXYCYTIDINE KINASE                                     79   1e-17
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                79   1e-17
2b92B [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1           79   1e-17
1e9rE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          79   1e-17
2akaA [x.x.x] MYOSIN II HEAVY CHAIN                                    79   2e-17
1e2fA [c.37.1] THYMIDYLATE KINASE                                      78   3e-17
2dr3B [x.x.x] UPF0273 PROTEIN PH0284                                   78   3e-17
3cddF [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      78   4e-17
3bczC [x.x.x] PROTEIN MEMO1                                            77   4e-17
3cmvE [x.x.x] PROTEIN RECA                                             77   5e-17
1cr2A [c.37.1] DNA PRIMASE/HELICASE                                    77   5e-17
2bkhA [x.x.x] UNCONVENTIONAL MYOSIN                                    77   6e-17
3cddC [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      77   7e-17
1cr0A [c.37.1] DNA PRIMASE/HELICASE                                    77   7e-17
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          77   7e-17
2d2fA [x.x.x] SUFC PROTEIN                                             76   8e-17
1e9sJ [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          76   9e-17
3c8uA [x.x.x] FRUCTOKINASE                                             76   1e-16
2bx2L [x.x.x] RIBONUCLEASE E                                           76   1e-16
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  76   1e-16
1e3mB [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR P...    75   2e-16
2ck3C [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM                   75   2e-16
3dymA [x.x.x] BETA-GALACTOSIDASE                                       75   2e-16
3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           75   2e-16
3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           75   2e-16
3cr7A [x.x.x] ADENYLYL-SULFATE KINASE                                  75   2e-16
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING           75   3e-16
1dhiA [c.71.1] DIHYDROFOLATE REDUCTASE                                 74   3e-16
2c9oC [x.x.x] RUVB-LIKE 1                                              74   3e-16
1e9rD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          74   4e-16
1e9sB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          74   5e-16
2bv7A [x.x.x] GLYCOLIPID TRANSFER PROTEIN                              74   5e-16
1e2gA [c.37.1] THYMIDYLATE KINASE                                      74   6e-16
1ai4B [d.153.1] PENICILLIN AMIDOHYDROLASE                              74   6e-16
1e6cA [c.37.1] SHIKIMATE KINASE                                        73   7e-16
2bwjA [x.x.x] ADENYLATE KINASE 5                                       73   8e-16
3bb1A [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            73   8e-16
2c0bL [x.x.x] RIBONUCLEASE E                                           73   1e-15
2dr3E [x.x.x] UPF0273 PROTEIN PH0284                                   73   1e-15
2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                72   1e-15
3da4A [x.x.x] COLICIN-M                                                72   1e-15
3dt4C [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC             72   1e-15
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      72   1e-15
3adkA [x.x.x] ADENYLATE KINASE                                         72   2e-15
3czjA [x.x.x] BETA-GALACTOSIDASE                                       72   2e-15
1cfrA [x.x.x] RESTRICTION ENDONUCLEASE                                 72   2e-15
3ch4B [x.x.x] PHOSPHOMEVALONATE KINASE                                 71   3e-15
3cr7D [x.x.x] ADENYLYL-SULFATE KINASE                                  71   3e-15
5dfrA [x.x.x] DIHYDROFOLATE REDUCTASE                                  71   3e-15
3dfqA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         71   4e-15
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          70   6e-15
3dfoD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         70   6e-15
1cr1A [c.37.1] DNA PRIMASE/HELICASE                                    70   7e-15
1drbA [c.71.1] DIHYDROFOLATE REDUCTASE                                 70   7e-15
2bhjA [x.x.x] NITRIC OXIDE SYNTHASE                                    70   8e-15
3dfnC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         70   8e-15
1eilA [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE          70   8e-15
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  70   8e-15
3dfnA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         70   8e-15
3bb1E [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            69   1e-14
1aldA [c.1.10 (2aldA)] ALDOLASE A                                      69   1e-14
2dr3F [x.x.x] UPF0273 PROTEIN PH0284                                   69   1e-14
2eg5G [x.x.x] XANTHOSINE METHYLTRANSFERASE                             69   2e-14
3dftD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         68   2e-14
2dr3D [x.x.x] UPF0273 PROTEIN PH0284                                   68   2e-14
6aldA [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE                    68   3e-14
3dfqD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         67   4e-14
2bjbA [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE             67   4e-14
1e4yA [c.37.1 - g.41.2] ADENYLATE KINASE                               67   4e-14
1draA [c.71.1] DIHYDROFOLATE REDUCTASE                                 67   5e-14
2drcA [c.71.1] DIHYDROFOLATE REDUCTASE                                 67   5e-14
3cm0A [x.x.x] ADENYLATE KINASE                                         67   5e-14
3b55A [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN                       67   6e-14
3d3qB [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   67   6e-14
2dr3C [x.x.x] UPF0273 PROTEIN PH0284                                   67   7e-14
2boeX [x.x.x] ENDOGLUCANASE E-2                                        67   7e-14
1bmfC [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE        67   7e-14
3clvA [x.x.x] RAB5 PROTEIN, PUTATIVE                                   67   8e-14
3d1mA [x.x.x] SONIC HEDGEHOG PROTEIN                                   66   8e-14
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          66   8e-14
1cjaA [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)                         66   8e-14
3bjdB [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)                66   8e-14
3dfpC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         66   9e-14
2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB                66   9e-14
3ecpA [x.x.x] TN5 TRANSPOSASE                                          66   9e-14
1e59A [c.60.1] PHOSPHOGLYCERATE MUTASE                                 66   1e-13
3dftC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         66   1e-13
3dfpD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         66   1e-13
3dfnD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         66   1e-13
2c4rL [x.x.x] RIBONUCLEASE E                                           65   2e-13
2ahvA [x.x.x] PUTATIVE ENZYME YDIF                                     65   2e-13
2aumA [x.x.x] HYPOTHETICAL PROTEIN                                     65   2e-13
1e9sI [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          65   3e-13
3d3qA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   64   4e-13
2a1fF [x.x.x] URIDYLATE KINASE                                         64   5e-13
3dauA [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE                         64   6e-13
3cueF [x.x.x] GTP-BINDING PROTEIN YPT1                                 64   6e-13
1e9rG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          64   6e-13
3cr7B [x.x.x] ADENYLYL-SULFATE KINASE                                  64   6e-13
1d6jA [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE                       64   6e-13
2aunB [x.x.x] HYPOTHETICAL PROTEIN                                     63   7e-13
3cioD [x.x.x] TYROSINE-PROTEIN KINASE ETK                              63   8e-13
3dm9B [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     63   9e-13
1accA [x.x.x] ANTHRAX PROTECTIVE ANTIGEN                               63   1e-12
4atjA [a.93.1] PROTEIN (PEROXIDASE C1A)                                63   1e-12
2ausC [x.x.x] PSEUDOURIDINE SYNTHASE                                   62   1e-12
2d7vA [x.x.x] HYPOTHETICAL PROTEIN VCA0330                             62   1e-12
3bb1G [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            62   2e-12
2an9A [x.x.x] GUANYLATE KINASE                                         62   2e-12
1adoA [c.1.10] ALDOLASE                                                62   2e-12
2bofX [x.x.x] ENDOGLUCANASE E-2                                        62   2e-12
2c9gA [x.x.x] PENTON PROTEIN                                           62   2e-12
1e9rF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          62   2e-12
2czvB [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3                       62   2e-12
1ak2A [x.x.x] ADENYLATE KINASE ISOENZYME-2                             61   3e-12
3cbnA [x.x.x] CONSERVED PROTEIN MTH639                                 61   3e-12
1e9sL [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          61   3e-12
2d7vB [x.x.x] HYPOTHETICAL PROTEIN VCA0330                             61   3e-12
1e9sM [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          61   3e-12
3bwdD [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6                       61   4e-12
1afrA [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE         61   4e-12
3c15C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          61   4e-12
2dpyB [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE                          61   4e-12
1cs4C [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        61   4e-12
3bv4A [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         61   4e-12
2c7cH [x.x.x] 60 KDA CHAPERONIN                                        61   5e-12
1e9sH [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          61   5e-12
1bglA [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE     60   5e-12
3a00A [x.x.x] GUANYLATE KINASE                                         60   6e-12
3cnlA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         60   8e-12
3dfqC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         59   1e-11
3cmvB [x.x.x] PROTEIN RECA                                             59   1e-11
1culC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        59   1e-11
1e2iB [c.37.1] THYMIDINE KINASE                                        59   1e-11
2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                59   1e-11
2aumB [x.x.x] HYPOTHETICAL PROTEIN                                     59   1e-11
1akeA [c.37.1 - g.41.2] ADENYLATE KINASE                               59   2e-11
1e2iA [c.37.1] THYMIDINE KINASE                                        59   2e-11
3bpbA [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE                  59   2e-11
3dffA [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2             59   2e-11
1e2kA [c.37.1] THYMIDINE KINASE                                        58   2e-11
3dfoC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A                         58   3e-11
3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC                      58   3e-11
2anbA [x.x.x] GUANYLATE KINASE                                         58   4e-11
3be4A [x.x.x] ADENYLATE KINASE                                         57   6e-11
1dw9A [a.35.1 - d.72.1] CYANATE LYASE                                  57   6e-11
1dekA [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE                    57   7e-11
3ec1A [x.x.x] YQEH GTPASE                                              56   8e-11
1dekB [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE                    56   9e-11
1c9kC [c.37.1] ADENOSYLCOBINAMIDE KINASE                               56   9e-11
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                56   1e-10
2ancF [x.x.x] GUANYLATE KINASE                                         56   1e-10
1e9sE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          56   1e-10
2a1fC [x.x.x] URIDYLATE KINASE                                         56   1e-10
1cjtC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        56   2e-10
2ahwD [x.x.x] PUTATIVE ENZYME YDIF                                     55   2e-10
2a1fD [x.x.x] URIDYLATE KINASE                                         55   2e-10
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          55   2e-10
2b8tD [x.x.x] THYMIDINE KINASE                                         55   2e-10
1ek0A [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)                     55   2e-10
3dlbB [x.x.x] ARGONAUTE                                                55   2e-10
1av6A [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))                   55   3e-10
3d1mB [x.x.x] SONIC HEDGEHOG PROTEIN                                   54   4e-10
3bb1H [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            54   4e-10
3a00B [x.x.x] GUANYLATE KINASE                                         54   6e-10
2dpyA [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE                          54   6e-10
3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE                         53   6e-10
3c7kA [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT          53   8e-10
3dyoA [x.x.x] BETA-GALACTOSIDASE                                       53   9e-10
1e2kB [c.37.1] THYMIDINE KINASE                                        53   1e-09
3e8aC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          53   1e-09
3cmuA [x.x.x] PROTEIN RECA                                             53   1e-09
2dftA [x.x.x] SHIKIMATE KINASE                                         53   1e-09
3crmA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE                   52   1e-09
2ccjA [x.x.x] THYMIDYLATE KINASE                                       52   2e-09
2a1fE [x.x.x] URIDYLATE KINASE                                         52   2e-09
1azsC [c.37.1 - a.66.1] GS-ALPHA                                       52   2e-09
1e4vA [c.37.1 - g.41.2] ADENYLATE KINASE                               51   3e-09
3b9qA [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT          51   3e-09
3cmwC [x.x.x] PROTEIN RECA                                             51   3e-09
1dp0A [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE     51   3e-09
1dyhA [c.71.1] DIHYDROFOLATE REDUCTASE                                 51   4e-09
1e2nA [c.37.1] THYMIDINE KINASE                                        51   4e-09
1e9rB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          51   4e-09
2e85B [x.x.x] HYDROGENASE 3 MATURATION PROTEASE                        51   4e-09
2bhvD [x.x.x] COMB10                                                   51   5e-09
3di4A [x.x.x] UNCHARACTERIZED PROTEIN DUF1989                          51   5e-09
2dftC [x.x.x] SHIKIMATE KINASE                                         50   6e-09
1e9sA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          50   6e-09
2bhvA [x.x.x] COMB10                                                   50   7e-09
3cphA [x.x.x] RAS-RELATED PROTEIN SEC4                                 50   8e-09
3brwA [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1                         50   8e-09
2d4uB [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I                    50   8e-09
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1                50   9e-09
2ancD [x.x.x] GUANYLATE KINASE                                         49   1e-08
4dfrA [c.71.1] DIHYDROFOLATE REDUCTASE                                 49   1e-08
3cnnA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         49   1e-08
1e1qB [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE        49   2e-08
1eamA [c.66.1] PROTEIN (VP39)                                          48   2e-08
1ckvA [x.x.x] PROTEIN (PROTEIN B)                                      48   2e-08
3dm5B [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN                        48   3e-08
2ancB [x.x.x] GUANYLATE KINASE                                         48   4e-08
1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE                               47   5e-08
3c14C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT          47   7e-08
1d8jA [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA                  47   8e-08
3bb1D [x.x.x] TRANSLOCASE OF CHLOROPLAST 34                            46   9e-08
3b85B [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN                   46   9e-08
3ed8A [x.x.x] YELLOW FLUORESCENCE PROTEIN                              46   1e-07
1e9sK [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB                          45   2e-07
3cqcA [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107                      45   2e-07
1cjuC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        45   3e-07
1e2hB [c.37.1] THYMIDINE KINASE                                        45   3e-07
3dfdA [x.x.x] PROTEIN YQBN                                             45   3e-07
2a5vA [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)               44   4e-07
3cddA [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      43   8e-07
2aexA [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL            43   8e-07
2axnA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-                   43   8e-07
1cjvC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)        43   9e-07
2b0lC [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC                  43   1e-06
2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     43   1e-06
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                42   2e-06
2a5vB [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)               41   3e-06
3dmdA [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     41   5e-06
1d6aA [d.165.1] POKEWEED ANTIVIRAL PROTEIN                             40   7e-06
1e2lA [c.37.1] THYMIDINE KINASE                                        40   8e-06
1e2mA [c.37.1] THYMIDINE KINASE                                        40   9e-06
2e85A [x.x.x] HYDROGENASE 3 MATURATION PROTEASE                        39   1e-05
1e2lB [c.37.1] THYMIDINE KINASE                                        39   1e-05
2cdnA [x.x.x] ADENYLATE KINASE                                         39   2e-05
2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     39   2e-05
3e70C [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR                     39   2e-05
1e2jB [c.37.1] THYMIDINE KINASE                                        38   3e-05
2bwjB [x.x.x] ADENYLATE KINASE 5                                       38   3e-05
1e2hA [c.37.1] THYMIDINE KINASE                                        38   3e-05
1e2mB [c.37.1] THYMIDINE KINASE                                        37   6e-05
2bwjD [x.x.x] ADENYLATE KINASE 5                                       37   6e-05
3bjqB [x.x.x] PHAGE-RELATED PROTEIN                                    37   7e-05
1e2nB [c.37.1] THYMIDINE KINASE                                        37   7e-05
2bhvC [x.x.x] COMB10                                                   37   8e-05
1d2zD [a.77.1] DEATH DOMAIN OF TUBE                                    36   1e-04
1bccF [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE                   36   1e-04
2aqwA [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE           36   2e-04
1e2jA [c.37.1] THYMIDINE KINASE                                        36   2e-04
1dwmA [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR                   36   2e-04
3cddE [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN                      35   3e-04
2a78A [x.x.x] RAS-RELATED PROTEIN RAL-A                                35   3e-04
3ci2A [x.x.x] CHYMOTRYPSIN INHIBITOR 2                                 34   3e-04
1ckeA [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)                 34   4e-04
3dkvA [x.x.x] ADENYLATE KINASE                                         34   4e-04
2bsqE [x.x.x] TRAFFICKING PROTEIN A                                    34   4e-04
2bwjF [x.x.x] ADENYLATE KINASE 5                                       34   5e-04
3c85A [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX          34   5e-04
1chdA [x.x.x] CHEB METHYLESTERASE                                      34   6e-04
3bm2B [x.x.x] PROTEIN YDJA                                             33   8e-04
3c5vA [x.x.x] PROTEIN PHOSPHATASE METHYLESTERASE 1                     33   8e-04
3e3xA [x.x.x] BIPA                                                     33   8e-04
2c95B [x.x.x] ADENYLATE KINASE 1                                       33   0.001

>2dwoA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 449

 Score =  139 bits (349), Expect = 1e-35
 Identities = 14/212 (6%), Positives = 45/212 (21%), Gaps = 20/212 (9%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
             V+++ V           +       V  ++G    GK+ + K +   +       ++ 
Sbjct: 6   SRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVF 64

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                                 ++                      + RK    A    +
Sbjct: 65  N-------------------VGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDV 105

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
           +     +     +   +   R+R  +    A+              D     + +  ++ 
Sbjct: 106 KSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKI 165

Query: 187 MRDEGATLLVSTHDLAGVGELCDEAILLHRRV 218
              +      +      +  +           
Sbjct: 166 SSPDYKDCNSAEAMDDFMKRISCYEASYQPLD 197


>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  134 bits (339), Expect = 2e-34
 Identities = 63/228 (27%), Positives = 103/228 (45%), Gaps = 6/228 (2%)

Query: 5   PALEVREVTVRY--GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
             +  R +  RY     + LDN+ + I +G V G++G  GSGKSTL K I     P++G 
Sbjct: 2   HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQ 61

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVID-VVMMGRYGHMGLTRRPRKSDRDA 121
           V I G   A A  N L   V    Q +      +ID + +      +       K     
Sbjct: 62  VLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 121

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
              +  R G   +   Q   LSGGQR+R  IAR +     + + DE  + +D  SE  I+
Sbjct: 122 DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 181

Query: 182 RVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           R + ++  +G T+++  H L+ V +  D  I++ + +++  G    +L
Sbjct: 182 RNMHKIC-KGRTVIIIAHRLSTV-KNADRIIVMEKGKIVEQGKHKELL 227


>3cmvH [x.x.x] PROTEIN RECA
          Length = 1173

 Score =  132 bits (332), Expect = 1e-33
 Identities = 26/235 (11%), Positives = 54/235 (22%), Gaps = 3/235 (1%)

Query: 7   LEVREVTVRYGDVLALDNV--TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               +V       L+LD       +  G +  + G   SGK+TL   +      +     
Sbjct: 301 DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 360

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                 A          V     +          + +       G           A+  
Sbjct: 361 FIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTP 420

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
             E  G    +H  + A    Q  R            +  +++    +   +   +    
Sbjct: 421 KAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRR 480

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFG 238
                EG  ++ S   +  V             ++L     +       +     
Sbjct: 481 IGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEK 535



 Score = 95.1 bits (235), Expect = 2e-22
 Identities = 23/224 (10%), Positives = 44/224 (19%), Gaps = 8/224 (3%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
               E        L +      +  G +  + G   SGK+TL   +      +       
Sbjct: 610 SMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI 669

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
               A              + +  + P      + +          R    D   V    
Sbjct: 670 DAEHAL-DPIYARKLGVDIDNLLCSQPDTGEQALEICDA-----LARSGAVDVIVVDSVA 723

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
             T   ++       +S   RK A   +                         I R+   
Sbjct: 724 ALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAV 783

Query: 187 MRDE-GATLLVSTHDLAGVGELCDE-AILLHRRVLAHGSPDRVL 228
              E           +        + A               ++
Sbjct: 784 KEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 827



 Score = 52.7 bits (125), Expect = 1e-09
 Identities = 18/213 (8%), Positives = 45/213 (21%), Gaps = 37/213 (17%)

Query: 19  VLALDNVTVEIG--RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKN 76
            L+LD      G   G +  + G   SGK+TL   +      +           A     
Sbjct: 8   SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY 67

Query: 77  GLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAH 136
                    + +  + P      + +                       ++         
Sbjct: 68  AR-KLGVDIDNLLCSQPDTGEQALEICD---------ALARSGAVDVIVVDSVAALTPKA 117

Query: 137 RQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLV 196
              G +S        +++ + +                        +   ++     L+ 
Sbjct: 118 EIEGEISHMGLAARMMSQAMRK------------------------LAGNLKQSNTLLIF 153

Query: 197 STHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                  +       + + R   +  G      
Sbjct: 154 INQGGNALKFYASVRLDIRRIGAVKEGENVVGS 186



 Score = 50.8 bits (120), Expect = 4e-09
 Identities = 27/211 (12%), Positives = 58/211 (27%), Gaps = 23/211 (10%)

Query: 29   IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR-KNGLLGYVPQSEQ 87
            +  G +  + G   SGK+TL   +      +           A        LG       
Sbjct: 931  LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDID--N 988

Query: 88   VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
            +  + P      + +              +   AV + +    +  L       +S   R
Sbjct: 989  LLCSQPDTGEQALEICD----------ALARSGAV-DVIVVDSVAALTPLAARMMSQAMR 1037

Query: 148  KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL------ 201
            K A   +       +  +++    +   +   +         EG  ++ S   +      
Sbjct: 1038 KLAGNLK--QSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK 1095

Query: 202  -AGVGELCDEAILLHRRVLAHGSPDRVLVPE 231
             A   +  +  IL    +  +G    + V E
Sbjct: 1096 IAAPFKQAEFQILYGEGINFYGELVDLGVKE 1126


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
           MSBA[MASQUE : MEMB(X) 137 / COIL(x) 0]
          Length = 572

 Score =  130 bits (328), Expect = 4e-33
 Identities = 53/247 (21%), Positives = 87/247 (35%), Gaps = 12/247 (4%)

Query: 2   TTPPALEVREVTVRYGDV--LALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
                LE R VT  Y      AL N+ ++I  G    L+G +GSGKST+   I       
Sbjct: 328 RATGDLEFRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDID 387

Query: 60  SGHVRIHG--LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKS 117
            GH+ + G  L             +       +   V                     + 
Sbjct: 388 EGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARM 447

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
                       GL  +       LSGGQR+R  IAR + + + + +LDE  +       
Sbjct: 448 AYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSA-LDTES 506

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLA-HGSPDRVL----VPEL 232
              ++   +   +  T LV  H L+ + E  DE +++   ++   G+   +L    V   
Sbjct: 507 ERAIQAALDELQKNRTSLVIAHRLSTI-EQADEIVVVEDGIIVERGTHSELLAQHGVYAQ 565

Query: 233 MLRA-FG 238
           + +  FG
Sbjct: 566 LHKMQFG 572


>3dmdC [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 318

 Score =  129 bits (325), Expect = 9e-33
 Identities = 30/241 (12%), Positives = 60/241 (24%), Gaps = 28/241 (11%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
              E     +     + L     +  +  V   +G NGSGK+T +  +A  +      V 
Sbjct: 96  AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVV 155

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
           I                       D      +  +    +   + + +    +D  AVA 
Sbjct: 156 IAA--------------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAY 195

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
              +          +   +G       +   + + A V   +      D  +   IV   
Sbjct: 196 DAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQA 255

Query: 185 REM-RDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL------VPELMLRA 236
           R+         ++ T   A        +I       +      +          E  L  
Sbjct: 256 RQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLER 315

Query: 237 F 237
            
Sbjct: 316 I 316


>2bifA [c.37.1 - c.60.1] PROTEIN
           (6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 432

 Score =  124 bits (312), Expect = 2e-31
 Identities = 13/179 (7%), Positives = 37/179 (20%), Gaps = 19/179 (10%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
           +  ++G    GK+ + K +   +       R                         +   
Sbjct: 4   LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFN-------------------VGQYRRD 44

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
           +                  + RK    A    + +    +  H  +   +   R+R  + 
Sbjct: 45  MVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMI 104

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAI 212
               +             VD       +  ++    +             +  +     
Sbjct: 105 FNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYEN 163


>2dwpA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 431

 Score =  124 bits (312), Expect = 2e-31
 Identities = 13/208 (6%), Positives = 46/208 (22%), Gaps = 23/208 (11%)

Query: 21  ALDNVTVEIGRG---VVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNG 77
            +  + V +       V  ++G    GK+ + K +   +       ++  +         
Sbjct: 6   RVQKIWVPVDHRNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGE------- 58

Query: 78  LLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHR 137
                       +                      + RK    A    ++     +    
Sbjct: 59  ------------YRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQI 106

Query: 138 QIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVS 197
            +   +   R+R  +    A+              D     + +  ++    +      +
Sbjct: 107 AVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSA 166

Query: 198 THDLAGVGELCDEAILLHRRVLAHGSPD 225
                 +  +       ++ +       
Sbjct: 167 EAMDDFMKRISCY-EASYQPLDPDKCDR 193


>1bifA [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
           FRUCTOSE-2,6-
          Length = 432

 Score =  124 bits (311), Expect = 3e-31
 Identities = 13/185 (7%), Positives = 38/185 (20%), Gaps = 19/185 (10%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
             +  ++G    GK+ + K +   +       R   +                     + 
Sbjct: 2   PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQ-------------------YR 42

Query: 92  FPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAF 151
             +                  + RK    A    + +    +  H  +   +   R+R  
Sbjct: 43  RDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRA 102

Query: 152 IARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEA 211
           +     +             VD       +  ++    +             +  +    
Sbjct: 103 MIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYE 162

Query: 212 ILLHR 216
                
Sbjct: 163 NSYES 167


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score =  122 bits (306), Expect = 1e-30
 Identities = 42/233 (18%), Positives = 81/233 (34%), Gaps = 13/233 (5%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           L ++++ V   D   L  +++++  G V  ++G NGSGKSTL  T+A     +     + 
Sbjct: 2   LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 67  G-------LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR 119
                   L P      G +    Q          +      +             + D 
Sbjct: 62  FKGKDLLALSPEDRAGEG-IFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDF 120

Query: 120 DAVAEAL---ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
             + E      +     L        SGG++KR  I +       + +LDE  +     +
Sbjct: 121 QDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSLDI-DA 179

Query: 177 ERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            + +   +  +RD   + ++ TH         D   +L++ R++  G    V 
Sbjct: 180 LKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGDFTLVK 232


>2c03B [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 297

 Score =  121 bits (303), Expect = 3e-30
 Identities = 29/228 (12%), Positives = 65/228 (28%), Gaps = 22/228 (9%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
           TP  + +  V     + L  +     +    +  L+G  GSGK+T    +A     +   
Sbjct: 69  TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
             +                       D   P     + ++G    + +         +++
Sbjct: 129 PLLVA--------------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI 168

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
              +E     +     +   +G  +    +   +A+   V   DE    +D  + +  + 
Sbjct: 169 RRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALS 228

Query: 183 VLREMRDE-GATLLVSTHDLAGVGELCDEAILL-HRRVLAHGSPDRVL 228
           V R   ++ G T LV T            +      + +         
Sbjct: 229 VARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKP 276


>3cmvG [x.x.x] PROTEIN RECA
          Length = 1167

 Score =  119 bits (299), Expect = 7e-30
 Identities = 20/231 (8%), Positives = 44/231 (19%), Gaps = 10/231 (4%)

Query: 2   TTPPALEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
                    +V         L +      +  G +  + G   SGK+TL   +      +
Sbjct: 298 MRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE 357

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR 119
                                     + +  + P      + +          R    D 
Sbjct: 358 GKTCAFID-AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICD-----ALARSGAVDV 411

Query: 120 DAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT 179
             V      T   ++       +S   RK A   +                         
Sbjct: 412 IVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLD 471

Query: 180 IVRVLR-EMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           I R+   +  +           +        +                 ++
Sbjct: 472 IRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 522



 Score =  118 bits (297), Expect = 1e-29
 Identities = 26/233 (11%), Positives = 49/233 (21%), Gaps = 13/233 (5%)

Query: 3   TPPALEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                   +V         L +      +  G +  + G   SGK+TL   +      + 
Sbjct: 598 RLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG 657

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                     A          V     +          + +           R    D  
Sbjct: 658 KTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDAL------ARSGAVDVI 711

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
            V      T   ++       +S   RK A   +                         I
Sbjct: 712 VVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDI 771

Query: 181 VRVLREMRDEGA----TLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            R+      E      T +    +         E  +L+   +  +G    + 
Sbjct: 772 RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLG 824



 Score =  103 bits (256), Expect = 7e-25
 Identities = 21/223 (9%), Positives = 48/223 (21%), Gaps = 7/223 (3%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
           V  ++     +         +  G +  + G   SGK+TL   +      +         
Sbjct: 1   VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA 59

Query: 69  PPAQARKNGLLG-YVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
             A              +              + +               D  A      
Sbjct: 60  EHALDPIYARKLGVDIDNLLCSQPDTGE--QALEICDALARSGAVDVIVVDSVAALTPKA 117

Query: 128 RTG-LTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
                   +H  + A    Q  R            +  +++    +   +   +      
Sbjct: 118 EIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIG 177

Query: 187 MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
              EG  ++ S   +  V +    A        + +G      
Sbjct: 178 AVKEGENVVGSETRVKVV-KNKIAAPFKQAEFQILYGEGINFY 219



 Score = 79.7 bits (195), Expect = 8e-18
 Identities = 30/236 (12%), Positives = 55/236 (23%), Gaps = 13/236 (5%)

Query: 8    EVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
               E        L +      +  G +  + G   SGK+TL   +      +        
Sbjct: 904  MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID 963

Query: 68   LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
               A          V     +                   + +     +S    V     
Sbjct: 964  AEHALDPIYARKLGVDIDNLLCS---------QPDTGEQALEICDALARSGAVDVIVVDS 1014

Query: 128  RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
               LT LA R +             +  +            F    +   R I  V    
Sbjct: 1015 VAALTPLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGE 1074

Query: 188  RD--EGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLE 240
                    + V  + +A       E  +L+   +  +G    + V E ++   G  
Sbjct: 1075 NVVGSETRVKVVKNKIA-APFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAW 1129


>3c95A [x.x.x] EXODEOXYRIBONUCLEASE I
          Length = 446

 Score =  118 bits (296), Expect = 2e-29
 Identities = 17/197 (8%), Positives = 44/197 (22%), Gaps = 18/197 (9%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LP 69
                  +  +       +    +      K  +L     L    +  + I+        
Sbjct: 251 MVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNL 310

Query: 70  PAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMG------RYGHMGLTRRPRKSDRDAVA 123
                   +   V            ++ +           +       R     D   V 
Sbjct: 311 KILRENPQVREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVD 370

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT---- 179
           + +E+      A    G L   +++R    R          L      +    ++     
Sbjct: 371 KRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTP--EFLQGYADELQMLVQQYADDK 428

Query: 180 -IVRVLREMRDEGATLL 195
             V +L+ +      ++
Sbjct: 429 EKVALLKALWQYADEIV 445


>3eiuA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 418

 Score =  117 bits (293), Expect = 4e-29
 Identities = 24/249 (9%), Positives = 57/249 (22%), Gaps = 30/249 (12%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                              ++  + T  + RG    +  A+G   + +   IA   +   
Sbjct: 88  GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG 147

Query: 61  GHVRIHGLPPAQ----ARKNGLLGYVPQSEQVDW---------------------AFPVR 95
                  +  A           +    ++  ++                      A    
Sbjct: 148 SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAA 207

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
                  G +  + LT     ++                 + + G + G +     I   
Sbjct: 208 EYLAYEHGMHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKGAKGSVTQIPIL 267

Query: 156 IAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLH 215
              G  +       +G         + V RE+      +    + L  +  L +  I   
Sbjct: 268 SMPGDDITHPIPDLSGYIT---EGQIVVARELH--RKGIYPPINVLPSLSRLMNSGIGAG 322

Query: 216 RRVLAHGSP 224
           +    H + 
Sbjct: 323 KTREDHKAV 331


>2c61B [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
          Length = 425

 Score =  117 bits (292), Expect = 5e-29
 Identities = 19/252 (7%), Positives = 50/252 (19%), Gaps = 32/252 (12%)

Query: 4   PPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
                           ++  + T  + RG    +  A+G   + +   IA   +      
Sbjct: 91  MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSES 150

Query: 64  RIHGLP----PAQARKNGLLGYVPQSEQVDWAFPVRVI---------------------- 97
               +              +    ++  ++ A     +                      
Sbjct: 151 AFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYL 210

Query: 98  DVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIA 157
                     +             +             + + G + G +     I     
Sbjct: 211 AYEHGMHVLVILTDITNYAEALRQMGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSM 270

Query: 158 QGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR- 216
            G  +       +G     +  + R L                 +    L +  I   + 
Sbjct: 271 PGDDITHPIPDLSGYITEGQIVVARELHRKG----IYPPINVLPSLS-RLMNSGIGAGKT 325

Query: 217 RVLAHGSPDRVL 228
           R       D++ 
Sbjct: 326 REDHKAVSDQMY 337


>1d1cA [c.37.1 - b.34.3] MYOSIN
          Length = 744

 Score =  116 bits (289), Expect = 9e-29
 Identities = 23/215 (10%), Positives = 62/215 (28%), Gaps = 4/215 (1%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
            +          ++  +     + G +G+GK+   K + + +   +G  +   L     +
Sbjct: 154 IFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQ 213

Query: 75  KNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDL 134
            N +L     ++        R    + +       ++    +S     +  + ++     
Sbjct: 214 ANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERN 273

Query: 135 AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATL 194
            H     L  G       A  +A   +   L++      K    +    +   R     +
Sbjct: 274 YHI-FYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKIT--RQAMDIV 330

Query: 195 LVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
             S  +   + ++    + L   +         VL
Sbjct: 331 GFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVL 365



 Score = 44.1 bits (102), Expect = 4e-07
 Identities = 3/77 (3%), Positives = 12/77 (15%), Gaps = 1/77 (1%)

Query: 134 LAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE-MRDEGA 192
                       ++  + + +           +      D      IV    +    +  
Sbjct: 5   DRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTV 64

Query: 193 TLLVSTHDLAGVGELCD 209
                        +   
Sbjct: 65  DGQDRQVKKDDANQRNP 81


>3dmdB [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 320

 Score =  114 bits (285), Expect = 3e-28
 Identities = 28/226 (12%), Positives = 59/226 (26%), Gaps = 22/226 (9%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
              E     +     + L     +  +  V   +G NGSGK+T +  +A  +      V 
Sbjct: 98  AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVV 157

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
           I                       D      +  +    +   + + +    +D  AVA 
Sbjct: 158 IAA--------------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAY 197

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
              +          +   +G       +   + + A V   +      D  +   IV   
Sbjct: 198 DAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQA 257

Query: 185 REMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           R+  +      ++ T   A        +I       +      +  
Sbjct: 258 RQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGY 303


>2b8wA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 288

 Score =  113 bits (283), Expect = 5e-28
 Identities = 21/255 (8%), Positives = 46/255 (18%), Gaps = 15/255 (5%)

Query: 3   TPPALEVREVTVRYG-DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           T P   +     R   +  AL  ++      VV  ++G   +GKS L+  +A      S 
Sbjct: 3   TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSL 62

Query: 62  HVRIHGLPPA------QARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYG------HMG 109
              +               K      V    +                            
Sbjct: 63  GSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFV 122

Query: 110 LTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPF 169
                  + +              +  + +             +  +         DE  
Sbjct: 123 YNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYL 182

Query: 170 AGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRV 227
               K  + T  +                               L    ++         
Sbjct: 183 TYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEF 242

Query: 228 LVPELMLRAFGLEEP 242
           +       ++     
Sbjct: 243 VQQVADFCSYIFSNS 257


>1aroP [e.8.1] T7 RNA POLYMERASE
          Length = 774

 Score =  112 bits (280), Expect = 1e-27
 Identities = 11/122 (9%), Positives = 29/122 (23%), Gaps = 7/122 (5%)

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL-TDLAHRQIGALSGGQRKRAFIAR 154
               + +              +D      A E+  L  +              ++  I  
Sbjct: 3   DFSDIELAAI------PFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLLITT 56

Query: 155 GIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILL 214
            + +               +    T  + L+E++ E    +     LA +    +  +  
Sbjct: 57  LLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQA 116

Query: 215 HR 216
             
Sbjct: 117 VA 118


>3cmvC [x.x.x] PROTEIN RECA
          Length = 1175

 Score =  112 bits (279), Expect = 1e-27
 Identities = 27/233 (11%), Positives = 52/233 (22%), Gaps = 13/233 (5%)

Query: 3   TPPALEVREVTVRYG--DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                   +V         L +      +  G +  + G   SGK+TL   +      + 
Sbjct: 606 RLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG 665

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                     A          V   + +  + P      + +          R    D  
Sbjct: 666 KTCAFIDAEHALDPIYARKLGV-DIDNLLCSQPDTGEQALEICDALA-----RSGAVDVI 719

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
            V      T   ++       +S   RK A   +                         I
Sbjct: 720 VVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDI 779

Query: 181 VRVLREMRDE----GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            R+      E      T +    +         E  +L+   +  +G    + 
Sbjct: 780 RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLG 832



 Score = 99.8 bits (247), Expect = 7e-24
 Identities = 25/245 (10%), Positives = 55/245 (22%), Gaps = 23/245 (9%)

Query: 5    PALEVREVTVRYGDVLALD--NVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
                  +V       L+LD       +  G +  + G   SGK+TL   +      +   
Sbjct: 907  GEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT 966

Query: 63   VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
                    A                      V + +++                  R   
Sbjct: 967  CAFIDAEHALDPIY------------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGA 1014

Query: 123  AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
             + +    +  L       +S   RK             +  +++    +   +   +  
Sbjct: 1015 VDVIVVDSVAALTPLAARMMSQAMRK--LAGNLKQSNTLLIFINQGGNALKFYASVRLDI 1072

Query: 183  VLREMRDE-----GATLLVSTHDLAGVGELCDEAILLHR--RVLAHGSPDRVLVPELMLR 235
                   E     G+   V                 +     +  +G    + V E ++ 
Sbjct: 1073 RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIE 1132

Query: 236  AFGLE 240
              G  
Sbjct: 1133 KAGAW 1137



 Score = 82.8 bits (203), Expect = 9e-19
 Identities = 25/227 (11%), Positives = 52/227 (22%), Gaps = 4/227 (1%)

Query: 2   TTPPALEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
                    +V         L +      +  G +  + G   SGK+TL   +      +
Sbjct: 298 MRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE 357

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR 119
                      A          V     +          + +       G          
Sbjct: 358 GKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSV 417

Query: 120 DAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT 179
            A+    E  G    +H  + A    Q  R            +  +++    +   +   
Sbjct: 418 AALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVR 477

Query: 180 IVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPD 225
           +         EG  ++ S   +  V +    A        + +G   
Sbjct: 478 LDIRRIGAVKEGENVVGSETRVKVV-KNKIAAPFKQAEFQILYGEGI 523



 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 19/223 (8%), Positives = 43/223 (19%), Gaps = 38/223 (17%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
           V  ++     +         +  G +  + G   SGK+TL   +      +         
Sbjct: 1   VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA 59

Query: 69  PPAQARKNGL-LGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
             A        LG    +              +         +         D+VA    
Sbjct: 60  EHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIV----VDSVAALT- 114

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL-RE 186
                                         +      + +   G+        +R L   
Sbjct: 115 -----------------------------PKAEIEGEIGDSHMGLAARMMSQAMRKLAGN 145

Query: 187 MRDEGATLLVSTHDLAGVGELCD-EAILLHRRVLAHGSPDRVL 228
           ++     L+        +         +     +  G      
Sbjct: 146 LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGS 188


>1e69A [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
          Length = 263

 Score =  111 bits (279), Expect = 2e-27
 Identities = 31/256 (12%), Positives = 72/256 (28%), Gaps = 54/256 (21%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR-----IHGL 68
           +      +    ++      V  ++G NGSGKS ++  I  +   +   +      +   
Sbjct: 6   LYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA 65

Query: 69  PPAQARKNGLLGYVPQS--------------------------------------EQVDW 90
             A            +                                       +    
Sbjct: 66  GSAYVELVF--EENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSI 123

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
               ++  +V   +  +    R                        +++  LSGG++   
Sbjct: 124 VGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALV 183

Query: 151 FIARGIA----QGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGE 206
            +A   A    + +  ++LDE  + +D  +     R+L+E   +    +V TH+   + E
Sbjct: 184 GLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVM-E 241

Query: 207 LCDEAILLHRRVLAHG 222
             D    +    + +G
Sbjct: 242 AADLLHGV---TMVNG 254


>2ccgA [x.x.x] THYMIDYLATE KINASE
          Length = 202

 Score =  110 bits (276), Expect = 4e-27
 Identities = 22/199 (11%), Positives = 47/199 (23%), Gaps = 15/199 (7%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
                G  GSGK+T++  +   +      +                      E++     
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVP-----------TGEEIRKIVL 51

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
                 +           R           +  +           +      +       
Sbjct: 52  EGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEV 111

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAIL 213
           R + + A   L  +    ++  +E    R+++  RD+             V E   E I 
Sbjct: 112 RALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIH 171

Query: 214 LHR----RVLAHGSPDRVL 228
                   V A    + V+
Sbjct: 172 NESQRFKSVNADQPLENVV 190


>2ccgB [x.x.x] THYMIDYLATE KINASE
          Length = 199

 Score =  109 bits (274), Expect = 7e-27
 Identities = 14/203 (6%), Positives = 43/203 (21%), Gaps = 17/203 (8%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
                  G  GSGK+T++  +   +      +           +                
Sbjct: 2   SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIR-----------KI 50

Query: 92  FPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAF 151
                   +           R           +  +           +      +     
Sbjct: 51  VLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVE 110

Query: 152 IARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHD--LAGVGELC 208
             R + + A   L  +    ++  +E    R+++  +  E         +     +    
Sbjct: 111 EVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIEGYQEIIHNES 170

Query: 209 DEAILLHR-RVLA--HGSPDRVL 228
                ++  + L        + +
Sbjct: 171 QRFKSVNADQPLENVVEDTYQTI 193


>2b8tA [x.x.x] THYMIDINE KINASE
          Length = 206

 Score =  109 bits (272), Expect = 1e-26
 Identities = 22/207 (10%), Positives = 53/207 (25%), Gaps = 17/207 (8%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL---LGYVPQSEQV 88
           G +  + G   +GK+  L      +        +            +    G    S +V
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEV 61

Query: 89  DWAFPVRVI-------DVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGA 141
           + A  +          D   +     +           + +AE      ++ L     G 
Sbjct: 62  ESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGE 121

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL 201
             G   K    A  I +   +       A        ++ ++  +  D    ++      
Sbjct: 122 PFGPIAKLFTYADKITKLTAICNECGAEAT------HSLRKIDGKHADYNDDIVKIGCQE 175

Query: 202 AGVGELCDEAILLHRRVLAHGSPDRVL 228
                +C     +  R   + + +  +
Sbjct: 176 F-YSAVCRHHHKVPNRPYLNSNSEEFI 201


>2akaB [x.x.x] DYNAMIN-1
          Length = 299

 Score =  108 bits (270), Expect = 2e-26
 Identities = 20/230 (8%), Positives = 54/230 (23%), Gaps = 9/230 (3%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
            ++  +  R  D  +      ++    +  ++G   +GKS++L+          G   + 
Sbjct: 2   EDLIPLVNRLQDAFSAIGQNADLDLPQI-AVVGGQSAGKSSVLENFVGRDFLPRGSGIVT 60

Query: 67  GLPPAQARKNGL---LGYVPQSEQ-----VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSD 118
             P      N       ++    +      +    +      + G    +       +  
Sbjct: 61  RRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVY 120

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
              V                       + +   +           +L    A  D  +  
Sbjct: 121 SPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSD 180

Query: 179 TIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
            +            T+ V T             +L ++ +        V+
Sbjct: 181 ALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVV 230


>3czpB [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
          Length = 452

 Score =  107 bits (268), Expect = 3e-26
 Identities = 24/206 (11%), Positives = 61/206 (29%), Gaps = 7/206 (3%)

Query: 16  YGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARK 75
              +  L          +V    G + +GK   ++ + + + P+  H+     P  + R 
Sbjct: 240 QARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERA 299

Query: 76  NGLLGYVPQSEQVDWAF---PVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
              L    +       F          V++ R           ++  +      + +   
Sbjct: 300 QPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYG 359

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGA 192
            +  +   A+    ++R F  R         + +E +   DK  +   V  + ++ D  +
Sbjct: 360 IIVVKFWLAIDKQTQER-FKEREKTPYKRYKITEEDWRNRDKWDQ--YVDAVGDV-DRTS 415

Query: 193 TLLVSTHDLAGVGELCDEAILLHRRV 218
           T +     +    +      +L    
Sbjct: 416 TEIAPWTLVEANDKRFARVKVLRTIN 441



 Score = 68.2 bits (165), Expect = 2e-14
 Identities = 12/126 (9%), Positives = 27/126 (21%), Gaps = 9/126 (7%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
             V E+     +      +  +    V+  + G  G+GK   +K + E            
Sbjct: 17  KAVIELREALLEAQ--FELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFL 74

Query: 67  G-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
                 L      +      +P   +    F      +                    + 
Sbjct: 75  RPSDEELERPPQWRFW--RRLPPKGRTGIFFGNWYSQLYARVEGHIKEAKLDQAIDAAER 132

Query: 122 VAEALE 127
                +
Sbjct: 133 FERLCD 138


>2czvA [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
          Length = 208

 Score =  107 bits (267), Expect = 4e-26
 Identities = 19/208 (9%), Positives = 50/208 (24%), Gaps = 22/208 (10%)

Query: 21  ALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLG 80
            +  + ++I       L           +K   E+   +    R      A    N    
Sbjct: 5   GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPS 64

Query: 81  YVPQSEQVDWAFPVRVID----------VVMMGRYGHMGLTRRPRKSDRDAVAEALERTG 130
            V  + Q   ++ + V               +       + R+    D       +++  
Sbjct: 65  LVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNV 124

Query: 131 LTDLAHRQIGALSGGQRKRAF------IARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
               + R +   +  +R                     FL        D    R ++ + 
Sbjct: 125 ALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG 184

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAI 212
             +   G  +  +   ++      +  +
Sbjct: 185 VVI---GMEIPQAKASIS---MYPEIIL 206


>3cmvA [x.x.x] PROTEIN RECA
          Length = 1190

 Score =  106 bits (265), Expect = 6e-26
 Identities = 22/228 (9%), Positives = 54/228 (23%), Gaps = 10/228 (4%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
           +    +++V  ++     +         +  G +  + G   SGK+TL   +      + 
Sbjct: 623 LGEDRSMDVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG 681

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                     A               +        ++          + +     +S   
Sbjct: 682 KTCAFIDAEHALDPIYA---------RKLGVDIDNLLCSQPDTGEQALEICDALARSGAV 732

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
            V        LT  A   + A    Q  R            +  +++    +   +   +
Sbjct: 733 DVIVVDSVAALTPKAEIGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRL 792

Query: 181 VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
                    EG  ++ S   +  V              + +G      
Sbjct: 793 DIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFY 840



 Score = 97.5 bits (241), Expect = 4e-23
 Identities = 24/243 (9%), Positives = 55/243 (22%), Gaps = 21/243 (8%)

Query: 5    PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
                  E        L +      +  G +  + G   SGK+TL   +      +     
Sbjct: 924  DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 983

Query: 65   IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                  A              + +  + P      + +                R    +
Sbjct: 984  FIDAEHALDPIY-ARKLGVDIDNLLCSQPDTGEQALEI-----------CDALARSGAVD 1031

Query: 125  ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI---- 180
             +    +  L       +S   RK A   +       +  +++    +   +   +    
Sbjct: 1032 VIVVDSVAALTPLAARMMSQAMRKLAGNLK--QSNTLLIFINQGGNALKFYASVRLDIRR 1089

Query: 181  -VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLH--RRVLAHGSPDRVLVPELMLRAF 237
               V       G+   V                 +     +  +G    + V E ++   
Sbjct: 1090 IGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA 1149

Query: 238  GLE 240
            G  
Sbjct: 1150 GAW 1152



 Score = 94.4 bits (233), Expect = 3e-22
 Identities = 20/222 (9%), Positives = 45/222 (20%), Gaps = 38/222 (17%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
           V  ++     +         +  G +  + G   SGK+TL   +      +         
Sbjct: 1   VETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA 59

Query: 69  PPAQARKN-GLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
             A        LG    +              +         +         D+VA    
Sbjct: 60  EHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIV----VDSVAALT- 114

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE- 186
                                         +      + +   G+        +R L   
Sbjct: 115 -----------------------------PKAEIEGEIGDSHMGLAARMMSQAMRKLAGN 145

Query: 187 MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRV 227
           ++     L+        +       + + R   +  G     
Sbjct: 146 LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVG 187



 Score = 38.1 bits (87), Expect = 3e-05
 Identities = 18/97 (18%), Positives = 25/97 (25%), Gaps = 24/97 (24%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLL--------------------GANGSGK 45
           AL   E     G ++ L          +  G L                    G   SGK
Sbjct: 284 ALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGK 343

Query: 46  STLLKTIAELVTPQSGHVRIHGL----PPAQARKNGL 78
           +TL   +      +              P  ARK G+
Sbjct: 344 TTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGV 380


>2a2zD [x.x.x] DEOXYCYTIDINE KINASE
          Length = 220

 Score =  106 bits (265), Expect = 6e-26
 Identities = 18/198 (9%), Positives = 38/198 (19%), Gaps = 12/198 (6%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLL---GYVPQSEQ 87
           R     + G   +GKST +  + +L                    N L        +   
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
               +         +       +    R    D    A        +   +         
Sbjct: 61  TFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD 120

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKP--------SERTIVRVLREMRDE-GATLLVST 198
                     +   +  L                   +   +  L ++  +  + LL  T
Sbjct: 121 WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT 180

Query: 199 HDLAGVGELCDEAILLHR 216
                        + L  
Sbjct: 181 LKTNFDYLQEVPILTLDV 198


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score =  106 bits (264), Expect = 9e-26
 Identities = 41/251 (16%), Positives = 86/251 (34%), Gaps = 29/251 (11%)

Query: 3   TPPALEVREVTVRY-----------GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKT 51
           +   + +  VT  +                L ++  +I RG +  + G+ G+GK++LL  
Sbjct: 1   STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMM 60

Query: 52  IAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLT 111
           I   + P  G ++  G                       +    ++   +      +   
Sbjct: 61  IMGELEPSEGKIKHSG------------------RISFCSQNSWIMPGTIKENIIGVSYD 102

Query: 112 RRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAG 171
               +S   A     + +   +  +  +  LSGGQR R  +AR + + A ++LLD PF  
Sbjct: 103 EYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGY 162

Query: 172 VDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPE 231
           +D  +E+ I            T ++ T  +  + +     IL       +G+   +    
Sbjct: 163 LDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLR 222

Query: 232 LMLRAFGLEEP 242
               +  +   
Sbjct: 223 PDFSSKLMSFD 233


>3dm5A [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
          Length = 416

 Score =  104 bits (261), Expect = 2e-25
 Identities = 21/227 (9%), Positives = 58/227 (25%), Gaps = 24/227 (10%)

Query: 5   PALEVREVTVRY--GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
               + ++        +           +  +  ++G  GSGK+T +  +A     +   
Sbjct: 71  KKEHIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYK 130

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
           V +                       D   P     +  +    H+ +   P++ D   +
Sbjct: 131 VGV--------------------VCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKL 170

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
           A+       +      I   +G  ++   +   + Q + V    E    +D    +    
Sbjct: 171 AKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYN 230

Query: 183 VLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRV 227
                ++      ++ T            + +      +        
Sbjct: 231 QALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEK 277


>2bc9A [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 294

 Score =  104 bits (260), Expect = 2e-25
 Identities = 24/226 (10%), Positives = 53/226 (23%), Gaps = 23/226 (10%)

Query: 2   TTPPALEVREVTVRYG-DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
            T P   +     R   +  AL  ++      VV  ++G   +GKS L+  +A      S
Sbjct: 6   MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS 65

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
               +                     +  W + V                     +   +
Sbjct: 66  LGSTVQS-----------------HTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDN 108

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
                +    +   +     ++    ++       + +          F         T+
Sbjct: 109 QNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTL 168

Query: 181 VRVLREMRDE-----GATLLVSTHDLAGVGELCDEAILLHRRVLAH 221
                ++  +         L  +  L       DE   L R  +  
Sbjct: 169 RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRK 214


>3b85A [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
          Length = 180

 Score =  104 bits (260), Expect = 3e-25
 Identities = 23/179 (12%), Positives = 44/179 (24%), Gaps = 3/179 (1%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQA 73
           V     L   +    I    +   LG  GSGK+ L     + +  +     I   P  +A
Sbjct: 1   VIRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA 60

Query: 74  RKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTD 133
            +           +        V   V+      +          R      +      +
Sbjct: 61  GEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQN 120

Query: 134 LAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR--VLREMRDE 190
               Q      G   +     G+       L         + +   +VR  ++  + D 
Sbjct: 121 TTPAQKFLTRLGFGSKVVTGDGLRL-VRHILRGVDDVHFSELTSSDVVRHQLVGHIVDA 178


>1e9cA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score =  104 bits (259), Expect = 3e-25
 Identities = 23/196 (11%), Positives = 44/196 (22%), Gaps = 11/196 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q +    
Sbjct: 2   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 61

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
              V       +    +        K         +                +       
Sbjct: 62  DHSVH------LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCK 115

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
               G+ +   V  L    A   K   R      R          +       + +    
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAK---RGAFGHERYENGAFQERAL-RCFHQLMKDTTLN 171

Query: 211 AILLHR-RVLAHGSPD 225
             ++   + +     D
Sbjct: 172 WKMVDASKSIEAVHED 187


>2c04A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 297

 Score =  103 bits (258), Expect = 4e-25
 Identities = 31/232 (13%), Positives = 69/232 (29%), Gaps = 23/232 (9%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
           TP  + +  V     + L  +     +    +  L+G  GSGK+T    +A     +   
Sbjct: 69  TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
             +                       D   P     + ++G    + +         +++
Sbjct: 129 PLLVA--------------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI 168

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
              +E     +     +   +G  +    +   +A+   V   DE    +D  + +  + 
Sbjct: 169 RRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALS 228

Query: 183 VLREMRDE-GATLLVSTHDLAGVGELCDEAILL--HRRVLAHGSPDRVLVPE 231
           V R   ++ G T LV T            +      + +   G  ++    E
Sbjct: 229 VARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE 280


>2a5gA [x.x.x] ADP-RIBOSYLATION FACTOR 6
          Length = 162

 Score =  101 bits (252), Expect = 2e-24
 Identities = 12/160 (7%), Positives = 42/160 (26%), Gaps = 4/160 (2%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP----PAQARKNGLLGYVPQSE 86
           + +   +LG + +GK+T+L  +    +  +       +              +G + +  
Sbjct: 1   KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIR 60

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
            +   +      ++ +            R+     + +   R  +  +   +       +
Sbjct: 61  PLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK 120

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
                   G+ +        +P            +  L  
Sbjct: 121 PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS 160


>2ccjB [x.x.x] THYMIDYLATE KINASE
          Length = 195

 Score =  101 bits (252), Expect = 3e-24
 Identities = 18/193 (9%), Positives = 49/193 (25%), Gaps = 12/193 (6%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
                G  GSGK+T++  +   +      +           +      +  ++  D    
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDM-DIRTE 61

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
             +                           +  +           +      +       
Sbjct: 62  AMLFAASRRE----------HLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEV 111

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAIL 213
           R + + A   L  +    ++  +E    R+++  R +   L      + G  E+      
Sbjct: 112 RALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRFKS 171

Query: 214 LHR-RVLAHGSPD 225
           ++  + L +   D
Sbjct: 172 VNADQPLENVVED 184


>2c61A [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
          Length = 431

 Score =  101 bits (251), Expect = 3e-24
 Identities = 26/225 (11%), Positives = 50/225 (22%), Gaps = 4/225 (1%)

Query: 4   PPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
                           ++  + T  + RG    +  A+G   + +   IA   +      
Sbjct: 90  MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSES 149

Query: 64  RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
               +  A    N                      VV +       + R          A
Sbjct: 150 AFAVVFAAMGITNEE---AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAA 206

Query: 124 EALERTGLTDLAHRQIGALSGGQRKR-AFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
           E L       +        +  +  R    AR    G   +                IV+
Sbjct: 207 EYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVK 266

Query: 183 VLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
             +    +   L +   D+          I   + V+A     + 
Sbjct: 267 GAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKG 311


>1e98A [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score =  101 bits (251), Expect = 3e-24
 Identities = 23/214 (10%), Positives = 48/214 (22%), Gaps = 11/214 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q +    
Sbjct: 3   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 62

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                    V +    +        K         +                +       
Sbjct: 63  DH------SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 116

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
               G+ +   V  L    A   K       R                     + +    
Sbjct: 117 QPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF----QERALRCFHQLMKDTTLN 172

Query: 211 AILLHR-RVLAHGSPDRVLVPELMLRAFGLEEPA 243
             ++   + +     +  ++ E  +R    +   
Sbjct: 173 WKMVDASKRIEAVHEEIRVLSEDAIRTATEKPLG 206


>2c03A [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
          Length = 295

 Score =  100 bits (250), Expect = 4e-24
 Identities = 31/243 (12%), Positives = 68/243 (27%), Gaps = 28/243 (11%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
           TP  + +  V     + L  +     +    +  L+G  GSGK+T    +A     +   
Sbjct: 69  TPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR 128

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
             +                       D   P     + ++G    + +         +++
Sbjct: 129 PLLVA--------------------ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI 168

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
              +E     +     +   +G  +    +   +A+   V   DE    +D  + +  + 
Sbjct: 169 RRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALS 228

Query: 183 VLRE-MRDEGATLLVSTHDLAGVGELCDEAILL--HRRVLAHGSPDRVLVP-----ELML 234
           V R      G T LV T            +      + +   G  ++         E + 
Sbjct: 229 VARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLA 288

Query: 235 RAF 237
              
Sbjct: 289 GRI 291


>3b2qA [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 436

 Score =  100 bits (249), Expect = 5e-24
 Identities = 19/215 (8%), Positives = 46/215 (21%), Gaps = 6/215 (2%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                              ++  + T  + RG    +  A+G   + +   IA   +   
Sbjct: 91  GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG 150

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                  +  A    N    Y     +   A    V+ + +              +    
Sbjct: 151 SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLA--DDPAVERIVTPRMALT 208

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
           A        G+  L             ++   AR              +   D  +    
Sbjct: 209 AAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVP---GRRGYPGYMYTDLATLYER 265

Query: 181 VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLH 215
             +++  +    T +                +  +
Sbjct: 266 AGIVKGAK-GSVTQIPILSMPGDDITHPIPDLSGY 299


>2b8tB [x.x.x] THYMIDINE KINASE
          Length = 189

 Score = 99.3 bits (246), Expect = 1e-23
 Identities = 19/196 (9%), Positives = 46/196 (23%), Gaps = 12/196 (6%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
           G +  + G   +GK+  L      +        +       + +      +       + 
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVEVESAPEILN-----YI 56

Query: 92  FPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAF 151
                 D   +     +           + +AE      ++ L     G   G   K   
Sbjct: 57  MSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFT 116

Query: 152 IARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEA 211
            A  I +   +       A          +R +     +    +V          +C   
Sbjct: 117 YADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCRHH 169

Query: 212 ILLHRRVLAHGSPDRV 227
             +  R   + + +  
Sbjct: 170 HKVPNRPYLNSNSEEF 185


>3dt2A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 621

 Score = 99.2 bits (245), Expect = 1e-23
 Identities = 25/257 (9%), Positives = 53/257 (20%), Gaps = 21/257 (8%)

Query: 1   MTTPPALEVREVTVRY----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
                AL +     +      + + +  +T   G+         +  GK+ L      L 
Sbjct: 241 GKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLP 300

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
             +   V           +  L    P++     A    V       +      T     
Sbjct: 301 GWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKT-IQKNTIFTNV 359

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
           ++        E           I +    + +           +           +D   
Sbjct: 360 AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW 419

Query: 177 ERTIVRVLREM-----RDEGATLLVSTHDLAGVGELC-------DEAILLHRRVLAHGSP 224
           E      +  +     R  G  L+           +          A     +V+ H   
Sbjct: 420 ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF 479

Query: 225 DRVL----VPELMLRAF 237
                        L  +
Sbjct: 480 AMRPFFGYNFGKYLAHW 496


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score = 99.1 bits (245), Expect = 1e-23
 Identities = 35/244 (14%), Positives = 75/244 (30%), Gaps = 9/244 (3%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           +++++ VT  +G+V+   ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I
Sbjct: 2   SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 61

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                           + +        P+  +      R        R  K     +   
Sbjct: 62  GEKRMNDTPPAERGVGMVEPSVFLLDEPLSNL--DAALRVQMRIEISRLHKRLGRTMIYV 119

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLD-----EPFAGVDKPSERTI 180
                       +I  L  G+  +      +        +           +      T 
Sbjct: 120 THDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA 179

Query: 181 VRVLREMRDEG-ATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFG 238
           +  ++          +    +   V    + ++ +    +L     D +L  E+ +    
Sbjct: 180 IDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQL 239

Query: 239 LEEP 242
             E 
Sbjct: 240 GNET 243


>1cr4A [c.37.1] DNA PRIMASE/HELICASE
          Length = 243

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 27/235 (11%), Positives = 57/235 (24%), Gaps = 26/235 (11%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
                  V + +     +++ T+    G V  +   +G GKST ++  A       G   
Sbjct: 8   HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKV 67

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                                 +         +  +          + +    +     +
Sbjct: 68  GL-----------------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQ 110

Query: 125 ALERTGLTDLAHRQIGALSGGQ--RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
             +     D  H                        G  V +LD         +  T ++
Sbjct: 111 WFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLK 170

Query: 183 VLREMRDEGATLLVSTHDLAG----VGELCDEAILLHR-RVLAHGSPDRVLVPEL 232
                +  G  L+V  H        + +L D  I L R +++           + 
Sbjct: 171 --GFAKSTGVVLVVICHLKDLRGGALRQLSDTIIALERNQLVLVRILKCRFTGDT 223


>3eiuB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 426

 Score = 97.9 bits (242), Expect = 3e-23
 Identities = 23/250 (9%), Positives = 47/250 (18%), Gaps = 34/250 (13%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                              ++  + T  + RG    +  A+G   + +   IA   +   
Sbjct: 88  GAAMNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPG 147

Query: 61  GHVRI------------------------HGLPPAQARKNGLLG-----YVPQSEQVDWA 91
                                          L  A    N          V     +  A
Sbjct: 148 SESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAA 207

Query: 92  FPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAF 151
             +     + +                  A              + + G + G +     
Sbjct: 208 EYLAYEHGMHVLVILTDITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVKGAKGSVTQ 267

Query: 152 IARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEA 211
           I      G  +       +G           V+              + L  +  L +  
Sbjct: 268 IPILSMPGDDITHPIPDLSGYIT----EGQIVVARELHRKGIYPP-INVLPSLSRLMNSG 322

Query: 212 ILLHRRVLAH 221
           I   +    H
Sbjct: 323 IGAGKTREDH 332


>2axzC [x.x.x] PRGX
          Length = 275

 Score = 97.8 bits (243), Expect = 3e-23
 Identities = 10/156 (6%), Positives = 32/156 (20%), Gaps = 15/156 (9%)

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
                  +     + +  +     +      D+      ++   +++L +          
Sbjct: 105 IYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSI 164

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE------GATLLVSTHD 200
            K   I     +   + +       +     R +      +             +   +D
Sbjct: 165 IKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEHLKTIKNISINGYYD 224

Query: 201 LAGVGELCDEAILL--------HRRVLAHGSPDRVL 228
           L  +  L      L           V        + 
Sbjct: 225 L-EINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIG 259


>1e9fA [c.37.1] THYMIDYLATE KINASE
          Length = 202

 Score = 96.9 bits (240), Expect = 5e-23
 Identities = 23/206 (11%), Positives = 45/206 (21%), Gaps = 14/206 (6%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G +G+GKST  + + E +        +   P        LL    Q +    
Sbjct: 2   RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 61

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
              V       +    +        K         +                +       
Sbjct: 62  DHSVH------LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 115

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPS---ERTIVRVLREMRD-----EGATLLVSTHDLA 202
               G+ +   V  L    A   K           +    +          ++ ++  + 
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIE 175

Query: 203 GVGELCDEAILLHRRVLAHGSPDRVL 228
            V E                    + 
Sbjct: 176 AVHEDIRVLSEDAIATATEKPLGELW 201


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score = 96.1 bits (237), Expect = 9e-23
 Identities = 60/227 (26%), Positives = 107/227 (47%), Gaps = 6/227 (2%)

Query: 7   LEVREVTVRYGD----VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
           +++  +T  +      + AL+NV++ +  G + G++GA+G+GKSTL++ +  L  P  G 
Sbjct: 2   IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS 61

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
           V + G       ++ L     Q   +   F +     V       + L   P+   +  V
Sbjct: 62  VLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRV 121

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
            E L   GL D        LSGGQ++R  IAR +A    V L DE  + +D  + R+I+ 
Sbjct: 122 TELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILE 181

Query: 183 VLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRV 227
           +L++  R  G T+L+ TH++  V  +CD   ++    ++   +   V
Sbjct: 182 LLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEV 228


>2cckA [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score = 95.9 bits (237), Expect = 1e-22
 Identities = 22/201 (10%), Positives = 45/201 (22%), Gaps = 23/201 (11%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
                G  GSGK+T++  +   +      +                        V     
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTRE-----------------PGGVPTGEE 45

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
           +R I +  M       L    R+           + G   L  R I +    Q     I 
Sbjct: 46  IRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIG 105

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG----ATLLVSTHDLAGVGELCD 209
               +    F ++  +  +      +       +          L      + G  E+  
Sbjct: 106 VEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDQEDLKFHEKVIEGYQEIIR 165

Query: 210 EAILLH--RRVLAHGSPDRVL 228
              +              + +
Sbjct: 166 FKSVNADQPLENVVEDTYQTI 186


>4dcgA [x.x.x] VP39
          Length = 291

 Score = 95.4 bits (236), Expect = 2e-22
 Identities = 17/244 (6%), Positives = 49/244 (20%), Gaps = 33/244 (13%)

Query: 22  LDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LPPAQARKN 76
           L    +  G       +   GS   T ++ + +        ++          P      
Sbjct: 53  LQRHGILDG-----ATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLR 107

Query: 77  GLLGY-----------VPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
            +              + +         +  +              +    S  + VA +
Sbjct: 108 DVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASS 167

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
           L+          +   +  G +     A   +    +  +            ++      
Sbjct: 168 LKWRCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYE 227

Query: 186 EM----RDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL----VPELMLRAF 237
           +            +V   D        +        +L     ++         L L+  
Sbjct: 228 KKMYYLNKIVRNKVVVNFDY----PNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQS 283

Query: 238 GLEE 241
               
Sbjct: 284 IFRF 287


>2ctsA [x.x.x] CITRATE SYNTHASE
          Length = 437

 Score = 95.2 bits (235), Expect = 2e-22
 Identities = 10/165 (6%), Positives = 32/165 (19%), Gaps = 9/165 (5%)

Query: 13  TVRYGDVLALDNV--TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG--- 67
                    L ++    +          G    G+ T+      +   +           
Sbjct: 1   ASSTNLKDILADLIPKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDP 60

Query: 68  --LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                 +         +    +         +    +   G +    +     ++    A
Sbjct: 61  DEGIRFRGYSIPECQKMLPKAKGGEEPLPEGL--FWLLVTGQIPTEEQVSWLSKEWAKRA 118

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFA 170
              + +  +       L    +  A I    ++        E   
Sbjct: 119 ALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIH 163


>2c9yA [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
          Length = 218

 Score = 95.2 bits (235), Expect = 2e-22
 Identities = 20/207 (9%), Positives = 40/207 (19%), Gaps = 2/207 (0%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
           G+   LLG  G+GK T    +AE                  +            +     
Sbjct: 1   GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLV 60

Query: 92  FPVRVID-VVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
               V++ +                   R      +    +     +    +        
Sbjct: 61  SDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSL 120

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
            I R   +              + P E     +  E      +          +     +
Sbjct: 121 LIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRR-SDDNEKALKIRLQAYHTQ 179

Query: 211 AILLHRRVLAHGSPDRVLVPELMLRAF 237
              L       G    +   +     F
Sbjct: 180 TTPLIEYYRKRGIHSAIDASQTPDVVF 206


>3d3kA [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
          Length = 233

 Score = 94.7 bits (234), Expect = 2e-22
 Identities = 23/216 (10%), Positives = 45/216 (20%), Gaps = 7/216 (3%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTP--QSGHVRIH 66
           V  ++      L        +       + G   S  +  L    +  T     G     
Sbjct: 19  VPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKG 78

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
               +  R               +      +   +         T+  + S    +  + 
Sbjct: 79  AQGISCGRHLANHDVQVIL----FLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSP 134

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
               +  L   +   L      +A +A      A V  +D P   +D      +   L  
Sbjct: 135 VDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPL 193

Query: 187 MRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHG 222
               G   L        V +                
Sbjct: 194 GEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVI 229


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score = 94.1 bits (232), Expect = 4e-22
 Identities = 59/225 (26%), Positives = 97/225 (43%), Gaps = 7/225 (3%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           +++++ VT  +G+V+   ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I
Sbjct: 2   SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 61

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                                 V  ++ +     V       + L    ++     V + 
Sbjct: 62  GEKRMNDTPP-----AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
            E   L  L  R+  ALSGGQR+R  I R +    +VFLLDEP + +D      +   + 
Sbjct: 117 AEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIS 176

Query: 186 EMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            +    G T++  THD      L D+ ++L   RV   G P  + 
Sbjct: 177 RLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 221



 Score = 40.5 bits (93), Expect = 5e-06
 Identities = 9/58 (15%), Positives = 18/58 (31%), Gaps = 4/58 (6%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR----KNGLLGYVPQ 84
            G    +     S +  L+    ++V  + G     GLPP +             + +
Sbjct: 309 LGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHK 366


>1e0jA [c.37.1] DNA HELICASE
          Length = 287

 Score = 93.7 bits (231), Expect = 5e-22
 Identities = 24/232 (10%), Positives = 55/232 (23%), Gaps = 15/232 (6%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
                  V + +     +++ T+    G V  +   +G GKST ++  A       G   
Sbjct: 16  REHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKV 75

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
              +                +E +        +      +   +   +  +  D     +
Sbjct: 76  GLAMLEES--------VEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGND 127

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
                     A            +       I       ++       ++     ++  L
Sbjct: 128 TFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKL 187

Query: 185 RE-MRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSP------DRVLV 229
           +   +  G  L+V  H          E           GS       D ++ 
Sbjct: 188 KGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIA 239


>3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 284

 Score = 93.3 bits (230), Expect = 7e-22
 Identities = 24/242 (9%), Positives = 62/242 (25%), Gaps = 14/242 (5%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
                +T        LD +T    R     +      GK+      A+ ++     V +H
Sbjct: 18  SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLH 77

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                      +         +  A  +    +    R        +   +  +     +
Sbjct: 78  S--------LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI 129

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR- 185
                   +   I + +   +++    R I     + LL+   A   + ++ + +     
Sbjct: 130 NIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLK 189

Query: 186 -EMRDEGATLLVSTHDLAGVGELCDEAILLHR----RVLAHGSPDRVLVPELMLRAFGLE 240
              R+    ++  +     V +  D+  +L        L   +     +          E
Sbjct: 190 KMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDKESE 249

Query: 241 EP 242
             
Sbjct: 250 SK 251


>3dt4A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 619

 Score = 93.1 bits (229), Expect = 8e-22
 Identities = 24/244 (9%), Positives = 51/244 (20%), Gaps = 17/244 (6%)

Query: 1   MTTPPALEVREVTVRY----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
                AL +     +      + + +  +T   G+         +  GK+ L      L 
Sbjct: 239 GKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLP 298

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
             +   V           +  L    P++     A    V       +      T     
Sbjct: 299 GWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQK-NTIFTNV 357

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
           ++        E           I +    + +           +           +D   
Sbjct: 358 AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW 417

Query: 177 ERTIVRVLREM-----RDEGATLLVSTHDLAGVGELC-------DEAILLHRRVLAHGSP 224
           E      +  +     R  G  L+           +          A     +V+ H   
Sbjct: 418 ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF 477

Query: 225 DRVL 228
               
Sbjct: 478 AMRP 481


>1e2dA [c.37.1] THYMIDYLATE KINASE
          Length = 209

 Score = 93.1 bits (230), Expect = 8e-22
 Identities = 20/199 (10%), Positives = 50/199 (25%), Gaps = 11/199 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q +    
Sbjct: 2   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 61

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
              V      ++            ++     V   ++R   + +A             + 
Sbjct: 62  DHSV-----HLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQ 116

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
                      +FL  +      + +           ++              + +    
Sbjct: 117 PDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER-----ALRCFHQLMKDTTLN 171

Query: 211 AILLHR-RVLAHGSPDRVL 228
             ++   + +     D  +
Sbjct: 172 WKMVDASKSIEAVHEDIRV 190


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score = 92.8 bits (229), Expect = 9e-22
 Identities = 55/225 (24%), Positives = 93/225 (41%), Gaps = 8/225 (3%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +++  +  R+GDV A+ ++++EI  G    LLG +G GK+T L+        +     
Sbjct: 3   AEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYI 62

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
              L     +        P+   V       +    +          R+  K + D    
Sbjct: 63  EDNLVADPEKGV---FVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVR 119

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
            +   GLT+L +R+   LSGGQR+R  + R I +   VF LDEP + +D         + 
Sbjct: 120 EVAELGLTELLNRKPRELSGGQRQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAELK 178

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           +  R  G T +  THD     E   + I +++  +   G+PD V 
Sbjct: 179 KLQRQLGVTTIYVTHD---QVEATGDRIAVNKGELQQVGTPDEVY 220


>1dkiA [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
          Length = 303

 Score = 92.8 bits (229), Expect = 1e-21
 Identities = 22/226 (9%), Positives = 51/226 (22%), Gaps = 22/226 (9%)

Query: 3   TPPALEVREVTVRYGD---VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
               L+ + +    G+   +L      V+ G     G   A GS  +   + +     P 
Sbjct: 70  VKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPN 129

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR 119
            G         +         Y    + +  A   R  +                 +   
Sbjct: 130 KGLKDYTYTLSSN------NPYFNHPKNLFAAISTRQYN--WNNILPTYSGRESNVQKMA 181

Query: 120 DAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT 179
            +   A     +        G+    + +RA         +   +    F+  D      
Sbjct: 182 ISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWE---- 237

Query: 180 IVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPD 225
               + +   +   +        G       A ++      +    
Sbjct: 238 --AQIDKELSQNQPVYYQGVGKVG-----GHAFVIDGADGRNFYHV 276


>3a1wA [x.x.x] IRON(II) TRANSPORT PROTEIN B
          Length = 159

 Score = 92.3 bits (228), Expect = 1e-21
 Identities = 16/152 (10%), Positives = 31/152 (20%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVR 95
            L G    GK++L   +       +    +                        ++    
Sbjct: 6   ALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYS 65

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
            ID  +   Y   G              E      L  L   +   L+      A     
Sbjct: 66  SIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDR 125

Query: 156 IAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
                 + +     + V       +   + E 
Sbjct: 126 YELQKHLGIPVVFTSSVTGEGLEELKEKIVEY 157


>3b2qB [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
          Length = 431

 Score = 91.3 bits (225), Expect = 3e-21
 Identities = 21/235 (8%), Positives = 49/235 (20%), Gaps = 37/235 (15%)

Query: 12  VTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG-----HVRIH 66
                   ++  + T  + RG    +  A+G   + +   IA   +          V   
Sbjct: 103 PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAA 162

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVR-------------------------VIDVVM 101
                +  +        +         V                            +  M
Sbjct: 163 MGITNEEAQYF--MSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGM 220

Query: 102 MGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGAT 161
                   +T       +                + + G + G +     I      G  
Sbjct: 221 HVLVILTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDD 280

Query: 162 VFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR 216
           +       +G     +  + R L         +    + L  +  L +  I   +
Sbjct: 281 ITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSLSRLMNSGIGAGK 330


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score = 90.6 bits (223), Expect = 4e-21
 Identities = 52/218 (23%), Positives = 84/218 (38%), Gaps = 30/218 (13%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
           +V+  +V    ++ ++I  G     +G +G GKSTLL+ IA L                 
Sbjct: 2   SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVFQ---------- 51

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
                                + V + +  G           ++     V +  E   L 
Sbjct: 52  --------------SYALYPHLSVAENMSFGLKLA----GAKKEVINQRVNQVAEVLQLA 93

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM-RDEG 191
            L  R+  ALSGGQR+R  I R +    +VFLLDEP + +D      +   +  + +  G
Sbjct: 94  HLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG 153

Query: 192 ATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            T++  THD      L D+ ++L   RV   G P  + 
Sbjct: 154 RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 191



 Score = 33.2 bits (74), Expect = 8e-04
 Identities = 8/40 (20%), Positives = 15/40 (37%)

Query: 35  CGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
             +     S +  L+    ++V  + G     GLPP +  
Sbjct: 283 TQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCH 322


>1e9rA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 420

 Score = 90.5 bits (223), Expect = 5e-21
 Identities = 20/186 (10%), Positives = 45/186 (24%), Gaps = 8/186 (4%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGV-VCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 22  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 81

Query: 64  RIHGLPPAQARKNGL-LGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
            I         K G     +               ++     +       R   S     
Sbjct: 82  VIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ------RYALSVVPRG 135

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                    +                     R +    T+   D+    ++     ++  
Sbjct: 136 KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFA 195

Query: 183 VLREMR 188
              E  
Sbjct: 196 GSNEAS 201


>2cgtH [x.x.x] 60 KDA GROEL
          Length = 515

 Score = 90.4 bits (223), Expect = 5e-21
 Identities = 22/263 (8%), Positives = 54/263 (20%), Gaps = 25/263 (9%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGR-GVVCGLLGANGSGKSTLLKTIAELVTPQ 59
                       T+    V     + +E     +   ++    S  +          T  
Sbjct: 35  RNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVL 94

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGR--------------- 104
           +  +   GL    A  N +       + V  A        V                   
Sbjct: 95  AQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSD 154

Query: 105 -------YGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIA 157
                     M    +      +      +   + +      G LS     +        
Sbjct: 155 ETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVEL 214

Query: 158 QGATVFLLDEPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR 216
           +   + L D+  + + +                  A  +        V       + +  
Sbjct: 215 ESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAA 274

Query: 217 -RVLAHGSPDRVLVPELMLRAFG 238
            +    G   + ++ ++     G
Sbjct: 275 VKAPGFGDRRKAMLQDIATLTGG 297


>1e9dA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 90.1 bits (222), Expect = 6e-21
 Identities = 22/196 (11%), Positives = 44/196 (22%), Gaps = 11/196 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q +    
Sbjct: 3   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 62

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                    V +    +        K         +                +       
Sbjct: 63  DH------SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCK 116

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
               G+ +   V  L    A      +R      R          +       + +    
Sbjct: 117 QPDVGLPKPDLVLFLQLQLADAA---KRGAFGHERYENGAFQERAL-RCFHQLMKDTTLN 172

Query: 211 AILLHR-RVLAHGSPD 225
             ++   + +     D
Sbjct: 173 WKMVDASKSIEAVHED 188


>2a30B [x.x.x] DEOXYCYTIDINE KINASE
          Length = 212

 Score = 89.4 bits (220), Expect = 1e-20
 Identities = 19/206 (9%), Positives = 44/206 (21%), Gaps = 14/206 (6%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           R     + G   +GKST +  +   V P+      +       +               +
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTY 60

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
           A   R+   +         +    R    D    A        +   +            
Sbjct: 61  ACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMN 120

Query: 151 FIARGIAQGATVFLLDEP--------FAGVDKPSERTIVRVLREMRDE-GATLLVSTHDL 201
                  +   +  L           +       +   +  L ++  +  + LL  T   
Sbjct: 121 NQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKT 180

Query: 202 AGVGELCDEAILLHRRVLAHGSPDRV 227
                     +      L     + +
Sbjct: 181 NFDYLQEVPIL-----TLDVNEYESL 201


>1bg0A [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
          Length = 356

 Score = 88.9 bits (219), Expect = 1e-20
 Identities = 20/233 (8%), Positives = 51/233 (21%), Gaps = 9/233 (3%)

Query: 8   EVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
            ++      G  L     +         G+   +     T       ++    G  ++  
Sbjct: 37  SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTD 96

Query: 68  LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
             P +   +                        + G   +  LT    K   + V+  L 
Sbjct: 97  KHPPKQWGDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLS 156

Query: 128 RTG-LTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
                    +  +  +S   +++      + +    FL                    + 
Sbjct: 157 SMEDELKGTYYPLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKT 216

Query: 187 M----RDEGAT---LLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPE 231
                 +E       +    DL  V +    A+     ++          +  
Sbjct: 217 FLVWVNEEDHLRIISMQKGGDLKTVYKRLVTAVDNIESKLPFSHDDRFGFLTF 269


>2a30D [x.x.x] DEOXYCYTIDINE KINASE
          Length = 215

 Score = 88.6 bits (218), Expect = 2e-20
 Identities = 20/209 (9%), Positives = 43/209 (20%), Gaps = 17/209 (8%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           R     + G   +GKST +  + +L                    N L     + E+  +
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 91  AFPVRVID---VVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
            F            +       +    R    D    A        +   +         
Sbjct: 61  TFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD 120

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKP--------SERTIVRVLREMRDE-GATLLVST 198
                     +   +  L                   +   +  L ++  +  + LL  T
Sbjct: 121 WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT 180

Query: 199 HDLAGVGELCDEAILLHRRVLAHGSPDRV 227
                        +      L     + +
Sbjct: 181 LKTNFDYLQEVPIL-----TLDVNEYESL 204


>2bdtA [x.x.x] BH3686
          Length = 170

 Score = 88.6 bits (218), Expect = 2e-20
 Identities = 19/168 (11%), Positives = 42/168 (25%), Gaps = 8/168 (4%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH------GLPPAQARKNGLLGYVPQSEQ 87
           +  + G  G GKST  K +A  +   +            G  P       L         
Sbjct: 3   LYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPPWESDELLALTWKNITD 62

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
           +   F +   DVV+             +          +    L       +   +  ++
Sbjct: 63  LTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKK 122

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
               +     +      +DE +       + T +  + +        +
Sbjct: 123 GERCLEL--VEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI 168


>3bb1F [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 245

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 22/241 (9%), Positives = 60/241 (24%), Gaps = 7/241 (2%)

Query: 7   LEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +           +  L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 5   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 64

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVV--MMGRYGHMGLTRRPRKSDRDAV 122
             G  P    ++     +   +         + D+   ++  +            DR   
Sbjct: 65  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDA 124

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                   L   A           +    +             DE F+   +   + +  
Sbjct: 125 YRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRS 184

Query: 183 VLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPEL-MLRAFGLEE 241
                + +   +L+         +  +  +L +           +    L    +  +++
Sbjct: 185 GASL-KKDIPVVLIENSGRCNKNDSDE-KVLPNGIAWIPHLVQTITEVALNKSESIFVDK 242

Query: 242 P 242
            
Sbjct: 243 N 243


>1dg3A [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
           GUANYLATE-BINDING
          Length = 540

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 22/204 (10%), Positives = 44/204 (21%), Gaps = 4/204 (1%)

Query: 3   TPPALEVREVTVRYGD-VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           T P   +     R      AL  ++      VV  ++G   +GKS L+  +A     +  
Sbjct: 3   TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGI 62

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
            +     P        LL      +              +        +       ++ A
Sbjct: 63  WMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQA 122

Query: 122 VAEAL--ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT 179
           + +            +               +  R  +        DE      K  + T
Sbjct: 123 MDQLYYVTELTHRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGT 182

Query: 180 IVRVLREMRDEG-ATLLVSTHDLA 202
             +                     
Sbjct: 183 SQKDETFNLPRLCIRKFFPKKKCF 206


>3czpA [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
          Length = 460

 Score = 87.9 bits (216), Expect = 3e-20
 Identities = 25/198 (12%), Positives = 55/198 (27%), Gaps = 6/198 (3%)

Query: 21  ALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLG 80
            L          +V    G + +GK   ++ + + + P+  H+     P  + R    L 
Sbjct: 253 GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLW 312

Query: 81  YVPQSEQ--VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ 138
              +       +    R     ++                   + +  E+     +   +
Sbjct: 313 RFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVK 372

Query: 139 -IGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE--RTIVRVLREMRDEGATLL 195
              A+    ++R F  R         + +E +   DK  +    +  V R   +     L
Sbjct: 373 FWLAIDKQTQER-FKEREKTPYKRYKITEEDWRNRDKWDQYVDAVGDVDRTSTEIAPWTL 431

Query: 196 VSTHDLAGVGELCDEAIL 213
           V  +D           I 
Sbjct: 432 VEANDKRFARVKVLRTIN 449



 Score = 69.5 bits (168), Expect = 1e-14
 Identities = 16/143 (11%), Positives = 33/143 (23%)

Query: 12  VTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPA 71
           + +R   + A   +  +    V+  + G  G+GK   +K + E                 
Sbjct: 20  IELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDE 79

Query: 72  QARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL 131
           +  +     +  +                 +       +         DA          
Sbjct: 80  ELERPPQWRFWRRLPPKGRTGIFFGNWYSQLYARVEGHIKEAKLDQAIDAAERFERLCDE 139

Query: 132 TDLAHRQIGALSGGQRKRAFIAR 154
             L  +    LS  Q K      
Sbjct: 140 GALLFKFWFHLSKKQLKERLSPL 162


>2d4hA [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 299

 Score = 87.5 bits (215), Expect = 4e-20
 Identities = 23/239 (9%), Positives = 42/239 (17%), Gaps = 16/239 (6%)

Query: 3   TPPALEVREVTVRYGD-VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           T P   +     R      AL  ++      VV  ++G   +GKS L+  +A      S 
Sbjct: 4   TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSL 63

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVD---WAFPVRVIDVVMMGRYGHMGLTRRPRKSD 118
              +          +                     +    +                  
Sbjct: 64  GSTVQKGIWMWCVPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGT 123

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            +  A              +  +                     F LD    G     + 
Sbjct: 124 INQQAMDQLYYVTELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDE 183

Query: 179 TIVRVLREMRDE------------GATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPD 225
            +   L+  +                                    L     L     D
Sbjct: 184 YLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELD 242


>1e3aB [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
          Length = 560

 Score = 87.3 bits (214), Expect = 4e-20
 Identities = 22/232 (9%), Positives = 48/232 (20%), Gaps = 19/232 (8%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS-----GHVRIHGLP 69
            +    A   +T+      V G +G   +G     ++  +   P           +    
Sbjct: 168 EWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFE 227

Query: 70  PAQARKNGLLGYVPQSEQV-------------DWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
                 N   GY+                    W    RV ++  +          +   
Sbjct: 228 MNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWD 287

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
             R    + L               L+    +R  +           L D+        S
Sbjct: 288 VIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGS 347

Query: 177 ERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRV 227
               V +   ++      +    D        +         +        +
Sbjct: 348 AILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNISVGAKIL 399


>3d7wA [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
          Length = 249

 Score = 87.3 bits (215), Expect = 4e-20
 Identities = 25/232 (10%), Positives = 47/232 (20%), Gaps = 32/232 (13%)

Query: 8   EVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
            V   +     +  L   TV +  G    L+    +G  T+   I         +   + 
Sbjct: 27  YVSSGSFSNN-IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQ 85

Query: 68  LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
                                    P         G                       +
Sbjct: 86  ------------------SYFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQ 127

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVD--------KPSERT 179
                D   + + AL     +    AR I     + ++ E                S  +
Sbjct: 128 IPLGIDQLIQSVTALRFPGGQTKTQARSILI--LIQMISEAARFNPILWRARQYINSGAS 185

Query: 180 IVRV---LREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
            +     L      G       H   GV        +    ++   +   V+
Sbjct: 186 FLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIALAIAPGVIVTLTNIRDVI 237


>2d4hB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 284

 Score = 87.1 bits (214), Expect = 5e-20
 Identities = 25/280 (8%), Positives = 54/280 (19%), Gaps = 56/280 (20%)

Query: 1   MTTPPALEVREVTVRYGD----VLALDNVTVEIGRGVVCGLLGANGSGKSTLLK------ 50
           MT P    +     R       +  L  +T  +    + GL     +GKS L+       
Sbjct: 2   MTGP-MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGL---YRTGKSYLMNKLAGKK 57

Query: 51  ----------TIAELVTPQSGHVRIHG-----LPPAQARKNGLLGYVPQSEQVDWAFPVR 95
                      +  +  P+     +       L    +    L   +  +   +    + 
Sbjct: 58  KGFSLGSKGIWMWCVPHPKKPGHILVLLDTEGLGQNDSWIFALAVLLSSTFVYNSIGTIN 117

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR------ 149
              +  +     +    R + SD             T           G           
Sbjct: 118 QQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTY 177

Query: 150 ------------------AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG 191
                                 R        F+ D P           +     +     
Sbjct: 178 SLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQ 237

Query: 192 ATLLVSTH--DLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                 ++    +    L     +          +    +
Sbjct: 238 QVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYVNAI 277


>2dr3A [x.x.x] UPF0273 PROTEIN PH0284
          Length = 232

 Score = 87.0 bits (214), Expect = 5e-20
 Identities = 23/223 (10%), Positives = 46/223 (20%), Gaps = 33/223 (14%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQA 73
           V+ G     + +   I    V  L G  G+GK+   +                 L     
Sbjct: 3   VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV 62

Query: 74  RKNGLLGYVPQSEQVDWAFP-VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
           +    +       +         ++D    G                             
Sbjct: 63  QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDL---------------- 106

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER---TIVRVLREMRD 189
                        +             A   ++D                I+++ R +  
Sbjct: 107 ---------TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAG 157

Query: 190 EGATLLVSTHDLA---GVGELCDEAILLHR-RVLAHGSPDRVL 228
            G T +  +       GV    D  I L    +        ++
Sbjct: 158 TGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIV 200


>2a2zA [x.x.x] DEOXYCYTIDINE KINASE
          Length = 222

 Score = 86.2 bits (212), Expect = 9e-20
 Identities = 21/203 (10%), Positives = 44/203 (21%), Gaps = 10/203 (4%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           R     + G   +GKST +  + +L                    N     +   +   W
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNV--LQMMYEKPERW 58

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
           +F  +    +   R     L  + +       +   +R       +              
Sbjct: 59  SFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYE----SECMNETEW 114

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG-ATLLVSTHDLAGVGELCD 209
            I +                      + T    L  +   G         +         
Sbjct: 115 TIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKH 174

Query: 210 EAILL---HRRVLAHGSPDRVLV 229
           E+ LL    +    +     +L 
Sbjct: 175 ESWLLHRTLKTNFDYLQEVPILT 197


>3cr7C [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 178

 Score = 86.1 bits (212), Expect = 1e-19
 Identities = 25/178 (14%), Positives = 48/178 (26%), Gaps = 20/178 (11%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLL-GYVPQSEQVD 89
           RG+   L G + SGKSTL   +   +                        G+       +
Sbjct: 2   RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNEN 61

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT----------------D 133
                 V  +        +     P + DRD   +  E TGL                 D
Sbjct: 62  IRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAEQRD 121

Query: 134 LAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG 191
                  A  G  ++   I+    +      +      +    +  + +++  +  +G
Sbjct: 122 PKGLYKKAREGVIKEFTGISA-PYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTKG 176


>2a2zB [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 85.9 bits (211), Expect = 1e-19
 Identities = 22/198 (11%), Positives = 44/198 (22%), Gaps = 13/198 (6%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           R     + G   +GKST +  + +L                    N L     + E+  +
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 91  AFPVRV----IDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
            F        I   +    G   +    R    D    A        +   +        
Sbjct: 61  TFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH 120

Query: 147 RKRAFIARGIAQGATVFLLDEP--------FAGVDKPSERTIVRVLREMRDE-GATLLVS 197
                      +   +  L           +       +   +  L ++  +  + LL  
Sbjct: 121 DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHR 180

Query: 198 THDLAGVGELCDEAILLH 215
           T             + L 
Sbjct: 181 TLKTNFDYLQEVPILTLD 198


>1e0jB [c.37.1] DNA HELICASE
          Length = 288

 Score = 85.2 bits (209), Expect = 2e-19
 Identities = 25/236 (10%), Positives = 56/236 (23%), Gaps = 15/236 (6%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
                    V + +     +++ T+    G V  +   +G GKST ++  A       G 
Sbjct: 15  REHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK 74

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
                +                +E +        +      +   +   +  +  D    
Sbjct: 75  KVGLAMLEESVE--------ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFG 126

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
            +          A            +       I       ++       ++     ++ 
Sbjct: 127 NDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMT 186

Query: 183 VLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSP------DRVLVPE 231
            L+   +  G  L+V  H          E           GS       D ++  E
Sbjct: 187 KLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALE 242


>2b8tC [x.x.x] THYMIDINE KINASE
          Length = 199

 Score = 85.2 bits (209), Expect = 2e-19
 Identities = 20/200 (10%), Positives = 49/200 (24%), Gaps = 9/200 (4%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI--HGLPPAQARKNGLLGYVPQSEQVD 89
           G +  + G   +GK+  L      +        +    +          +      E ++
Sbjct: 2   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLPSVEVESAPEILN 61

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
           +       D   +     +           + +AE      ++ L     G   G   K 
Sbjct: 62  YIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKL 121

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCD 209
              A  I +   +       A          +R +     +    +V          +C 
Sbjct: 122 FTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCR 174

Query: 210 EAILLHRRVLAHGSPDRVLV 229
               +  R   + + +  + 
Sbjct: 175 HHHKVPNRPYLNSNSEEFIK 194


>3bb1B [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 243

 Score = 85.1 bits (209), Expect = 2e-19
 Identities = 24/233 (10%), Positives = 50/233 (21%), Gaps = 8/233 (3%)

Query: 7   LEVREVTVRYGDVL--ALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +          L   L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 5   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 64

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTR-RPRKSDRDAVA 123
               P   +R                         + + +   +  T       DR    
Sbjct: 65  SGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAY 124

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                  L   A           +    +             DE F+   +   + +   
Sbjct: 125 RVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSG 184

Query: 184 LREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRA 236
                D    L+ ++       ++    I              +    L    
Sbjct: 185 ASLASDIPVVLIENSGRCNSDEKVLPNGI-----AWIPHLVQTITEVALNKSE 232


>2d4uA [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
          Length = 167

 Score = 85.0 bits (209), Expect = 2e-19
 Identities = 18/172 (10%), Positives = 37/172 (21%), Gaps = 14/172 (8%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP-----PAQARKNGL---LGYVPQSEQ 87
           G LG+ G   + L          Q+   +   L        Q R       + Y+     
Sbjct: 1   GPLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVALLQTRNTLNRAGIRYMMDQNN 60

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
           +     V  +               +          +  + T       R          
Sbjct: 61  IGSGSTVAELMESASISLKQA---EKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALA 117

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTH 199
           +   +             D+P  G     E+  V  + +        +   +
Sbjct: 118 ELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN 166


>2cjwB [x.x.x] GTP-BINDING PROTEIN GEM
          Length = 170

 Score = 84.9 bits (209), Expect = 2e-19
 Identities = 25/186 (13%), Positives = 44/186 (23%), Gaps = 23/186 (12%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
                 L+G  G GKSTL    A +       + + G        +    +        +
Sbjct: 5   TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILLDMWENHDHMQVGDAY 64

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                + D      +      R   +  R      +   G      R+  ++S G+    
Sbjct: 65  LIVYSITDRAS---FEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGRAAVV 121

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
           F  + I   A V    +                      EG    V     +   +    
Sbjct: 122 FDCKFIETSAAVQHNVKE-------------------LFEGIVRQVRLRRDSKE-KNERR 161

Query: 211 AILLHR 216
                R
Sbjct: 162 LAYQKR 167


>1e9sF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 24/228 (10%), Positives = 54/228 (23%), Gaps = 29/228 (12%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 24  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 83

Query: 64  RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
            I         K G    +  +            + +                       
Sbjct: 84  VIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------- 128

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                              +    + A   R + +     L       + +    T +  
Sbjct: 129 ---------YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIAT 179

Query: 184 LREMRDEGAT----LLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
             ++R          L +  + A         +L  +       PD  
Sbjct: 180 FDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGD 227


>1e9sD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 417

 Score = 83.9 bits (206), Expect = 4e-19
 Identities = 20/223 (8%), Positives = 49/223 (21%), Gaps = 29/223 (13%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 19  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 78

Query: 64  RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
            I                       D               +  +      ++       
Sbjct: 79  VIVDPNGDM--------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL---- 126

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                              +    + A   R + +     L       + +    T +  
Sbjct: 127 ------------SVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIAT 174

Query: 184 LREMRDE---GATLLVSTHDLAGVGELCDE-AILLHRRVLAHG 222
             ++R          +          L     +L  +      
Sbjct: 175 FDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT 217


>1dhjA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 83.2 bits (205), Expect = 7e-19
 Identities = 11/136 (8%), Positives = 30/136 (22%), Gaps = 2/136 (1%)

Query: 107 HMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLD 166
              L         +A+   L  +      +     +  G+     I R +     + L  
Sbjct: 5   IAALAVDRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSS 64

Query: 167 EPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSP 224
           +P         +++   +          ++              +  L H    +   + 
Sbjct: 65  QPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTH 124

Query: 225 DRVLVPELMLRAFGLE 240
                P+         
Sbjct: 125 FPDYEPDDWESVSSEF 140


>3bo6B [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
          Length = 215

 Score = 82.8 bits (203), Expect = 9e-19
 Identities = 11/205 (5%), Positives = 40/205 (19%), Gaps = 7/205 (3%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
             +     +       + +      G+      A   G           +     + +  
Sbjct: 12  HSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCK 71

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
           G           +      +       +       + ++    + R  ++S     A+  
Sbjct: 72  GDFAGDKFHIS-VQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFT 130

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
                     +   +     R+           + +     P + V   + + +      
Sbjct: 131 LYVKPDQENSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNEL 190

Query: 187 MRDEGATLLVS--THDLAGVGELCD 209
                   + S    +         
Sbjct: 191 RSGRDGGEMQSQALREE----PFYR 211


>1e3mA [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
           PROTEIN MUTS
          Length = 765

 Score = 82.5 bits (203), Expect = 1e-18
 Identities = 22/191 (11%), Positives = 39/191 (20%), Gaps = 11/191 (5%)

Query: 42  GSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLL--GYVPQSEQVDWAFPVRVIDV 99
               +    T+            I            +L   ++          P R    
Sbjct: 540 LVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANP---LNLSPQRR--- 593

Query: 100 VMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQG 159
           +++        T R       A   +       ++          G  +           
Sbjct: 594 LIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGFVETETANILHNAT 653

Query: 160 ATVFLLDEPFAGVDKPSERTIVRVLRE--MRDEGATLLVSTHDLAGVGELCDEAILLHR- 216
               +LDE   G       ++     E       A  L +TH          E +     
Sbjct: 654 EYSLVLDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEGVANVHL 713

Query: 217 RVLAHGSPDRV 227
             L HG     
Sbjct: 714 DALEHGDTIAF 724


>3bb1C [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 246

 Score = 82.2 bits (201), Expect = 2e-18
 Identities = 25/241 (10%), Positives = 62/241 (25%), Gaps = 7/241 (2%)

Query: 7   LEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +           +  L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 5   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 64

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAF--PVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
             G  P    ++     +   +         +  + + ++  +            DR   
Sbjct: 65  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDA 124

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                   L   A           +    +             DE F+     +   +VR
Sbjct: 125 YRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSK-RSEALLQVVR 183

Query: 183 VLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL-VPELMLRAFGLEE 241
               ++ +   +L+            DE +L +           +  V      +  +++
Sbjct: 184 SGASLKSDIPVVLIENSGRCNK-NDSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDK 242

Query: 242 P 242
            
Sbjct: 243 N 243


>3cmxA [x.x.x] PROTEIN RECA
          Length = 1603

 Score = 82.1 bits (201), Expect = 2e-18
 Identities = 22/239 (9%), Positives = 64/239 (26%), Gaps = 24/239 (10%)

Query: 19   VLALDNVTVEIG--RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKN 76
             L+LD      G   G +  + G   SGK+TL   +      +           A     
Sbjct: 1340 SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY 1399

Query: 77   G-LLGYVPQSEQVDWAFPVR-------------VIDVVMMGRYGHMGLTRRPRKSDRDAV 122
               LG    +                        +DV+++         +   +    A+
Sbjct: 1400 ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVA-ALTPKAEARMMSQAM 1458

Query: 123  AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
             +       ++     I  +   +      A      +    +    A  +  +      
Sbjct: 1459 RKLAGNLKQSNTLLIFINQIRNPETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSET 1517

Query: 183  VLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLE 240
             ++ ++++     ++        ++     +     ++  G  ++++       ++  E
Sbjct: 1518 RVKVVKNK-----IAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGE 1571


>2axpA [x.x.x] HYPOTHETICAL PROTEIN BSU20280
          Length = 171

 Score = 82.0 bits (201), Expect = 2e-18
 Identities = 20/163 (12%), Positives = 39/163 (23%), Gaps = 12/163 (7%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLL-GYVPQSEQVDWAF 92
           +  L G +   KST+   +++ +           L  +   K       +   + V    
Sbjct: 2   LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDR 61

Query: 93  PVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTD--------LAHRQIGALSG 144
            V    V       +  LT R  +   D +    +   L          L  R    + G
Sbjct: 62  FVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEG 121

Query: 145 GQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
                          A +                 I + +  +
Sbjct: 122 KDIDSILELYREVSNAGLHTYSWDTGQWS---SDEIAKDIIFL 161


>421pA [x.x.x] H-RAS P21 PROTEIN
          Length = 166

 Score = 81.6 bits (200), Expect = 2e-18
 Identities = 16/161 (9%), Positives = 36/161 (22%), Gaps = 4/161 (2%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
                 ++GA G GKS L   + +          I      Q   +G    +   +    
Sbjct: 2   TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ 61

Query: 91  AFPVRVIDVVMMGRYGHMGLTRR----PRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
                + D  M    G + +         +       +        D+    +G      
Sbjct: 62  EEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLA 121

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
            +     +      +  +     +   +         L   
Sbjct: 122 ARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE 162


>3dtbB [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 612

 Score = 81.3 bits (199), Expect = 3e-18
 Identities = 17/219 (7%), Positives = 42/219 (19%), Gaps = 6/219 (2%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
              + + +  +T   G+         +  GK+ L      L   +   V           
Sbjct: 258 WLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA 317

Query: 75  KNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDL 134
           +   L  +          P   +             T     ++        E       
Sbjct: 318 QGN-LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLA 376

Query: 135 AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE---- 190
               I +    + +           +           +D   E      +  +       
Sbjct: 377 PGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRP 436

Query: 191 -GATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
            G  L+           +        + ++      R  
Sbjct: 437 AGVPLVYEALSWQHGVFVGAAMRSEAKVIMHDPFAMRPF 475



 Score = 50.5 bits (119), Expect = 5e-09
 Identities = 13/154 (8%), Positives = 44/154 (28%), Gaps = 13/154 (8%)

Query: 19  VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL 78
           +    + + ++ +G +  L       +  +    A+L  P+  H  I      +  +   
Sbjct: 3   LHNGLDFSAKVIQGSLDSL---PQEVRKFVEG-NAQLCQPEYIH--ICDGSEEEYGRLLA 56

Query: 79  LGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSD--RDAVAEALERTGLTDLAH 136
                  ++      ++  D   +       + R   K+        + +          
Sbjct: 57  -----HMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSGQSQL 111

Query: 137 RQIGALSGGQRKRAFIARGIAQGATVFLLDEPFA 170
            +  +    ++       G  +G T++++     
Sbjct: 112 GRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMG 145


>1e9sG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score = 81.2 bits (199), Expect = 3e-18
 Identities = 22/222 (9%), Positives = 52/222 (23%), Gaps = 35/222 (15%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 24  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 83

Query: 64  RIHGLPPAQ---ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
            I            ++  +   P     D           +                   
Sbjct: 84  VIVDPNGDMLSKFGRDKDIILNPY----DQRTKGWSFFNEIRND---------------- 123

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
                 +R              +    + A   R + +     L       + +    T 
Sbjct: 124 ---YDWQR----YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTT 176

Query: 181 VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHG 222
           +    ++R         T   +      + +  L        
Sbjct: 177 IATFDDLRGFL----EGTLAESLFAGSNEASKALTSARFVLS 214


>2bkiA [x.x.x] UNCONVENTIONAL MYOSIN
          Length = 824

 Score = 81.2 bits (198), Expect = 3e-18
 Identities = 14/189 (7%), Positives = 41/189 (21%), Gaps = 6/189 (3%)

Query: 1   MTTPPALEVREVTV----RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
             T  + + + +       +            +       + G +G+GK+   K +   +
Sbjct: 108 SETIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYL 167

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
           T   G  +       +A          ++ + + +        V +       +      
Sbjct: 168 TESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFG--KFVEIHFNEKSSVVGGFVS 225

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
                 +    +       H      +G            +     +L            
Sbjct: 226 HYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKE 285

Query: 177 ERTIVRVLR 185
               +   R
Sbjct: 286 TDKQILQNR 294


>1d6jB [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 182

 Score = 80.3 bits (197), Expect = 5e-18
 Identities = 22/177 (12%), Positives = 48/177 (27%), Gaps = 3/177 (1%)

Query: 16  YGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG-HVRIHGLPPAQAR 74
              +   +   +   RG+   L G + SGKSTL   +   +      H         +  
Sbjct: 2   ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG 61

Query: 75  KNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDL 134
            N  LG+       +      V  +        +     P + DRD   +  E     + 
Sbjct: 62  LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEE 121

Query: 135 AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG 191
                  +           R   +      +      +    +  + +++  +  +G
Sbjct: 122 TGLPFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTKG 176


>3cmtD [x.x.x] PROTEIN RECA
          Length = 1609

 Score = 80.2 bits (196), Expect = 6e-18
 Identities = 31/262 (11%), Positives = 65/262 (24%), Gaps = 48/262 (18%)

Query: 7    LEVREVTVRYGDVLALDNVTVE--------------------IGRGVVCGLLGANGSGKS 46
            L   E     G ++ L                          +  G +  + G   SGK+
Sbjct: 1310 LGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKT 1369

Query: 47   TLLKTIAELVTPQSGHVRIHGL----PPAQARKNGLLGYVPQSEQVDWAF---------- 92
            TL   +      +              P  ARK   LG    +                 
Sbjct: 1370 TLTLQVIAAAQREGKTCAFIDAEHALDPIYARK---LGVDIDNLLCSQPDTGEQALEICD 1426

Query: 93   ---PVRVIDVVMMGRYGHMGLTRRPRKSDR---DAVAEALERTGLTDLAHRQIGALSGGQ 146
                   +DV+++     +        + R    A+ +       ++     I  +    
Sbjct: 1427 ALARSGAVDVIVVDSVAALTPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKN 1486

Query: 147  RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGE 206
             +       +   A+V L       V          V  E R +     ++        +
Sbjct: 1487 PETTTGGNALKFYASVRLDIRRIGAVK----EGENVVGSETRVKVVKNKIAAPFKQAEFQ 1542

Query: 207  LCDE-AILLHRRVLAHGSPDRV 227
            +     I  +  ++  G  +++
Sbjct: 1543 ILYGEGINFYGELVDLGVKEKL 1564



 Score = 33.6 bits (75), Expect = 6e-04
 Identities = 10/49 (20%), Positives = 16/49 (32%), Gaps = 2/49 (4%)

Query: 21 ALDNVTVEIG--RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
          +LD      G   G +  + G   SGK+TL   +      +        
Sbjct: 10 SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID 58


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 80.1 bits (196), Expect = 6e-18
 Identities = 40/246 (16%), Positives = 77/246 (31%), Gaps = 24/246 (9%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
                   +      +   L ++  +I RG +  + G+ G+GK++LL  I   + P  G 
Sbjct: 15  EGFGELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK 74

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
           ++                               +   +     G      R R   +   
Sbjct: 75  IKHS-----------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQ 117

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
            E                 LSGGQR R  +AR + + A ++LLD PF  +D  +E+ I  
Sbjct: 118 LEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 177

Query: 183 VLREMRDEGATLLVSTHDLAGVGELCDEAIL-LHRRVLAHGSPDRVLVP-----ELMLRA 236
                     T ++ T       +  D+ ++        +G+   +          ++ +
Sbjct: 178 SCVCKLMANKTRILVTSK-MEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMDS 236

Query: 237 FGLEEP 242
           F     
Sbjct: 237 FDQFSA 242


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 79.9 bits (195), Expect = 7e-18
 Identities = 44/233 (18%), Positives = 83/233 (35%), Gaps = 11/233 (4%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG----- 61
           L ++++ V   D   L  +++++  G V  ++G NGSGKSTL  T+A     +       
Sbjct: 2   LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 62  ----HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKS 117
                +              +    P               +  +  Y       R    
Sbjct: 62  FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
           D      AL +     L        SGG++KR  I +       + +LDE  +G+D  + 
Sbjct: 122 DLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDAL 181

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGE-LCDEAILLHR-RVLAHGSPDRVL 228
           + +   +  +RD   + ++ TH    +     D   +L++ R++  G    V 
Sbjct: 182 KVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 234


>2cckB [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score = 79.7 bits (195), Expect = 8e-18
 Identities = 21/184 (11%), Positives = 47/184 (25%), Gaps = 5/184 (2%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG----LPPAQARKNGLLGYVPQSEQVD 89
                G  GSGK+T++  +   +      +            + RK  L G +    +  
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGDMDIRTEAM 62

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
                R   +V+                  D+            +   +           
Sbjct: 63  LFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLY 122

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGELC 208
             +   +   A V         +D+   +   +V+   ++      + +   L  V E  
Sbjct: 123 PDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDT 182

Query: 209 DEAI 212
            + I
Sbjct: 183 YQTI 186


>2d0kA [x.x.x] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 79.5 bits (195), Expect = 1e-17
 Identities = 13/139 (9%), Positives = 32/139 (23%), Gaps = 2/139 (1%)

Query: 107 HMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLD 166
              L       + +A+   L         +     +  G+     I R +     + L  
Sbjct: 5   IAALAVDRVIGNENALPWNLPADLAWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSS 64

Query: 167 EPFAGVDKPSERTIVRVLR-EMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSP 224
           +P         +++   +          ++              +  L H    +   + 
Sbjct: 65  QPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTH 124

Query: 225 DRVLVPELMLRAFGLEEPA 243
                P+     F     A
Sbjct: 125 FPDYEPDDWESVFSEFHDA 143


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 79.4 bits (194), Expect = 1e-17
 Identities = 43/224 (19%), Positives = 76/224 (33%), Gaps = 2/224 (0%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           LE+R++         L  V + + +G V  L+G NG+GKSTL K +A           I 
Sbjct: 3   LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL 62

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                    +                 V  + +    R        R             
Sbjct: 63  LDGENILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKK 122

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
               L          L+ G++KR  I + +    T  +LDE  +G+D  + + + R +  
Sbjct: 123 ALELLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNA 182

Query: 187 -MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                   L+++ +         D+  ++   RV+A G P+  L
Sbjct: 183 MRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELAL 226


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score = 79.4 bits (194), Expect = 1e-17
 Identities = 58/235 (24%), Positives = 101/235 (42%), Gaps = 13/235 (5%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           L V ++  RYG    L  V+++   G V  ++G++GSGKST L+ I  L  P  G + ++
Sbjct: 3   LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVN 62

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHM------------GLTRRP 114
           G      R       V    Q+        +       + HM             L    
Sbjct: 63  GQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 122

Query: 115 RKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDK 174
             +   A+    +         +    LSGGQ++R  IAR +A    V L DEP + +D 
Sbjct: 123 HDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDP 182

Query: 175 PSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                ++R+++++ +EG T++V TH++     +    I LH+ ++   G P++V 
Sbjct: 183 ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVF 237


>2a5jA [x.x.x] RAS-RELATED PROTEIN RAB-2B
          Length = 177

 Score = 79.3 bits (194), Expect = 1e-17
 Identities = 17/166 (10%), Positives = 40/166 (24%), Gaps = 1/166 (0%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
                 ++G  G GKS LL    +      G      +     ++  L  +    ++   
Sbjct: 11  YLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIKLQIWDTAGQESFR 70

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
           +               +    R         + +A + +    +            R+  
Sbjct: 71  SITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDV 130

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL-REMRDEGATLL 195
               G A      L+    +     +         +E+  +    L
Sbjct: 131 KREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL 176


>3cddD [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 325

 Score = 79.3 bits (194), Expect = 1e-17
 Identities = 22/207 (10%), Positives = 53/207 (25%), Gaps = 29/207 (14%)

Query: 12  VTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPA 71
           + ++ G  +      + I R      L A+G+          +    Q            
Sbjct: 4   IVLKAGGKIYQGWTKIGITRS-----LEASGAFDLETY----KFNDAQYKAFIEPIKQGQ 54

Query: 72  QARKN--GLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR---------KSDRD 120
               +  G        +    ++    I + + GR     L              ++   
Sbjct: 55  ACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQ 114

Query: 121 AVAEALERTGLTDLAHRQIGA------LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDK 174
                 +  G+  + +  +G       +  G+     +AR +A+   V L  + F  +  
Sbjct: 115 IADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLAR-LAKQRGVLLTSDTFGNLVI 173

Query: 175 PSERTIVRVLREMRDEGATLLVSTHDL 201
                    +      G  +  +    
Sbjct: 174 TRASKTKAGVS--LILGDNVKAARGRF 198


>3dt7A [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 624

 Score = 79.2 bits (193), Expect = 1e-17
 Identities = 23/257 (8%), Positives = 49/257 (19%), Gaps = 21/257 (8%)

Query: 1   MTTPPALEVREVTVRY----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
                AL +     +      + + +  +T   G+         +  GK+ L      L 
Sbjct: 244 GKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLP 303

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
             +   V           +  L              P   +             T     
Sbjct: 304 GWKVECVGDDIAWMKFDAQGNLRAI-NPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV 362

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
           ++        E           I +    + +           +           +D   
Sbjct: 363 AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW 422

Query: 177 ERTIVRVLREM-----RDEGATLLVSTHDLAGVGELC-------DEAILLHRRVLAHGSP 224
           E      +  +     R  G  L+           +          A     +V+ H   
Sbjct: 423 ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF 482

Query: 225 DRVL----VPELMLRAF 237
                        L  +
Sbjct: 483 AMRPFFGYNFGKYLAHW 499


>2b8wB [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 290

 Score = 79.1 bits (193), Expect = 1e-17
 Identities = 23/229 (10%), Positives = 52/229 (22%), Gaps = 8/229 (3%)

Query: 3   TPPALEVREVTVRYG-DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           T P   +     R   +  AL  ++      VV  ++G   +GKS L+  +A      S 
Sbjct: 3   TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSL 62

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
              +                VP  ++      +   + +     G               
Sbjct: 63  GSTVQSHTKGIWM-----WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL 117

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
            +  +  +  T             +      ++        F+       +D  ++   +
Sbjct: 118 SSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPL 177

Query: 182 RVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                +          S  D               + +      P    
Sbjct: 178 TPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRR 226


>2a30A [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 79.0 bits (193), Expect = 1e-17
 Identities = 18/215 (8%), Positives = 43/215 (20%), Gaps = 23/215 (10%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP---------PAQARKNGLLGY 81
           R     + G   +GKST +  + +L                            K     +
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 82  VPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGA 141
             Q+         ++  +    +     +    R    D    A        +   +   
Sbjct: 61  TFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI 120

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKP--------SERTIVRVLREMRDE-GA 192
                           +   +  L                   +   +  L ++  +  +
Sbjct: 121 YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHES 180

Query: 193 TLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
            LL  T             +      L     + +
Sbjct: 181 WLLHRTLKTNFDYLQEVPIL-----TLDVNEYESL 210


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score = 79.0 bits (193), Expect = 1e-17
 Identities = 43/234 (18%), Positives = 79/234 (33%), Gaps = 18/234 (7%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
              V         L ++  +I RG +  + G+ G+GK++LL  I   + P  G ++    
Sbjct: 2   TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS-- 59

Query: 69  PPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALER 128
                          +         +    +            R         + E + +
Sbjct: 60  --------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK 105

Query: 129 TGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMR 188
               D        LSGGQR R  +AR + + A ++LLD PF  +D  +E+ I        
Sbjct: 106 FAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKL 165

Query: 189 DEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLEE 241
               T ++ T  +    +  D+ ++LH      +G+   +         F  E 
Sbjct: 166 MANKTRILVTSKME-HLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFSAER 218


>2b92B [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
          Length = 290

 Score = 79.0 bits (193), Expect = 1e-17
 Identities = 21/224 (9%), Positives = 41/224 (18%), Gaps = 15/224 (6%)

Query: 3   TPPALEVREVTVRYG-DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           T P   +     R   +  AL  ++      VV  ++G   +GKS L+  +A      S 
Sbjct: 3   TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSL 62

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYG----------HMGLT 111
              +                 P    V               +                 
Sbjct: 63  GSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFV 122

Query: 112 RRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAG 171
                +      + L          R   +         +  R  +              
Sbjct: 123 YNSIGTINQQAMDQLYYVTELTHRIRSKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDE 182

Query: 172 VDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLH 215
               S +      ++        L                +   
Sbjct: 183 YLTYSLKLKKGTSQKDETFNLPRLCIRKFF----PKKKCFVFDR 222


>1e9rE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 419

 Score = 78.9 bits (193), Expect = 1e-17
 Identities = 27/228 (11%), Positives = 56/228 (24%), Gaps = 31/228 (13%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGR-GVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 21  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 80

Query: 64  RIHGLPPAQARKNGLLGY-VPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
            I         K G     +               ++     +    L+  PR       
Sbjct: 81  VIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT---- 136

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                                    + A   R + +     L       + +    T + 
Sbjct: 137 ---------------------DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIA 175

Query: 183 VLREMRDEGATLL---VSTHDLAGVGELCDE-AILLHRRVLAHGSPDR 226
              ++R      L   +          L     +L  +       PD 
Sbjct: 176 TFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDG 223


>2akaA [x.x.x] MYOSIN II HEAVY CHAIN
          Length = 764

 Score = 78.8 bits (192), Expect = 2e-17
 Identities = 20/220 (9%), Positives = 61/220 (27%), Gaps = 7/220 (3%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
              +          ++  +     + G +G+GK+   K + + +   +G  + +G    +
Sbjct: 152 PHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLE 211

Query: 73  ARKNGLLGYVPQSEQ--VDWAFPVRVIDVVMMGRYGHMGLTRRPR-KSDRDAVAEALERT 129
            +       +                    +  ++   G       +S     +  + ++
Sbjct: 212 QQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQS 271

Query: 130 GLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRD 189
                 H     L+G   +           +  +L       +   S+    ++ R+  D
Sbjct: 272 ETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMD 331

Query: 190 EGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
               +  S  +   + ++    + L   +         VL
Sbjct: 332 ---IVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVL 368



 Score = 54.5 bits (129), Expect = 3e-10
 Identities = 3/58 (5%), Positives = 10/58 (17%)

Query: 131 LTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMR 188
                          ++  + + +           +      D      IV    +  
Sbjct: 2   PIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSF 59


>1e2fA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 78.1 bits (191), Expect = 3e-17
 Identities = 21/190 (11%), Positives = 41/190 (21%), Gaps = 9/190 (4%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q +    
Sbjct: 3   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVE 62

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                    V +    +        K         +                +       
Sbjct: 63  DHS------VHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 116

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
               G+ +   V  L    A   K          R          +            + 
Sbjct: 117 QPDVGLPKPDLVLFLQLQLADAAKRGAF---GHERYENGAFQERALRCFHQLMKDTTLNW 173

Query: 211 AILLHRRVLA 220
            ++   + + 
Sbjct: 174 KMVDASKSIE 183


>2dr3B [x.x.x] UPF0273 PROTEIN PH0284
          Length = 240

 Score = 77.8 bits (190), Expect = 3e-17
 Identities = 17/232 (7%), Positives = 42/232 (18%), Gaps = 32/232 (13%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
            V+ G     + +   I    V  L G  G+GK+   +                 L    
Sbjct: 3   RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP 62

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
            +    +       +      +  +        G                          
Sbjct: 63  VQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK------------------------ 98

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR---EMRD 189
              +         +             A   ++D                +L+    +  
Sbjct: 99  ---YIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAG 155

Query: 190 EGATLLVSTHDLAGVGELCDEAILL--HRRVLAHGSPDRVLVPELMLRAFGL 239
            G T +  +    G        +       +          +   ++     
Sbjct: 156 TGCTSIFVSQVSVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMR 207


>3cddF [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 319

 Score = 77.6 bits (189), Expect = 4e-17
 Identities = 16/234 (6%), Positives = 44/234 (18%), Gaps = 6/234 (2%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
                      +++                 +      TL +    +  P    V ++  
Sbjct: 72  WVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTD 131

Query: 69  P----PAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                     + G   +   +        +   D            T+           +
Sbjct: 132 VGEPFQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVK 191

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
           A            +    + G +     +        + + +E              R  
Sbjct: 192 AARGRFSWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQR 251

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAFG 238
              +   A   V+   +            L   +   G  + ++   L      
Sbjct: 252 SIGK-SNAEYTVTGWRIPQT-GKLWNINTLVPVIDEIGLDEELIASILFSEDDA 303


>3bczC [x.x.x] PROTEIN MEMO1
          Length = 284

 Score = 77.3 bits (188), Expect = 4e-17
 Identities = 16/206 (7%), Positives = 43/206 (20%), Gaps = 4/206 (1%)

Query: 25  VTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYV-P 83
                G          N   +  L +  +     ++      G     +        V P
Sbjct: 4   EASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDP 63

Query: 84  QSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALS 143
              +  +         +       + + R P    R       E          Q     
Sbjct: 64  SITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDE 123

Query: 144 GGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAG 203
                  + A+  +      ++      + +  E+   ++  +   + + L V + D   
Sbjct: 124 HSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFC- 182

Query: 204 VGELCDEAILLHRRVLAHGSPDRVLV 229
                      +           +  
Sbjct: 183 --HWGQRFRYSYYDESQGEIYRSIEH 206


>3cmvE [x.x.x] PROTEIN RECA
          Length = 1165

 Score = 77.2 bits (188), Expect = 5e-17
 Identities = 23/237 (9%), Positives = 49/237 (20%), Gaps = 10/237 (4%)

Query: 7   LEVREVTVRYGDVLALDNVTV--EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               +V       L+LD       +  G +  + G   SGK+TL   +      +     
Sbjct: 600 DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 659

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                 A              + +  + P      + +          R    D   V  
Sbjct: 660 FIDAEHAL-DPIYARKLGVDIDNLLCSQPDTGEQALEICDALA-----RSGAVDVIVVDS 713

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
               T   ++       +S   RK A   +                         I R+ 
Sbjct: 714 VAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIG 773

Query: 185 -REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGL 239
             +  +           +        +                 ++   +  +    
Sbjct: 774 AVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEK 830



 Score = 63.0 bits (151), Expect = 9e-13
 Identities = 22/220 (10%), Positives = 39/220 (17%), Gaps = 8/220 (3%)

Query: 8   EVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
              E        L +      +  G +  + G   SGK+TL   +      +        
Sbjct: 304 MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFID 363

Query: 68  LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
              A          V     +          + +           R    D   V     
Sbjct: 364 AEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDAL------ARSGAVDVIVVDSVAA 417

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
            T   ++       +S   RK A   +                         I R+    
Sbjct: 418 LTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK 477

Query: 188 RDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPD 225
             E           +        +                
Sbjct: 478 EGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYG 517



 Score = 42.2 bits (97), Expect = 2e-06
 Identities = 10/61 (16%), Positives = 19/61 (31%), Gaps = 5/61 (8%)

Query: 9  VREVTVRYGDVLALDNV--TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          V  ++       +LD       +  G +  + G   SGK+TL   +      +       
Sbjct: 1  VETISTGSL---SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI 57

Query: 67 G 67
           
Sbjct: 58 D 58


>1cr2A [c.37.1] DNA PRIMASE/HELICASE
          Length = 239

 Score = 77.0 bits (188), Expect = 5e-17
 Identities = 32/247 (12%), Positives = 64/247 (25%), Gaps = 29/247 (11%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
                V + +     +++ T+    G V  +   +G GKST ++  A       G     
Sbjct: 10  SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL 69

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                               +         +  +          + +    +     +  
Sbjct: 70  A-----------------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF 112

Query: 127 ERTGLTDLAH-RQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
           +     D  H          +            G  V +LD         +  T ++   
Sbjct: 113 DELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF- 171

Query: 186 EMRDEGATLLVSTHDLAGVGE-LCDEAILLHR-RVLAHGSP------DRVLVPEL-MLRA 236
             +  G  L+V  H  +G    L D  I L R  ++           D  +   +   + 
Sbjct: 172 -AKSTGVVLVVICHLKSGALRQLSDTIIALERNNLVLVRILKCRFTGDTGIAGYMEYNKE 230

Query: 237 FGLEEPA 243
            G  EP+
Sbjct: 231 TGWLEPS 237


>2bkhA [x.x.x] UNCONVENTIONAL MYOSIN
          Length = 787

 Score = 76.9 bits (187), Expect = 6e-17
 Identities = 13/178 (7%), Positives = 35/178 (19%), Gaps = 5/178 (2%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
                    +            +       + G +G+GK+   K +   +T   G  +  
Sbjct: 116 SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDI 175

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR-DAVAEA 125
                +A             +             +   +           S      +  
Sbjct: 176 DDRIVEANPLLEAFGNA---KTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRI 232

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIAR-GIAQGATVFLLDEPFAGVDKPSERTIVR 182
             +       H      +G                             +K +++ I++
Sbjct: 233 CVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQ 290


>3cddC [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 322

 Score = 76.6 bits (187), Expect = 7e-17
 Identities = 19/233 (8%), Positives = 52/233 (22%), Gaps = 39/233 (16%)

Query: 23  DNVTVEIGRGVVCGLLGANGSGKSTLLKTIA--------ELVTPQSGHVRIHGLPPAQAR 74
           + + ++          G    G + +  T +                   I  +   QA 
Sbjct: 1   EEIVLKA--------GGKIYQGWTKIGITRSLEASGAFDLETYKFQYKAFIEPIKQGQAC 52

Query: 75  K---NGLLGYVPQSEQVDWAFPVRVID-----VVMMGRYGHMGLTRRPR----KSDRDAV 122
                G        +    ++    I                 +         ++     
Sbjct: 53  TVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIA 112

Query: 123 AEALERTGLTDLAHRQIGA------LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
               +  G+  + +  +G       +  G+     +AR   Q   V L  + F  +    
Sbjct: 113 DIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLAKQ-RGVLLTSDTFGNLVITR 171

Query: 177 ERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                  +  +   G  +  +    +   +   +  +      L      +  
Sbjct: 172 ASKTKAGVSLIL--GDNVKAARGRFS-WRQRFSKFTIKADSAGLPTVGGIKAD 221


>1cr0A [c.37.1] DNA PRIMASE/HELICASE
          Length = 241

 Score = 76.6 bits (187), Expect = 7e-17
 Identities = 32/249 (12%), Positives = 67/249 (26%), Gaps = 31/249 (12%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
                V + +     +++ T+    G V  +   +G GKST ++  A       G     
Sbjct: 10  SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL 69

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                               +         +  +          + +    +     +  
Sbjct: 70  -----------------AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF 112

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIA--QGATVFLLDEPFAGVDKPSERTIVRVL 184
           +     D  H           +       +    G  V +LD       K  +  + ++ 
Sbjct: 113 DELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLK 170

Query: 185 REMRDEGATLLVSTH--DLAGVGELCDEAILLHR-RVLAHGSPDRVLVPEL-------ML 234
              +  G  L+V  H  DL  + +L D  I L R +++           +          
Sbjct: 171 GFAKSTGVVLVVICHLKDLRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYN 230

Query: 235 RAFGLEEPA 243
           +  G  EP+
Sbjct: 231 KETGWLEPS 239


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score = 76.5 bits (186), Expect = 7e-17
 Identities = 58/218 (26%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
           +V+  +V    ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I       
Sbjct: 2   SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKR--- 58

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
                 +   P +E+      +     V       + L    ++     V +  E   L 
Sbjct: 59  ------MNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLA 112

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-G 191
            L  R+  ALSGGQR+R  I R +    +VFLLDEP + +D      +   +  +    G
Sbjct: 113 HLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLG 172

Query: 192 ATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            T++  THD      L D+ ++L   RV   G P  + 
Sbjct: 173 RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 210


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 76.4 bits (186), Expect = 8e-17
 Identities = 44/229 (19%), Positives = 85/229 (37%), Gaps = 7/229 (3%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV--- 63
           LE+R++         L  V + + +G V  L+G NG+GKSTL K +A             
Sbjct: 3   LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEIL 62

Query: 64  --RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
               + L  +   +     ++     V+         + +  +              +  
Sbjct: 63  LDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVK 122

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
            A  L     + L+       SGG++KR  I + +    T  +LDE  +G+D  + + + 
Sbjct: 123 KALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVA 182

Query: 182 RVL-REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           R +          L+++ +         D+  ++   RV+A G P+  L
Sbjct: 183 RGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELAL 231


>1e9sJ [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 76.2 bits (186), Expect = 9e-17
 Identities = 21/215 (9%), Positives = 47/215 (21%), Gaps = 28/215 (13%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + 
Sbjct: 25  GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMV 84

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
           I                       D               +  +         D      
Sbjct: 85  IVDPNGDMLS--------KFGRDKDIILNPYDQRTKGWSFFNEI-----RNDYDWQRY-- 129

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
                             +    + A   R + +     L       + +    T +   
Sbjct: 130 ---------ALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATF 180

Query: 185 REMRD---EGATLLVSTHDLAGVGELCDEAILLHR 216
            ++R          +          L     +L  
Sbjct: 181 DDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD 215


>3c8uA [x.x.x] FRUCTOKINASE
          Length = 203

 Score = 76.1 bits (186), Expect = 1e-16
 Identities = 32/222 (14%), Positives = 51/222 (22%), Gaps = 24/222 (10%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
           T+       L+ +        +  L GA GSGKSTL   +A  ++ Q     +       
Sbjct: 2   TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVV------ 55

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
                     P    +D         +   G           R        E      + 
Sbjct: 56  ----------PDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQER----VIY 101

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS--ERTIVRVLREMRDE 190
            L  R       G  +     R         L D P              + V  ++   
Sbjct: 102 PLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPADLEAR 161

Query: 191 G-ATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVP 230
                L    +            L +   + A   P  +  P
Sbjct: 162 LVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP 203


>2bx2L [x.x.x] RIBONUCLEASE E
          Length = 500

 Score = 75.9 bits (185), Expect = 1e-16
 Identities = 18/150 (12%), Positives = 37/150 (24%), Gaps = 9/150 (6%)

Query: 83  PQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ---I 139
           P     +    VR     +    G +           +   + +   G  D + +     
Sbjct: 198 PFLIHQESNVIVRAFRDYLRQDIGEI---LIDNPKVLELARQHIAALGRPDFSSKIKLYT 254

Query: 140 GALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTH 199
           G +      +       A    V L       +D     T + +     D   T   +  
Sbjct: 255 GEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNL 314

Query: 200 DLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           + A   E+  +  L     ++     D   
Sbjct: 315 EAA--DEIARQLRLRDLGGLIVIDFIDMTP 342


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 75.7 bits (184), Expect = 1e-16
 Identities = 39/232 (16%), Positives = 74/232 (31%), Gaps = 10/232 (4%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH---- 62
           L ++++ V   D   L  +++++  G V  ++G NGSGKSTL  T+A     +       
Sbjct: 2   LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
            +   L           G     +       V     +            +      D  
Sbjct: 62  FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 123 AEA-----LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
                   L +     L        SGG++KR  I +       + +LDE         +
Sbjct: 122 DLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALK 181

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                V      + + ++V+ +         D   +L++ R++  G    V 
Sbjct: 182 VVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 233


>1e3mB [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
           PROTEIN MUTS
          Length = 732

 Score = 75.5 bits (185), Expect = 2e-16
 Identities = 26/204 (12%), Positives = 51/204 (25%), Gaps = 11/204 (5%)

Query: 47  TLLKTIAEL-VTPQSGHVRIH---GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMM 102
            +L  +AE   T            G+   + R   ++  V     +     +     +++
Sbjct: 504 DVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHP-VVEQVLNEPFIANPLNLSPQRRLII 562

Query: 103 GRYGHMGLTRRPRKSDRDAVAEA-LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGAT 161
                   T R       A   + +    +      +I    G   +             
Sbjct: 563 TGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTFVETETANILHNATEY 622

Query: 162 VFLLDEPFAGVDKPSERTIVRVL--REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RV 218
             +LDE   G       ++             A  L +TH          E +       
Sbjct: 623 SLVLDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEGVANVHLDA 682

Query: 219 LAHGSPDRV--LVPELMLRAFGLE 240
           L HG       +      +++GL 
Sbjct: 683 LEHGDTIAFHSVQDGAASKSYGLA 706


>2ck3C [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
          Length = 490

 Score = 75.5 bits (184), Expect = 2e-16
 Identities = 17/229 (7%), Positives = 44/229 (19%), Gaps = 29/229 (12%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
           +  P  +    V       +   +  V IGRG    ++G   +GK+++           +
Sbjct: 111 LKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN 170

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                           G                  +   +++                  
Sbjct: 171 DGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASD------------ 218

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
                             +  L+                  + + D+         + ++
Sbjct: 219 ---------------AAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSL 263

Query: 181 VRVLREMRDEGATLLVSTHDLAGVGELCD-EAILLHRRVLAHGSPDRVL 228
           +      R E     V       +              + A    +   
Sbjct: 264 LLRRPPGR-EAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQA 311


>3dymA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 75.5 bits (183), Expect = 2e-16
 Identities = 9/127 (7%), Positives = 25/127 (19%), Gaps = 3/127 (2%)

Query: 101 MMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGI--AQ 158
              R+     +    +       + L               +   +  R      +   +
Sbjct: 740 GNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK 799

Query: 159 GATVFLLDEPFAGVDKPSERTIVRVLREM-RDEGATLLVSTHDLAGVGELCDEAILLHRR 217
            A  +  +         +    V +            L  +     +      AI +   
Sbjct: 800 AAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVE 859

Query: 218 VLAHGSP 224
           V +    
Sbjct: 860 VASDTPH 866


>3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 409

 Score = 75.3 bits (183), Expect = 2e-16
 Identities = 23/232 (9%), Positives = 61/232 (26%), Gaps = 14/232 (6%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
                  LD +T    R     +      GK+      A+ ++     V +H        
Sbjct: 151 VPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS------- 203

Query: 75  KNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDL 134
              +         +  A  +    +    R        +   +  +     +        
Sbjct: 204 -LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQ 262

Query: 135 AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM--RDEGA 192
           +   I + +   +++    R I     + LL+   A   + ++ + +    +   R+   
Sbjct: 263 SVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDV 322

Query: 193 TLLVSTHDLAGVGELCDEAILL----HRRVLAHGSPDRVLVPELMLRAFGLE 240
            ++  +     V +  D+  +L        L   +     +          E
Sbjct: 323 VVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDKESE 374



 Score = 52.9 bits (125), Expect = 9e-10
 Identities = 5/71 (7%), Positives = 13/71 (18%)

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
           +   E   + +          G      F  + + +           A V +   +    
Sbjct: 11  SILTEPELIKECPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGF 70

Query: 183 VLREMRDEGAT 193
                      
Sbjct: 71  GYLTELAASVA 81


>3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 419

 Score = 75.2 bits (183), Expect = 2e-16
 Identities = 20/242 (8%), Positives = 61/242 (25%), Gaps = 26/242 (10%)

Query: 12  VTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPA 71
           +T        LD +T    R     +      GK+      A+ ++     V +H     
Sbjct: 158 ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHS---- 213

Query: 72  QARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL 131
                     +   ++ +    +     +   +              + ++A        
Sbjct: 214 ----------LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSN 263

Query: 132 TDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM---- 187
            ++  +   +++    K     R       + ++D         +  +    + ++    
Sbjct: 264 INIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDL 323

Query: 188 ----RDEGATLLVSTHDLAGVGELCDEAILLH----RRVLAHGSPDRVLVPELMLRAFGL 239
               R+    ++  +     V +  D+  +L        L   +     +          
Sbjct: 324 KKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDKES 383

Query: 240 EE 241
           E 
Sbjct: 384 ES 385


>3cr7A [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 179

 Score = 75.0 bits (183), Expect = 2e-16
 Identities = 27/188 (14%), Positives = 47/188 (25%), Gaps = 30/188 (15%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG----LPPAQARKNGLLGYVPQSE 86
           RG+   L G + SGKSTL   +   +               +     +  G         
Sbjct: 1   RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNEN 60

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT-------------- 132
               A       +        +     P + DRD   +  E TGL               
Sbjct: 61  IRRIAEV---AKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEVYVDVPVEVAE 117

Query: 133 --DLAHRQIGALSGGQRKR-AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRD 189
             D       A  G  ++     A   A       +      V    +    +++  +  
Sbjct: 118 QRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVK----QIIDYLDT 173

Query: 190 EGATLLVS 197
           +G     +
Sbjct: 174 KGYL--PA 179


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score = 74.6 bits (181), Expect = 3e-16
 Identities = 44/211 (20%), Positives = 90/211 (42%), Gaps = 10/211 (4%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +E+  ++ ++ +  +LDN+++++  G    +LG  G+GK+  L+ IA    P SG + + 
Sbjct: 2   IEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLD 60

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
           G          +    P+   + + +    +   M  +       R  +  D   V +  
Sbjct: 61  G--------KDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTA 112

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
               +  L  R    LSGG+++R  +AR +     + LLDEP + +D  ++     +L  
Sbjct: 113 RDLKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSV 172

Query: 187 MRDE-GATLLVSTHDLAGVGELCDEAILLHR 216
           +  +   T+L  THD      + D   ++  
Sbjct: 173 LHKKNKLTVLHITHDQTEARIMADRIAVVMD 203



 Score = 48.0 bits (112), Expect = 3e-08
 Identities = 4/44 (9%), Positives = 10/44 (22%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
             +V   +         + +  AE +    G         +   
Sbjct: 302 GALVRVKVDCGVPLNVLITRRSAEEMELSPGVQIYARFKASSVH 345


>1dhiA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 74.5 bits (182), Expect = 3e-16
 Identities = 13/127 (10%), Positives = 32/127 (25%), Gaps = 2/127 (1%)

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            +A+   L  +      +     +  G+     I R +     + L  +P         +
Sbjct: 17  ENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVK 76

Query: 179 TIVRVLREMRDEG-ATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRA 236
           ++   +    D     ++              +  L H    +   +      P+     
Sbjct: 77  SVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESV 136

Query: 237 FGLEEPA 243
           F     A
Sbjct: 137 FSEFHDA 143


>2c9oC [x.x.x] RUVB-LIKE 1
          Length = 311

 Score = 74.4 bits (181), Expect = 3e-16
 Identities = 17/215 (7%), Positives = 49/215 (22%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQA 73
            R    + ++ +  +   G    L G  G+GK+ L   IA+ +  +     + G      
Sbjct: 39  AREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST 98

Query: 74  RKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTD 133
                   +    +             ++       L      +             L  
Sbjct: 99  EIKKTEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKVVNKYIDQGIAELVP 158

Query: 134 LAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGAT 193
                            ++ R +       ++     G         +     +  +   
Sbjct: 159 GVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLD 218

Query: 194 LLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
            ++    +    +   + I +  +       +  L
Sbjct: 219 RVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEAL 253


>1e9rD [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 415

 Score = 73.9 bits (180), Expect = 4e-16
 Identities = 23/229 (10%), Positives = 51/229 (22%), Gaps = 29/229 (12%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 19  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 78

Query: 64  RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
            I         K G    +  +            + +               +       
Sbjct: 79  VIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT---- 134

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                                   + A   R + +     L       + +    T +  
Sbjct: 135 --------------------DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIAT 174

Query: 184 LREMRDE---GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
             ++R          +          L     +L          PD   
Sbjct: 175 FDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDF 223


>1e9sB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 73.9 bits (180), Expect = 5e-16
 Identities = 24/210 (11%), Positives = 53/210 (25%), Gaps = 17/210 (8%)

Query: 8   EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27  KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67  G-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
                 L      K+     +   +Q    +                   +R   S    
Sbjct: 87  DPNGDMLSKFGRDKD---IILNPYDQRTKGWSFFNEIRNDYDW-------QRYALSVVPR 136

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
                     +                     R +    T+   D+    ++     ++ 
Sbjct: 137 GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF 196

Query: 182 RVLREMRDE-GATLLVSTHDLAGVGELCDE 210
               E      +   V +  L     + D 
Sbjct: 197 AGSNEASKALTSARFVLSDKLPEHVTMPDG 226


>2bv7A [x.x.x] GLYCOLIPID TRANSFER PROTEIN
          Length = 202

 Score = 73.8 bits (180), Expect = 5e-16
 Identities = 14/214 (6%), Positives = 40/214 (18%), Gaps = 35/214 (16%)

Query: 3   TPPALEVREVTVRYGDVLALDNVTVEIGRG-------VVCGLLGANGSGKSTLLKTIAEL 55
           T P LE       +     L +      +         +  +   N +   TL   +   
Sbjct: 13  TGPFLEAVSHLPPF--FDCLGSPVFTPIKADISGNITKIKAVYDTNPTKFRTLQNILEVE 70

Query: 56  VTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR 115
                      G                          + +   +   +     +    R
Sbjct: 71  KEMYGAEWPKVG---------------------ATLALMWLKRGLRFIQVFLQSICDGER 109

Query: 116 KSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKP 175
             +   +            A+        G   +      +          +  +     
Sbjct: 110 DENHPNLIRVNATK-----AYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNV 164

Query: 176 SERTIVRVLREMRDEGATLLVSTHDLAGVGELCD 209
           +E   +  +R         +   +++        
Sbjct: 165 TEEECLEKVRLFLVNYTATIDVIYEMYTRMNAEL 198


>1e2gA [c.37.1] THYMIDYLATE KINASE
          Length = 205

 Score = 73.6 bits (179), Expect = 6e-16
 Identities = 24/196 (12%), Positives = 45/196 (22%), Gaps = 15/196 (7%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG +  L G + +GKST  + + E +        +   P        LL    Q  +   
Sbjct: 2   RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQ--KKSD 59

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                V  +    R+  +       K         +                +       
Sbjct: 60  VEDHSVHLLFSANRWEQV----PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCK 115

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE 210
               G+ +   V  L    A   K  ER                         + +    
Sbjct: 116 QPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQLMKDTTLN 167

Query: 211 AILLHR-RVLAHGSPD 225
             ++   + +     D
Sbjct: 168 WKMVDASKSIEAVHED 183


>1ai4B [d.153.1] PENICILLIN AMIDOHYDROLASE
          Length = 557

 Score = 73.6 bits (179), Expect = 6e-16
 Identities = 19/219 (8%), Positives = 41/219 (18%), Gaps = 19/219 (8%)

Query: 26  TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQA------------ 73
           T+      V G +G   +G     ++  +   P  G  +                     
Sbjct: 176 TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSG 235

Query: 74  ------RKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
                                 W    RV ++  +          +     R    + L 
Sbjct: 236 YIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLN 295

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
                         L+    +R  +           L D+        S    V +   +
Sbjct: 296 LRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSML 355

Query: 188 RDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPD 225
           +      +    D        +         +       
Sbjct: 356 KRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNISVGAK 394


>1e6cA [c.37.1] SHIKIMATE KINASE
          Length = 170

 Score = 73.2 bits (178), Expect = 7e-16
 Identities = 22/166 (13%), Positives = 49/166 (29%), Gaps = 11/166 (6%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL------LGYVPQSEQ 87
              ++GA G G +T+ + +A  +  +     I     +      +       G+  +  +
Sbjct: 4   PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESE 63

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL---TDLAHRQIGALSG 144
              A       V   G    +   R+  ++    V        L      + +     + 
Sbjct: 64  ALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPTL 123

Query: 145 GQRKRAFIARGIAQGATVFLLDEPFAGVD--KPSERTIVRVLREMR 188
             R  A     + +       D     VD  +P    +  +++ MR
Sbjct: 124 TGRPIAEEMEAVLREREALYQDVAHYVVDATQPPAAIVCELMQTMR 169


>2bwjA [x.x.x] ADENYLATE KINASE 5
          Length = 196

 Score = 73.2 bits (178), Expect = 8e-16
 Identities = 17/199 (8%), Positives = 49/199 (24%), Gaps = 14/199 (7%)

Query: 25  VTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR--IHGLPPAQARKNGLLGYV 82
              ++ +  +  ++G  GSGK T  + + E            +     +++ ++ L+  +
Sbjct: 2   FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDI 61

Query: 83  PQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGAL 142
            +   +  +  V  +    M                     E  +              +
Sbjct: 62  MERGDLVPSGIVLELLKEAMVASLGD----TRGFLIDGYPREVKQGEEFGRRIGDPQLVI 117

Query: 143 SGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHD-- 200
                      R +    +   +D+    + K  E      +  +        +   +  
Sbjct: 118 CMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 177

Query: 201 ------LAGVGELCDEAIL 213
                    +    D   L
Sbjct: 178 GTPEDVFLQLCTAIDSIFL 196


>3bb1A [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 252

 Score = 73.1 bits (178), Expect = 8e-16
 Identities = 26/245 (10%), Positives = 67/245 (27%), Gaps = 15/245 (6%)

Query: 7   LEVREVTVRYGDVL--ALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +          L   L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 11  SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 70

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
             G  P    ++     +   +         + D+ +      +      +  D     +
Sbjct: 71  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFL----LDKTIDVLLYVD 126

Query: 125 ALERTGLTDLA------HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            L+   + +L                  +    +             DE F+   +   +
Sbjct: 127 RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQ 186

Query: 179 TIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL-VPELMLRAF 237
            +VR    ++ +   +L+         +  DE +L +           +  V      + 
Sbjct: 187 -VVRSGASLKSDIPVVLIENSGRCNKNDS-DEKVLPNGIAWIPHLVQTITEVALNKSESI 244

Query: 238 GLEEP 242
            +++ 
Sbjct: 245 FVDKN 249


>2c0bL [x.x.x] RIBONUCLEASE E
          Length = 488

 Score = 72.8 bits (177), Expect = 1e-15
 Identities = 20/165 (12%), Positives = 40/165 (24%), Gaps = 17/165 (10%)

Query: 80  GYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQI 139
            ++      +    VR     +    G + +              AL R   +       
Sbjct: 188 PFLIHQ---ESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKIKLYT 244

Query: 140 GALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV------------LREM 187
           G +      +       A    V L       +D     T + +                
Sbjct: 245 GEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARDIEETAFNTNLE 304

Query: 188 RDEGATLLVSTHDLAG--VGELCDEAILLHRRVLAHGSPDRVLVP 230
             +     +   DL G  V +  D   + H+R + +   + V   
Sbjct: 305 AADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAVRQD 349


>2dr3E [x.x.x] UPF0273 PROTEIN PH0284
          Length = 236

 Score = 72.7 bits (177), Expect = 1e-15
 Identities = 23/227 (10%), Positives = 47/227 (20%), Gaps = 40/227 (17%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG----- 67
            V+ G     + +   I    V  L G  G+GK+   +                      
Sbjct: 3   RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP 62

Query: 68  LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALE 127
           +   Q       G+  +  +    F +       +G+                       
Sbjct: 63  VQVRQNMAQ--FGWDVKPYEEKGMFAMVDAFTAGIGKEYEK------------------- 101

Query: 128 RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV---RVL 184
                   +         +             A   ++D                  ++ 
Sbjct: 102 --------YIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLK 153

Query: 185 REMRDEGAT--LLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           R +   G T   +       GV    D  I L    +        ++
Sbjct: 154 RVLAGTGCTSIFVSQVSVGPGVEHGVDGIIRLDLDEIDGELKRSLIV 200


>2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 294

 Score = 72.5 bits (176), Expect = 1e-15
 Identities = 19/219 (8%), Positives = 50/219 (22%), Gaps = 22/219 (10%)

Query: 1   MTTPPALEVREVTVRY--GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTP 58
            T     + R    +   G       +   I    +    G  GSGK+ L   ++  V  
Sbjct: 62  KTALEVKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQL 121

Query: 59  QSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSD 118
                 + G              V    +  + +         +G      +        
Sbjct: 122 PPEKGGLSG------------KAVYIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRA 169

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            +             +       +S     +  +   +               V +    
Sbjct: 170 INTD-------HQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLN 222

Query: 179 TIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR 216
             +  L  + +     ++++   +  +  +    I L +
Sbjct: 223 KHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRIQLKK 261


>3da4A [x.x.x] COLICIN-M
          Length = 270

 Score = 72.4 bits (176), Expect = 1e-15
 Identities = 13/185 (7%), Positives = 36/185 (19%), Gaps = 30/185 (16%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
                 +    ++V                       +       +T +  +A  +    
Sbjct: 84  NADRNLVLHPGISVYDAYH---FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNG 140

Query: 61  GHVRIHG------------LPPAQARKNGLLGYVPQSEQVDW---------------AFP 93
               ++                    K+G++G  P S +                     
Sbjct: 141 AERSVNIANIGLKISPMKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITL 200

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
                + +                D+     +  R  + +   R     SG + +     
Sbjct: 201 KTEGTLTISANGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKEYQILLPG 260

Query: 154 RGIAQ 158
               +
Sbjct: 261 EIHIK 265


>3dt4C [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
          Length = 620

 Score = 72.4 bits (176), Expect = 1e-15
 Identities = 20/210 (9%), Positives = 43/210 (20%), Gaps = 10/210 (4%)

Query: 1   MTTPPALEVREVTVRY----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
                AL +     +      + + +  +T   G+         +  GK+ L      L 
Sbjct: 240 GKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLP 299

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
             +   V           +  L    P++     A    V       +      T     
Sbjct: 300 GWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKT-IQKNTIFTNV 358

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVD--- 173
           ++        E           I +    + +           +           +D   
Sbjct: 359 AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW 418

Query: 174 --KPSERTIVRVLREMRDEGATLLVSTHDL 201
                      +    R  G  L+      
Sbjct: 419 ESPEGVPIEGIIFGGRRPAGVPLVYEALSW 448


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 72.3 bits (175), Expect = 1e-15
 Identities = 51/211 (24%), Positives = 83/211 (39%), Gaps = 21/211 (9%)

Query: 28  EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQ 87
           EI +G V G++G NG GK+T +K +A +  P  G V                        
Sbjct: 364 EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD--------------------L 403

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
                P  +        Y  +      + +      E L+  G+ DL  R +  LSGG+ 
Sbjct: 404 TVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLKPLGIIDLYDRNVEDLSGGEL 463

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGE 206
           +R  IA  + + A ++LLDEP A +D      + R +R + ++   T LV  HD+  +  
Sbjct: 464 QRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDY 523

Query: 207 LCDEAILLHRRVLAHGSPDRVLVPELMLRAF 237
           + D  I+       HG     +     +  F
Sbjct: 524 VSDRLIVFEGEPGRHGRALPPMGMREGMNRF 554



 Score = 57.3 bits (136), Expect = 5e-11
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 2/172 (1%)

Query: 55  LVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRP 114
            + P             +A +   L    +  +     PV     V +      G  R  
Sbjct: 126 QLIPNLCEDNDSWDNVIRAFRGNELQNYFERLKNGEIRPVVKPQYVDLLPKAVKGKVREL 185

Query: 115 RKSDRDA--VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGV 172
            K   +     E ++   L ++  R++  LSGG+ +R  IA  + + A  +  DEP + +
Sbjct: 186 LKKVDEVGKFEEVVKELELENVLDRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYL 245

Query: 173 DKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSP 224
           D      + RV+R + +EG  +LV  HDLA +  L D   +++     +G  
Sbjct: 246 DIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLSDVIHVVYGEPGVYGIF 297


>3adkA [x.x.x] ADENYLATE KINASE
          Length = 194

 Score = 72.0 bits (175), Expect = 2e-15
 Identities = 20/186 (10%), Positives = 46/186 (24%), Gaps = 3/186 (1%)

Query: 28  EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQ 87
           ++ +  +  ++G  GSGK T  + I +                 +       G +     
Sbjct: 4   KLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA--EVSSGSARGKMLSEIM 61

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
                      + M+       +             E  +         +    L     
Sbjct: 62  EKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAG 121

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAG-VGE 206
                 R + +G T   +D+    + K  E         +       +V   +  G V +
Sbjct: 122 PETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDD 181

Query: 207 LCDEAI 212
           +  +  
Sbjct: 182 VFSQVC 187


>3czjA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 71.9 bits (174), Expect = 2e-15
 Identities = 11/141 (7%), Positives = 27/141 (19%), Gaps = 3/141 (2%)

Query: 100 VMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAH--RQIGALSGGQRKRAFIARGIA 157
           +   R+     +    +       + L                 +S   R          
Sbjct: 739 LGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERW 798

Query: 158 QGATVFLLDEPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR 216
           + A  +  +         +    V +            L  +     +      AI +  
Sbjct: 799 KAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV 858

Query: 217 RVLAHGSPDRVLVPELMLRAF 237
            V +       +     L   
Sbjct: 859 EVASDTPHPARIGLNCQLAQV 879


>1cfrA [x.x.x] RESTRICTION ENDONUCLEASE
          Length = 283

 Score = 71.6 bits (175), Expect = 2e-15
 Identities = 27/214 (12%), Positives = 55/214 (25%), Gaps = 34/214 (15%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIH---------GLPPAQARKNGLLGYVPQSE 86
            ++  +G G    + +    V     H+ I+         GL      +   LG      
Sbjct: 2   DIISKSGEGNKYTINSAIAFVAYA-SHIDINTTEFSKVLSGLRDFINDEAIRLGGKISDG 60

Query: 87  QV--------DWAFPVRVID----------VVMMGRYGHMGLTRRPRKSDRDAVAEALER 128
                     +W   +R I+          VV M       +    +    + + +   +
Sbjct: 61  SFNKCNGDWYEWLIGIRAIEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSK 120

Query: 129 TGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMR 188
             L       +  ++          RG  +     L D  F+ +   +   I  + +   
Sbjct: 121 LSL-----NNVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFI 175

Query: 189 DE-GATLLVSTHDLAGVGELCDEAILLHRRVLAH 221
           D      + S   +           L H   L  
Sbjct: 176 DYAELEHIKSFLSVKTTFRPDRRLQLAHEGSLMK 209


>3ch4B [x.x.x] PHOSPHOMEVALONATE KINASE
          Length = 188

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 18/202 (8%), Positives = 40/202 (19%), Gaps = 29/202 (14%)

Query: 24  NVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNG---LLG 80
              +     +V    G   SGK  + + +   +      V     P  +           
Sbjct: 3   MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ 62

Query: 81  YVPQSEQVDWAFPVRVIDVVMMGRYGH------MGLTRRPRKSDRDAVAEALERTGLTDL 134
           Y     +    +                       +           +    E  G    
Sbjct: 63  YKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQ 122

Query: 135 AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATL 194
             R +      Q++      G+    +   LD                       +   +
Sbjct: 123 TVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFG--------------------DFDWV 162

Query: 195 LVSTHDLAGVGELCDEAILLHR 216
           + +      + E  +  I   R
Sbjct: 163 IENHGVEQRLEEQLENLIEFIR 184


>3cr7D [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 183

 Score = 71.2 bits (173), Expect = 3e-15
 Identities = 23/187 (12%), Positives = 46/187 (24%), Gaps = 25/187 (13%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP----PAQARKNGLLGYVPQSE 86
           RG+   L G + SGKSTL   +   +                     +  G         
Sbjct: 2   RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNEN 61

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL--------------- 131
               A   ++                R  +     + E  E TGL               
Sbjct: 62  IRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVEVYVDVPVEVAE 121

Query: 132 -TDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE 190
             D       A  G  ++   I+    +      +      +    +  + +++  +  +
Sbjct: 122 QRDPKGLYKKAREGVIKEFTGISA-PYEAPANPEVHVKNYELP--VQDAVKQIIDYLDTK 178

Query: 191 GATLLVS 197
           G     +
Sbjct: 179 GYL--PA 183


>5dfrA [x.x.x] DIHYDROFOLATE REDUCTASE
          Length = 154

 Score = 71.1 bits (173), Expect = 3e-15
 Identities = 12/130 (9%), Positives = 28/130 (21%), Gaps = 2/130 (1%)

Query: 113 RPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGV 172
                DR      L         +     +  G+     I R +     + L  +P    
Sbjct: 6   AALAVDRVIGPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDD 65

Query: 173 DKPSERTI-VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVP 230
                +++   +          ++              +  L H    +   +      P
Sbjct: 66  RVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEP 125

Query: 231 ELMLRAFGLE 240
           +     F   
Sbjct: 126 DDWESVFSEF 135


>3dfqA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 350

 Score = 70.9 bits (173), Expect = 4e-15
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 70.3 bits (170), Expect = 6e-15
 Identities = 44/225 (19%), Positives = 74/225 (32%), Gaps = 49/225 (21%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           +++++ VT  +G+V+   ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I
Sbjct: 2   SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 61

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                           +            RV  V  +   G   +               
Sbjct: 62  GEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSV---------- 111

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
                                                FLLDEP + +D      +   + 
Sbjct: 112 -------------------------------------FLLDEPLSNLDAALRVQMRIEIS 134

Query: 186 EMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            +    G T++  THD      L D+ ++L   RV   G P  + 
Sbjct: 135 RLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 179



 Score = 34.5 bits (77), Expect = 3e-04
 Identities = 9/60 (15%), Positives = 18/60 (30%), Gaps = 8/60 (13%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPA------QARKNGLLGYVPQ 84
            G    +     S +  L+    ++V  + G     GLPP       +         + +
Sbjct: 267 LGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTA--CRRLHK 324


>3dfoD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 360

 Score = 70.1 bits (171), Expect = 6e-15
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>1cr1A [c.37.1] DNA PRIMASE/HELICASE
          Length = 245

 Score = 70.0 bits (170), Expect = 7e-15
 Identities = 30/249 (12%), Positives = 65/249 (26%), Gaps = 35/249 (14%)

Query: 11  EVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP 70
            V + +     +++ T+    G V  +   +G GKST ++  A       G         
Sbjct: 14  SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA--- 70

Query: 71  AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTG 130
                           +         +  +          + +    +     +  +   
Sbjct: 71  --------------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELF 116

Query: 131 LTDLAHRQIGALSGGQRKRAFIARGIAQ--GATVFLLDEPFAGVDKPSERTIVRVLREMR 188
             D  H           +       +    G  V +LD       K  +  + ++    +
Sbjct: 117 GNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAK 174

Query: 189 DEGATLLVSTHDL------AGVGELCDEAILLHR-RVLAHGSPDRVLVPEL-------ML 234
             G  L+V  H          + +L D  I L R +++           +          
Sbjct: 175 STGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYN 234

Query: 235 RAFGLEEPA 243
           +  G  EP+
Sbjct: 235 KETGWLEPS 243


>1drbA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 69.9 bits (170), Expect = 7e-15
 Identities = 12/136 (8%), Positives = 30/136 (22%), Gaps = 2/136 (1%)

Query: 107 HMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLD 166
              L         +A+   L         +     +  G+     I R +     + L  
Sbjct: 5   IAALAVDRVIGMENAMPWNLPACLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSS 64

Query: 167 EPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSP 224
           +P         +++   +          ++              +  L H    +   + 
Sbjct: 65  QPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTH 124

Query: 225 DRVLVPELMLRAFGLE 240
                P+     F   
Sbjct: 125 FPDYEPDDWESVFSEF 140


>2bhjA [x.x.x] NITRIC OXIDE SYNTHASE
          Length = 414

 Score = 69.8 bits (170), Expect = 8e-15
 Identities = 18/194 (9%), Positives = 40/194 (20%), Gaps = 9/194 (4%)

Query: 55  LVTPQSGHVRIHGLPPAQARKNGL------LGYVPQSEQVDWAFPVRVIDVVMMGRYGHM 108
           +    SG +    L        G       L   P+ +       +     +      + 
Sbjct: 5   IKNWGSGEILHDTLHHKATSCLGSIMNPKSLTRGPRDKPTPLEELLP--HAIEFINQYYG 62

Query: 109 GLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEP 168
                  +     +    +    T      +  L    +     A           L   
Sbjct: 63  SFKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVF 122

Query: 169 FAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
            A     ++     + R +        + S   +            L    L   +  ++
Sbjct: 123 DARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQM 182

Query: 228 LVPELMLRAFGLEE 241
               +   A  LE 
Sbjct: 183 PDGTIRGDAATLEF 196


>3dfnC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 353

 Score = 69.8 bits (170), Expect = 8e-15
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>1eilA [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
          Length = 289

 Score = 69.8 bits (169), Expect = 8e-15
 Identities = 8/116 (6%), Positives = 25/116 (21%), Gaps = 5/116 (4%)

Query: 116 KSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKP 175
           +          +         + +G ++ G    A + R   +   + +       +   
Sbjct: 3   ERLGYLGFAVKDVPAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYA 62

Query: 176 SERTIV--RVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                    + R         +  T        +    ++         G P  + 
Sbjct: 63  GLEVDDAAALERMADKLRQAGVAFTRGD--EALMQQRKVMGLLCLQDPFGLPLEIY 116


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 69.8 bits (169), Expect = 8e-15
 Identities = 42/232 (18%), Positives = 76/232 (32%), Gaps = 12/232 (5%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI- 65
           L ++++ V   D   L  +++++  G V  ++G NGSGKSTL  T+A     +     + 
Sbjct: 2   LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE 61

Query: 66  -----HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVI---DVVMMGRYGHMGLTRRPRKS 117
                      + R    +    Q          +      +  +  Y       R    
Sbjct: 62  FKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQ 121

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
           D      AL +     L        SGG++KR  I +       + +LDE          
Sbjct: 122 DLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVV 181

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
              V  LR+ +     +      +       D   +L++ R++  G    V 
Sbjct: 182 ADGVNSLRDGKRSFIIVTH-YQRIL-DYIKPDYVHVLYQGRIVKSGDFTLVK 231


>3dfnA [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 350

 Score = 69.8 bits (170), Expect = 8e-15
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>3bb1E [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 248

 Score = 69.4 bits (168), Expect = 1e-14
 Identities = 21/226 (9%), Positives = 56/226 (24%), Gaps = 4/226 (1%)

Query: 7   LEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIA--ELVTPQSGH 62
             +           +  L N+  E    +   ++G  G GKS+ + +I    +V+     
Sbjct: 5   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 64

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
                       + G    +  +  +     +  + + ++  +            DR   
Sbjct: 65  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDA 124

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                   L   A           +    +             DE F+   +   + +  
Sbjct: 125 YRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRS 184

Query: 183 VLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
                +     +++  +         DE +L +           + 
Sbjct: 185 GASLKKASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTIT 230


>1aldA [c.1.10 (2aldA)] ALDOLASE A
          Length = 363

 Score = 69.0 bits (168), Expect = 1e-14
 Identities = 12/91 (13%), Positives = 25/91 (27%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           ++        +++ + IA  I       L  +   G      ++I     E        L
Sbjct: 2   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>2dr3F [x.x.x] UPF0273 PROTEIN PH0284
          Length = 236

 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 24/227 (10%), Positives = 50/227 (22%), Gaps = 34/227 (14%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP---P 70
           V+ G     + +   I    V  L G  G+GK+   +                 L     
Sbjct: 3   VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV 62

Query: 71  AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTG 130
              +     G+  +  +    F +       +G+                          
Sbjct: 63  QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDL-------------- 108

Query: 131 LTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE---RTIVRVLREM 187
                          +             A   ++D                I+++ R +
Sbjct: 109 -----------TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVL 157

Query: 188 RDEGATLLVSTHDLAG---VGELCDEAILLHRRVLAHGSPDRVLVPE 231
              G T +  +        V    D  I L    +       ++V +
Sbjct: 158 AGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWK 204


>2eg5G [x.x.x] XANTHOSINE METHYLTRANSFERASE
          Length = 343

 Score = 68.7 bits (166), Expect = 2e-14
 Identities = 17/201 (8%), Positives = 49/201 (24%), Gaps = 17/201 (8%)

Query: 5   PALEVREVTVRY-----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLL-----KTIAE 54
            A     +              L      I + +    LG      + L      ++I +
Sbjct: 9   SAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDK 68

Query: 55  LVTPQSGHVRIHGLPPAQARKNGLLG-YVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRR 113
           +   +   ++I          N +         +++     ++   ++    G       
Sbjct: 69  VGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLF 128

Query: 114 PRKSDRDAVAEALE------RTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDE 167
           P +S     +           +GL        G++   +  R  + +      T      
Sbjct: 129 PEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTF 188

Query: 168 PFAGVDKPSERTIVRVLREMR 188
                ++      + +    +
Sbjct: 189 LRIHSEELFSHGRMLLTCICK 209


>3dftD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 360

 Score = 68.2 bits (166), Expect = 2e-14
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>2dr3D [x.x.x] UPF0273 PROTEIN PH0284
          Length = 242

 Score = 68.2 bits (165), Expect = 2e-14
 Identities = 18/235 (7%), Positives = 43/235 (18%), Gaps = 27/235 (11%)

Query: 13  TVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQ 72
            V+ G     + +   I    V  L G  G+GK+   +                 L    
Sbjct: 3   RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHP 62

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
            +    +       +  +        V                                 
Sbjct: 63  VQVRQNMAQFGWDVK-PYEEKGMFAMVDAFTAGIGKSKEYEK------------------ 103

Query: 133 DLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE---RTIVRVLREMRD 189
              +         +             A   ++D                I+++ R +  
Sbjct: 104 ---YIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAG 160

Query: 190 EGATLLVSTHDLAGVGELCDEAILL--HRRVLAHGSPDRVLVPELMLRAFGLEEP 242
            G T +  +    G        +       +          +   ++        
Sbjct: 161 TGCTSIFVSQVSVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTS 215


>6aldA [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
          Length = 343

 Score = 67.9 bits (165), Expect = 3e-14
 Identities = 13/91 (14%), Positives = 24/91 (26%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L  +   G      ++I     E        L
Sbjct: 1   HSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 60

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 61  LLTADDRVNPCIGGVILFHETLYQKADDGRP 91


>3dfqD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 361

 Score = 67.5 bits (164), Expect = 4e-14
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>2bjbA [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
          Length = 421

 Score = 67.4 bits (164), Expect = 4e-14
 Identities = 28/234 (11%), Positives = 51/234 (21%), Gaps = 23/234 (9%)

Query: 1   MTTPPALEVREVTV-RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
                AL+   + V   G  L +           V    G  G    T+L+ +  L    
Sbjct: 55  ELMLDALQTLGLRVDGVGSELTVSGRIEPGPGARV--DCGLAG----TVLRFVPPLAALG 108

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR-KSD 118
           S  V   G                          +R + V + G      +         
Sbjct: 109 SVPVTFDG------------DQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGG 156

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
             A+  +     ++ L      A              +     + +            + 
Sbjct: 157 TVAIDASASSQFVSGLLLS--AASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDD 214

Query: 179 TIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPE 231
           +     +       A       DL         A++    V   G P   + P 
Sbjct: 215 STPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSGGTVRITGWPRVSVQPA 268


>1e4yA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score = 67.4 bits (163), Expect = 4e-14
 Identities = 14/195 (7%), Positives = 27/195 (13%), Gaps = 27/195 (13%)

Query: 35  CGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPV 94
             LLGA  +GK T  + I E                                        
Sbjct: 3   IILLGALVAGKGTQAQFIMEKYGIPQISTGDML------------------------RAA 38

Query: 95  RVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIAR 154
                 +  +   +    +    +                    +        +   +  
Sbjct: 39  VKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKE 98

Query: 155 GIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILL 214
                  V   D P   +        V                           +E    
Sbjct: 99  AGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVY--HVKFNPPKVEGKDDVTGEELTTR 156

Query: 215 HR-RVLAHGSPDRVL 228
              +           
Sbjct: 157 KDDQEETVRKRLVEY 171


>1draA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 67.2 bits (163), Expect = 5e-14
 Identities = 13/127 (10%), Positives = 31/127 (24%), Gaps = 2/127 (1%)

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            +A+   L         +     +  G+     I R +     + L  +P         +
Sbjct: 17  ENAMPWNLPAELAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVK 76

Query: 179 TIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRA 236
           ++   +    D     ++              +  L H    +   +      P+     
Sbjct: 77  SVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESV 136

Query: 237 FGLEEPA 243
           F     A
Sbjct: 137 FSEFHDA 143


>2drcA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 67.2 bits (163), Expect = 5e-14
 Identities = 12/128 (9%), Positives = 30/128 (23%), Gaps = 2/128 (1%)

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
             +A+   L         +     +  G+     I R +     + L  +P         
Sbjct: 16  MENAMPFNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWV 75

Query: 178 RTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLR 235
           +++   +          ++              +  L H    +   +      P+    
Sbjct: 76  KSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWES 135

Query: 236 AFGLEEPA 243
            F     A
Sbjct: 136 VFSEFHDA 143


>3cm0A [x.x.x] ADENYLATE KINASE
          Length = 184

 Score = 67.0 bits (163), Expect = 5e-14
 Identities = 20/189 (10%), Positives = 47/189 (24%), Gaps = 16/189 (8%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL--LGYVPQSEQVD 89
           G     LG  G+GK T    +A+ +  +                     +  + +     
Sbjct: 2   GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPLGERVRPIMER---G 58

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRR--PRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
              P  +I  ++        +        +  +A+   L  TG      R +G +     
Sbjct: 59  DLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSETGT-----RLLGVVLVEVP 113

Query: 148 KRAFIARGIAQG---ATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAG 203
           +   + R + +          +E      +        ++           +        
Sbjct: 114 EEELVRRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDE 173

Query: 204 VGELCDEAI 212
           V      A+
Sbjct: 174 VYARIRAAL 182


>3b55A [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
          Length = 400

 Score = 67.0 bits (162), Expect = 6e-14
 Identities = 13/120 (10%), Positives = 28/120 (23%), Gaps = 5/120 (4%)

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
               + +         +    +                A++  L E   G          
Sbjct: 3   NTNQIAKWLEAHAKPLKTTNPTASLNDL--KPLKNVGSASIVGLGEATHGAH-EVFTKHR 59

Query: 182 RVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAFGLEE 241
            V   + ++G T LV         EL     +L  +         V   + +     + +
Sbjct: 60  IVKYLVSEKGFTNLVLEEGWDRALELDR--YVLTGKGNPSQHLTPVFKTKELDLLDWIRQ 117


>3d3qB [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 290

 Score = 66.9 bits (162), Expect = 6e-14
 Identities = 19/233 (8%), Positives = 49/233 (21%), Gaps = 23/233 (9%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           +  +  ++G   SGK+ L   +A+    +                            +D 
Sbjct: 1   KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDI 60

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHR---QIGALSGGQR 147
             P          +       +   +  +  +        +  L +    +       + 
Sbjct: 61  LPPDASFSAYEFKKR-AEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVKLKL 119

Query: 148 KR-AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM-----------------RD 189
           K    +              E    +   + + ++R +                     +
Sbjct: 120 KELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTEN 179

Query: 190 EGATLLVSTHDLAGVGELCDE-AILLHRRVLAHGSPDRVLVPELMLRAFGLEE 241
               L+           +     IL H                   +A G +E
Sbjct: 180 YDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAIGYKE 232


>2dr3C [x.x.x] UPF0273 PROTEIN PH0284
          Length = 233

 Score = 66.7 bits (161), Expect = 7e-14
 Identities = 14/195 (7%), Positives = 41/195 (21%), Gaps = 5/195 (2%)

Query: 39  GANGSGKSTLLKTIAELVTPQSGHVRI--HGLPPAQARKNGLLGYVPQSEQVDWAFPVRV 96
               +G   + + +   +  ++  +     G       +  L   +   E   +      
Sbjct: 2   RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH 61

Query: 97  IDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGI 156
              V           +   +    A+ +A          +         +          
Sbjct: 62  PVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVHDLTDIREFIEVLRQAIR 121

Query: 157 AQGATVFLLDEPFAGVDKPSERTIVRVL---REMRDEGATLLVSTHDLAGVGELCDEAIL 213
              A   ++D                +L   R +   G T +  +        +     L
Sbjct: 122 DINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGVEHGVDGIIRL 181

Query: 214 LHRRVLAHGSPDRVL 228
               +        ++
Sbjct: 182 DLDEIDGELKRSLIV 196


>2boeX [x.x.x] ENDOGLUCANASE E-2
          Length = 281

 Score = 66.7 bits (162), Expect = 7e-14
 Identities = 12/109 (11%), Positives = 31/109 (28%), Gaps = 9/109 (8%)

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVD----- 173
           RD +A   + T        Q   ++G        A+   +   + + + P          
Sbjct: 29  RDRIASVPQGTWFAHHNPGQ---ITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPS 85

Query: 174 -KPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAH 221
                  I      +++  A ++V    ++ +              +A+
Sbjct: 86  HSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAY 134


>1bmfC [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
          Length = 492

 Score = 66.6 bits (161), Expect = 7e-14
 Identities = 19/234 (8%), Positives = 46/234 (19%), Gaps = 39/234 (16%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
           +  P  +    V       +   +  V IGRG    ++G   +GK+++           +
Sbjct: 113 LKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN 172

Query: 61  GHVRIHG-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR 115
                             ++          +++  A  ++   VV         L     
Sbjct: 173 DGTDEKKKLYCIYVAIGQKR---STVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP 229

Query: 116 KSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKP 175
                                                         + + D+        
Sbjct: 230 -----------------------------YSGCSMGEYFRDNGKHALIIYDDLSKQAV-A 259

Query: 176 SERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAIL-LHRRVLAHGSPDRVL 228
             +  + + R    E     V       +              + A    +   
Sbjct: 260 YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQA 313


>3clvA [x.x.x] RAB5 PROTEIN, PUTATIVE
          Length = 175

 Score = 66.5 bits (161), Expect = 8e-14
 Identities = 19/176 (10%), Positives = 46/176 (26%), Gaps = 17/176 (9%)

Query: 28  EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPA------------QARK 75
           E        LLG +  GKS+++  + +    ++ +  I                      
Sbjct: 3   EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVVNLNDNYNENLCNI 62

Query: 76  NGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLA 135
              +      E+     P     +   G    + +      +  D     + +  ++   
Sbjct: 63  KFDIWDTAGQERYASIVP-----LYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNY 117

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG 191
              + A    +  +  I           LL    +     + + I  +L E   + 
Sbjct: 118 IIILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN 173


>3d1mA [x.x.x] SONIC HEDGEHOG PROTEIN
          Length = 148

 Score = 66.5 bits (161), Expect = 8e-14
 Identities = 17/131 (12%), Positives = 34/131 (25%), Gaps = 9/131 (6%)

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGI--AQGATVFLLDEPFAGVDKPSER 178
            +A       + +      G   G   + +   + +       +   DE   G D+   +
Sbjct: 2   PLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQ 61

Query: 179 TIVRVLREMRDE------GATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPEL 232
                L  +         G  L V+           +  +    R +   + DR      
Sbjct: 62  RCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEES-LHYEGRAVDITTSDRDRSKYG 120

Query: 233 MLRAFGLEEPA 243
           ML    +E   
Sbjct: 121 MLARLAVEAGF 131


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 66.4 bits (160), Expect = 8e-14
 Identities = 59/225 (26%), Positives = 97/225 (43%), Gaps = 7/225 (3%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           +++++ VT  +G+V+   ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I
Sbjct: 2   SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 61

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                                 V  ++ +     V       + L    ++     V + 
Sbjct: 62  GEKRMNDTPPAER-----GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV 116

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
            E   L  L  R+  ALSGGQR+R  I R +    +VFLLDEP + +D      +   + 
Sbjct: 117 AEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIS 176

Query: 186 EMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
            +    G T++  THD      L D+ ++L   RV   G P  + 
Sbjct: 177 RLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 221


>1cjaA [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
          Length = 327

 Score = 66.4 bits (160), Expect = 8e-14
 Identities = 12/168 (7%), Positives = 33/168 (19%), Gaps = 12/168 (7%)

Query: 45  KSTLLKTIAELVTPQSGHVRIHGLPPAQARKNG--LLGYVPQSEQVDWAFPVRVIDVVMM 102
            ++  + + +    Q G +    +    + +              +       V+ +   
Sbjct: 159 TTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLPIAWTNEGNLDNIMLSERGATVVPIDSK 218

Query: 103 GRYGHMGLTRRPRKSDRDA-VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGAT 161
                       R  +    +            + R I  L  G          I+    
Sbjct: 219 IIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLYTGYDVG--TEGSISMQEG 276

Query: 162 VFLLDEPFAGVDKPSERTIV-------RVLREMRDEGATLLVSTHDLA 202
                   A  D  +    +       +    +      +      L 
Sbjct: 277 FLATVRECASFDLDAFERELLSWQESLQKCHNLSISPQAIPFILRMLR 324


>3bjdB [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
          Length = 318

 Score = 66.4 bits (161), Expect = 8e-14
 Identities = 28/193 (14%), Positives = 42/193 (21%), Gaps = 13/193 (6%)

Query: 46  STLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRY 105
           +T   ++ +L        RI     A    +  +     S+    A      D      Y
Sbjct: 1   NTRNFSLPQLQNLPIEEARIVADALAVHATSRQIDSAA-SKLAALAEAGLKGDRQAYAAY 59

Query: 106 GHMGLTRRPRKSDRDA-VAEALERTGLTDLAHRQIGALSGG---------QRKRAFIARG 155
             +            A     L R             LS             +       
Sbjct: 60  QQLLYVLSLSDDVATAQTRRWLARAIYRVEERFPAADLSRALSEEDFQKRLEQEIAAQSR 119

Query: 156 IAQGATV-FLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILL 214
               +   F      A +         R  R  RD    LLV+  D+     L       
Sbjct: 120 ERHPSQYVFSGSASRAQLQVFLRHQWFRTFRLYRDAA-DLLVNLTDVDEAAALARYLYGE 178

Query: 215 HRRVLAHGSPDRV 227
                  GS  R+
Sbjct: 179 LGEEDEKGSHPRL 191


>3dfpC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 352

 Score = 66.4 bits (161), Expect = 9e-14
 Identities = 11/81 (13%), Positives = 20/81 (24%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR 216
           + T D      +    +    
Sbjct: 62  LLTADDRVNPCIGGVILFHET 82


>2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
          Length = 220

 Score = 66.3 bits (160), Expect = 9e-14
 Identities = 28/211 (13%), Positives = 50/211 (23%), Gaps = 11/211 (5%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL-PPAQ 72
           +  G       +      GV+  + G   SGK+TL      L   +  +V   G   P +
Sbjct: 2   LSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPER 61

Query: 73  ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT 132
             +      +   E +         D     R                 V          
Sbjct: 62  LVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAE 121

Query: 133 DLAHRQIGALSGG---------QRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
           +     I  LS           +     I        +   + +P A          +  
Sbjct: 122 ENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILR 181

Query: 184 LREMRDEG-ATLLVSTHDLAGVGELCDEAIL 213
           L ++   G    ++  H     G +    I 
Sbjct: 182 LDKLPKPGLRVAVLERHRFRPEGLMAYFRIT 212


>3ecpA [x.x.x] TN5 TRANSPOSASE
          Length = 458

 Score = 66.3 bits (160), Expect = 9e-14
 Identities = 13/194 (6%), Positives = 35/194 (18%), Gaps = 34/194 (17%)

Query: 53  AELVTPQSGHVRIHG-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGH 107
           + L         +        P   AR                           + +Y  
Sbjct: 2   SALHRAADWAKSVFSSAALGDPRRTARLV--------------------NVAAQLAKYSG 41

Query: 108 MGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDE 167
             +     +  + A   A       +           G  +   +A+   +     L  E
Sbjct: 42  KSI-TISSEGSKAAQEGAYRFIRNPN--VSAEAIRKAGAMQTVKLAQEFPE----LLAIE 94

Query: 168 PFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDR 226
                     +    + +    +  +     H +  +       + L             
Sbjct: 95  DTTS-LSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPA 153

Query: 227 VLVPELMLRAFGLE 240
               +   +     
Sbjct: 154 DADEKESGKWLAAA 167


>1e59A [c.60.1] PHOSPHOGLYCERATE MUTASE
          Length = 239

 Score = 66.0 bits (159), Expect = 1e-13
 Identities = 20/226 (8%), Positives = 49/226 (21%), Gaps = 13/226 (5%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LPPAQARKNGLLGYVP 83
           +  G          +G   +  +   +   ++    +            +     +  + 
Sbjct: 7   VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLW 66

Query: 84  QSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALS 143
                     + V     +    +  L    +    +   +   +      A        
Sbjct: 67  NVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTK 126

Query: 144 GGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAG 203
             +R      R          L E  A             +      G  ++++ H  + 
Sbjct: 127 DDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSL 186

Query: 204 VGELCDEAILLHR-RVLAHGSPDRVL-VPELM-----LRAFGLEEP 242
              L      +    +L    P  V  V E       L+ + L   
Sbjct: 187 R-ALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNA 231


>3dftC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 352

 Score = 65.9 bits (160), Expect = 1e-13
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>3dfpD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 362

 Score = 65.9 bits (160), Expect = 1e-13
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>3dfnD [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 361

 Score = 65.6 bits (159), Expect = 1e-13
 Identities = 11/81 (13%), Positives = 20/81 (24%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR 216
           + T D      +    +    
Sbjct: 62  LLTADDRVNPCIGGVILFHET 82


>2c4rL [x.x.x] RIBONUCLEASE E
          Length = 491

 Score = 65.5 bits (158), Expect = 2e-13
 Identities = 14/215 (6%), Positives = 40/215 (18%), Gaps = 12/215 (5%)

Query: 22  LDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKN--GLL 79
             +  +E+   +    L                    Q           A  +       
Sbjct: 136 GISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAESRPA 195

Query: 80  GYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQI 139
            ++    Q          D +       + +              AL R   +       
Sbjct: 196 PFLIH--QESNVIVRAFRDYLRQDIG-EILIDNPKVLELARQHIAALGRPDFSSKIKLYT 252

Query: 140 GALSGGQRKRAFIARGIAQG------ATVFLLDEPFAGVDKPSERTIVRVLREM-RDEGA 192
           G +      +       A        +   ++ +    +      +    + E   +   
Sbjct: 253 GEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNL 312

Query: 193 TLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
                      + +L    ++    +        V
Sbjct: 313 EAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAV 347


>2ahvA [x.x.x] PUTATIVE ENZYME YDIF
          Length = 512

 Score = 65.2 bits (157), Expect = 2e-13
 Identities = 21/248 (8%), Positives = 58/248 (23%), Gaps = 18/248 (7%)

Query: 9   VREVTVRYGD-VLALDNVTVEIGRG---VVCGLLGANGSGKSTLLKTIAE---------- 54
           V+   +     VL+       I       V G  G      + +     +          
Sbjct: 1   VKPPRINGRVPVLSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKYKQTQTPRNL 60

Query: 55  -LVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRR 113
            +++P     R        A++  +   +                  ++      G+  +
Sbjct: 61  SIISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQ 120

Query: 114 PRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVD 173
             ++        +   G+      +       +  +  + + +      +L  +  A   
Sbjct: 121 TLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDI 180

Query: 174 KPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAIL---LHRRVLAHGSPDRVLVP 230
                T          E   + +    +A         ++         A   P  V +P
Sbjct: 181 AFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMVKKATLHPKSVRIP 240

Query: 231 ELMLRAFG 238
             ++    
Sbjct: 241 GYLVDIVV 248


>2aumA [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 65.2 bits (158), Expect = 2e-13
 Identities = 16/145 (11%), Positives = 30/145 (20%), Gaps = 18/145 (12%)

Query: 92  FPVR-VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT----DLAHRQIGALSGGQ 146
            P+   + ++                   +A    LE  G+          +   L+G  
Sbjct: 8   QPIDGRVALIAPASA--------IATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTV 59

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGE 206
            +R            +  +     G         +   R        L+           
Sbjct: 60  EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISV---- 115

Query: 207 LCDEAILLHRRVLAHGSPDRVLVPE 231
               A   H     HG     L  +
Sbjct: 116 -LLSAFHRHGLPAIHGPVATGLGLQ 139


>1e9sI [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 64.7 bits (156), Expect = 3e-13
 Identities = 22/212 (10%), Positives = 51/212 (24%), Gaps = 29/212 (13%)

Query: 8   EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27  KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                   K G    +  +            + +                          
Sbjct: 87  DPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR------------------ 128

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
                           +    + A   R + +     L       + +    T +    +
Sbjct: 129 ------YALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDD 182

Query: 187 MRDEGATLLVSTHDLAGVGELCDEAILLHRRV 218
           +R      L  T   +      + +  L    
Sbjct: 183 LRGF----LEGTLAESLFAGSNEASKALTSAR 210


>3d3qA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 294

 Score = 64.3 bits (155), Expect = 4e-13
 Identities = 22/235 (9%), Positives = 52/235 (22%), Gaps = 24/235 (10%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSG---HVRIHGLPPAQARKNGLLGYVPQSEQ 87
           +  +  ++G   SGK+ L   +A+    +          G            G     + 
Sbjct: 1   KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDI 60

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA-----VAEALERTGLTDLAHRQIGAL 142
           +         +           +TRR +           +   L          ++   L
Sbjct: 61  LPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKKQVKL 120

Query: 143 SGGQ----------RKRAFIARGIAQGATVFLLDEPFAGVD-----KPSERTIVRVLREM 187
              +             A   +  A+             ++     K    +  +V +  
Sbjct: 121 KLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFT 180

Query: 188 RDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLEE 241
            +    L+           +     +L                     +A G +E
Sbjct: 181 ENYDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAIGYKE 235


>2a1fF [x.x.x] URIDYLATE KINASE
          Length = 234

 Score = 63.9 bits (154), Expect = 5e-13
 Identities = 14/98 (14%), Positives = 27/98 (27%), Gaps = 6/98 (6%)

Query: 143 SGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLA 202
           S    KR  +       +   L  E   G+D      +   ++E+ + G  + V      
Sbjct: 1   SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 203 GVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGL 239
                      ++R      G    V+    M  +   
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFR 93


>3dauA [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 63.7 bits (154), Expect = 6e-13
 Identities = 12/122 (9%), Positives = 30/122 (24%), Gaps = 2/122 (1%)

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            +A+   L         +     +  G+     I R +     + L  +P         +
Sbjct: 17  ENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVK 76

Query: 179 TIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRA 236
           ++   +    D     ++              +  L H    +   +      P+     
Sbjct: 77  SVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESV 136

Query: 237 FG 238
           F 
Sbjct: 137 FS 138


>3cueF [x.x.x] GTP-BINDING PROTEIN YPT1
          Length = 166

 Score = 63.6 bits (153), Expect = 6e-13
 Identities = 16/166 (9%), Positives = 36/166 (21%)

Query: 28  EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQ 87
           E        L+G +G GKS LL   ++      G            +   L  +    ++
Sbjct: 1   EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 60

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
                              +    +      +  + E       T L            +
Sbjct: 61  RFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDK 120

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGAT 193
           +               +     + +D  +       +     E  +
Sbjct: 121 RVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS 166


>1e9rG [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 417

 Score = 63.6 bits (153), Expect = 6e-13
 Identities = 19/150 (12%), Positives = 42/150 (28%), Gaps = 3/150 (2%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEI-GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + 
Sbjct: 21  GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMV 80

Query: 65  IHG--LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
           I                  +   +Q    +              +        K+D    
Sbjct: 81  IVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEE 140

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFI 152
             +  R  L + A +     +   R+    
Sbjct: 141 WASYGRLLLRETAKKLALIGTPSMRELFHW 170


>3cr7B [x.x.x] ADENYLYL-SULFATE KINASE
          Length = 181

 Score = 63.6 bits (153), Expect = 6e-13
 Identities = 22/176 (12%), Positives = 40/176 (22%), Gaps = 7/176 (3%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLL-GYVPQSEQVD 89
           RG+   L G + SGKSTL   +   +                        G+       +
Sbjct: 1   RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNEN 60

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG-----ALSG 144
                 V  +        +     P + DRD   +  E           +      A   
Sbjct: 61  IRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVPVEVAEQR 120

Query: 145 GQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM-RDEGATLLVSTH 199
             +     AR         +     A  +         +  +    +    L +  
Sbjct: 121 DPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKG 176


>1d6jA [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
          Length = 177

 Score = 63.5 bits (153), Expect = 6e-13
 Identities = 18/182 (9%), Positives = 39/182 (21%), Gaps = 18/182 (9%)

Query: 16  YGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARK 75
              +   +   +   RG+   L G + SGKSTL   +   +                   
Sbjct: 2   ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG 61

Query: 76  NGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLA 135
                        +        D     R            +     +         D A
Sbjct: 62  L------------NKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTA 109

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAG-----VDKPSERTIV-RVLREMRD 189
            +     + G+                   + P          +   +  V +++  +  
Sbjct: 110 RQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDT 169

Query: 190 EG 191
           +G
Sbjct: 170 KG 171


>2aunB [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 63.3 bits (153), Expect = 7e-13
 Identities = 14/123 (11%), Positives = 28/123 (22%), Gaps = 10/123 (8%)

Query: 114 PRKSDRDAVAEALERTGL----TDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPF 169
                 +A    LE  G+          +   L+G   +R            +  +    
Sbjct: 21  IATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLR 80

Query: 170 AGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGS-PDRVL 228
            G         +   R        L+  +        +   A   H     HG     + 
Sbjct: 81  GGYGCGQLLPGLDWGRLEAASPRPLIGFSDI-----SVLLSAFHRHGLPAIHGPVATGLG 135

Query: 229 VPE 231
           + +
Sbjct: 136 LEQ 138


>3cioD [x.x.x] TYROSINE-PROTEIN KINASE ETK
          Length = 255

 Score = 63.2 bits (152), Expect = 8e-13
 Identities = 18/183 (9%), Positives = 48/183 (26%), Gaps = 4/183 (2%)

Query: 23  DNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYV 82
               +E    ++        SGK+ +  T+A ++      V        +   + L    
Sbjct: 63  HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVS 122

Query: 83  PQSEQVD----WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ 138
            +    +         +VI     G +  +   + P       + + + +       H  
Sbjct: 123 NEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYD 182

Query: 139 IGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVST 198
           +  +          A  + +     LL   F           ++ L +        +++ 
Sbjct: 183 LVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNG 242

Query: 199 HDL 201
              
Sbjct: 243 VIK 245


>3dm9B [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 301

 Score = 63.0 bits (152), Expect = 9e-13
 Identities = 32/214 (14%), Positives = 56/214 (26%), Gaps = 23/214 (10%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           A++     +            +          +G NGSGK+T +  +A  +      V I
Sbjct: 82  AVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVI 141

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEA 125
                 +       G + Q E+      V+VI                P     DA+  A
Sbjct: 142 AASDTFR------AGAIEQLEEHAKRIGVKVI---------KHSYGADPAAVAYDAIQHA 186

Query: 126 LERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR 185
             R          +  +    R          + A V   +      D  +   IV   R
Sbjct: 187 KAR-------GIDVVLIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQAR 239

Query: 186 EMRDE-GATLLVSTHDLAGVGELCDEAILLHRRV 218
           +  +      ++ T   A        +I      
Sbjct: 240 QFNEAVKIDGIILTKLDADARGGAALSISYVIDA 273


>1accA [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
          Length = 665

 Score = 62.8 bits (151), Expect = 1e-12
 Identities = 18/222 (8%), Positives = 54/222 (24%), Gaps = 38/222 (17%)

Query: 14  VRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAEL---VTPQSGHVRIHGLPP 70
           ++      + N             +  + +     LK   ++       +G+++  G   
Sbjct: 418 IQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFGFNEPNGNLQYQGKDI 477

Query: 71  AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTG 130
                           + D+ F  +    +               + +   +   L++  
Sbjct: 478 ---------------TEFDFNFDQQTSQNIKNQL----------AELNATNIYTVLDKIK 512

Query: 131 LTDLAHRQI---GALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
           L    +  I                   + + A   +++    G+    ++ I ++L   
Sbjct: 513 LNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGY 572

Query: 188 RDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
             E                + D   +L+   +   G      
Sbjct: 573 IVEIEDTEGLKEV------INDRYDMLNISSLRQDGKTFIDF 608


>4atjA [a.93.1] PROTEIN (PEROXIDASE C1A)
          Length = 308

 Score = 62.8 bits (151), Expect = 1e-12
 Identities = 20/137 (14%), Positives = 35/137 (25%), Gaps = 6/137 (4%)

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
                   R     +  R + +   A    +    L  +A +Q   L+GG   R  + R 
Sbjct: 68  AFGNANSAR--GFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRR 125

Query: 156 IA----QGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEA 211
            +           L  PF  + +  +      L    D  A     T        + D  
Sbjct: 126 DSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRL 185

Query: 212 ILLHRRVLAHGSPDRVL 228
                  L   + +   
Sbjct: 186 YNFSNTGLPDPTLNTTY 202


>2ausC [x.x.x] PSEUDOURIDINE SYNTHASE
          Length = 311

 Score = 62.5 bits (150), Expect = 1e-12
 Identities = 18/133 (13%), Positives = 36/133 (27%), Gaps = 1/133 (0%)

Query: 107 HMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLD 166
                 +          E   + G+ +L  +  G  S            + +      LD
Sbjct: 13  KAETNPKWGFPPDKRPIELHIQYGVINL-DKPPGPTSHEVVAWIKRILNLEKAGHGGTLD 71

Query: 167 EPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDR 226
              +GV   +     RV++ +   G   +   H    V E    A++            +
Sbjct: 72  PKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIRAVMKEFEGEIIQRTRK 131

Query: 227 VLVPELMLRAFGL 239
           V   E++      
Sbjct: 132 VYYIEILEIDGRD 144


>2d7vA [x.x.x] HYPOTHETICAL PROTEIN VCA0330
          Length = 152

 Score = 62.5 bits (151), Expect = 1e-12
 Identities = 13/90 (14%), Positives = 29/90 (32%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               +    + +  + A     VE       G+LG N  GK+++ K +       SG  +
Sbjct: 62  FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSK 121

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPV 94
                  +        ++  S + +    +
Sbjct: 122 PTLQQLEKHHLAHENCFIANSVETEVVTEI 151


>3bb1G [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 251

 Score = 62.1 bits (149), Expect = 2e-12
 Identities = 24/236 (10%), Positives = 54/236 (22%), Gaps = 9/236 (3%)

Query: 2   TTPPALEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQ 59
           T      +           +  L N+  E    +   ++G  G GKS+ + +I       
Sbjct: 6   TVRGWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVS 65

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMG--RYGHMGLTRRPRKS 117
               +  G  P    ++     +   +         + D+ +     +            
Sbjct: 66  ISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYV 125

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
           DR           L   A           +    +             DE F+      E
Sbjct: 126 DRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRS---E 182

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPEL 232
             +  V          +++  +      +   +  +L             +    L
Sbjct: 183 ALLQVVRSGASLSDIPVVLIENSGRCN-KNDSDEKVLPNGIAWIPHLVQTITEVAL 237


>2an9A [x.x.x] GUANYLATE KINASE
          Length = 205

 Score = 61.8 bits (148), Expect = 2e-12
 Identities = 25/210 (11%), Positives = 55/210 (26%), Gaps = 12/210 (5%)

Query: 30  GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVD 89
            +G +  +   +G+GKS+L++ + +        V +                    E   
Sbjct: 1   AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP------GEVHGEHYF 54

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
           +       +++    +                  E +  TG+              ++K 
Sbjct: 55  FVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKM 114

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE-----MRDEGATLLVSTHDLAGV 204
                      +   LD    G  + SE  I + + +             L+   D    
Sbjct: 115 PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA 174

Query: 205 GELCDEAILLHR-RVLAHGSPDRVLVPELM 233
                  I   R R+         L+ +L+
Sbjct: 175 LTDLKTIIRAERLRMSRQKQRHDALISKLL 204


>1adoA [c.1.10] ALDOLASE
          Length = 363

 Score = 61.8 bits (149), Expect = 2e-12
 Identities = 11/81 (13%), Positives = 21/81 (25%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L  +   G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR 216
           + T D      +    +    
Sbjct: 62  LLTADDRVNPCIGGVILFHET 82


>2bofX [x.x.x] ENDOGLUCANASE E-2
          Length = 278

 Score = 61.8 bits (149), Expect = 2e-12
 Identities = 18/178 (10%), Positives = 33/178 (18%), Gaps = 15/178 (8%)

Query: 56  VTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR 115
           V P           P   R   +   +    Q  W               G +       
Sbjct: 5   VNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHN---------PGQITGQVDAL 55

Query: 116 KSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKP 175
            S   A  +                      R          +    +++ EP       
Sbjct: 56  MSAAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMS 115

Query: 176 SERTIVR-VLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAH-----GSPDRV 227
           S    V+  + E        L +    A +      +       +A         +  
Sbjct: 116 SCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSA 173


>2c9gA [x.x.x] PENTON PROTEIN
          Length = 447

 Score = 61.7 bits (147), Expect = 2e-12
 Identities = 5/58 (8%), Positives = 14/58 (24%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
             +  R +T      L  + V   +  G     +  +    + +   +          
Sbjct: 98  RVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLE 155


>1e9rF [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 416

 Score = 61.6 bits (148), Expect = 2e-12
 Identities = 25/190 (13%), Positives = 50/190 (26%), Gaps = 18/190 (9%)

Query: 8   EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 22  KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 81

Query: 67  GLP----PAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
                      R   ++          W+F   + +     RY    + R       +  
Sbjct: 82  DPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWA 141

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
           +          L          G      +           L            E T+  
Sbjct: 142 SYGRLL-----LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFL--------EGTLAE 188

Query: 183 VLREMRDEGA 192
            L    +E +
Sbjct: 189 SLFAGSNEAS 198


>2czvB [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
          Length = 206

 Score = 61.6 bits (148), Expect = 2e-12
 Identities = 18/198 (9%), Positives = 45/198 (22%), Gaps = 13/198 (6%)

Query: 12  VTVRYGDVLALDNVTVEIGRGV-VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP 70
           V     D+   +   +       V   +  N       L+   +     +  +       
Sbjct: 2   VKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL 61

Query: 71  AQARKNGLLGYVPQSEQVD-WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERT 129
            +        Y+   E  D       +   V       +   R+    D       +++ 
Sbjct: 62  VRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVN--RKDPGIDHVLAKLMVKKN 119

Query: 130 GLTDLAHRQIGALSGGQRKRAF------IARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                + R +   +  +R                     FL        D    R ++ +
Sbjct: 120 VALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISL 179

Query: 184 LREMRDEGATLLVSTHDL 201
              +   G  +  +   +
Sbjct: 180 GVVI---GMEIPQAKASI 194


>1ak2A [x.x.x] ADENYLATE KINASE ISOENZYME-2
          Length = 220

 Score = 61.4 bits (147), Expect = 3e-12
 Identities = 22/206 (10%), Positives = 42/206 (20%), Gaps = 9/206 (4%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           +GV   LLG  G+GK T    +A+                  +            +    
Sbjct: 2   KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKL 61

Query: 91  AF-PVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
               + +  +                   R      +    +     +    +       
Sbjct: 62  VSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDS 121

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM--RDEGATLLVSTHDLAGVGEL 207
             I R   +              + P E     +  E   R            L      
Sbjct: 122 LLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQ 181

Query: 208 CDEAILLH------RRVLAHGSPDRV 227
               +  +        + A  +PD V
Sbjct: 182 TTPLVEYYSKRGIHSAIDASQTPDVV 207


>3cbnA [x.x.x] CONSERVED PROTEIN MTH639
          Length = 142

 Score = 61.4 bits (148), Expect = 3e-12
 Identities = 17/147 (11%), Positives = 33/147 (22%), Gaps = 20/147 (13%)

Query: 60  SGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR 119
              +R  G P   A        V      D           ++G      ++  P +   
Sbjct: 5   RYTLRARGHPNVTAGHRTT-FEVTV----DPEIGET--ADCIIGVSSSDSISTLPDEKRA 57

Query: 120 DAVAEALER-----TGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDK 174
            A    +        G  ++       L+          +     +   +  +  A    
Sbjct: 58  IARESLVRVILRTENGYDEIRGYGHPELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLD 117

Query: 175 PSERTIVRVLREMRDEGATLLVSTHDL 201
                +VR LR         L     +
Sbjct: 118 ---ENLVRDLR-----KGRELKVEIIV 136


>1e9sL [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 426

 Score = 61.3 bits (147), Expect = 3e-12
 Identities = 20/163 (12%), Positives = 46/163 (28%), Gaps = 8/163 (4%)

Query: 8   EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27  KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67  G-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
                 L      K+ +    P  ++         I      +   + +  R +  + + 
Sbjct: 87  DPNGDMLSKFGRDKDII--LNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEE 144

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFL 164
            A               +      +    +           FL
Sbjct: 145 WASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFL 187


>2d7vB [x.x.x] HYPOTHETICAL PROTEIN VCA0330
          Length = 151

 Score = 61.3 bits (148), Expect = 3e-12
 Identities = 13/90 (14%), Positives = 29/90 (32%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               +    + +  + A     VE       G+LG N  GK+++ K +       SG  +
Sbjct: 61  FVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSK 120

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPV 94
                  +        ++  S + +    +
Sbjct: 121 PTLQQLEKHHLAHENCFIANSVETEVVTEI 150


>1e9sM [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 425

 Score = 61.3 bits (147), Expect = 3e-12
 Identities = 21/198 (10%), Positives = 48/198 (24%), Gaps = 8/198 (4%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
              +++ +T      + +  V +          + GA G+GKS LL+ +A     +   +
Sbjct: 24  SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRM 83

Query: 64  RIHGLPPAQ-ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
            I        ++       +      D           +   Y      +R   S     
Sbjct: 84  VIVDPNGDMLSKFGRDKDIILN--PYDQRTKGWSFFNEIRNDYDW----QRYALSVVPRG 137

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                    +                     R +    T+   D+    ++     ++  
Sbjct: 138 KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFA 197

Query: 183 VLREMRDEGATLLVSTHD 200
              E      +      D
Sbjct: 198 GSNEASKALTSARFVLSD 215


>3bwdD [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
          Length = 156

 Score = 61.0 bits (146), Expect = 4e-12
 Identities = 18/158 (11%), Positives = 40/158 (25%), Gaps = 4/158 (2%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           R + C  +G    GK+ LL +      P S +V +     A    N     +        
Sbjct: 1   RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYN----RLRPLSYRGA 56

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
              +    ++    Y ++     P           +      DL   +   +        
Sbjct: 57  DVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITT 116

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMR 188
                + +        E  +   +  +      +R + 
Sbjct: 117 VQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVL 154


>1afrA [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
          Length = 345

 Score = 61.0 bits (146), Expect = 4e-12
 Identities = 24/252 (9%), Positives = 49/252 (19%), Gaps = 51/252 (20%)

Query: 18  DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG---------- 67
                  VT  +    +      +   +  +L  +  +         +            
Sbjct: 3   PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQV 62

Query: 68  ---------------------------------LPPAQARKNGLLGYVPQSEQVDWAFPV 94
                                            +           G  P S  +      
Sbjct: 63  RELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTRAWT 122

Query: 95  RVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIAR 154
              +        ++ L+ R      +   + L  +G  D        L          A 
Sbjct: 123 AEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSG-MDPRTENSPYLGFIYTSFQERAT 181

Query: 155 GIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILL 214
            I+ G T     E           TI        DE       T  +  + E+  +  +L
Sbjct: 182 FISHGNTARQAKEHGDIKLAQICGTI------AADEKRHETAYTKIVEKLFEIDPDGTVL 235

Query: 215 HR-RVLAHGSPD 225
               ++      
Sbjct: 236 AFADMMRKKISM 247


>3c15C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 334

 Score = 60.9 bits (146), Expect = 4e-12
 Identities = 12/80 (15%), Positives = 21/80 (26%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
                   LLGA  SGKST++K +  L        ++  +          +     +   
Sbjct: 2   YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVP 61

Query: 89  DWAFPVRVIDVVMMGRYGHM 108
                       +      M
Sbjct: 62  PVELANPENQFRVDYILSVM 81


>2dpyB [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
          Length = 426

 Score = 60.9 bits (147), Expect = 4e-12
 Identities = 36/191 (18%), Positives = 54/191 (28%), Gaps = 10/191 (5%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             L+   +       +   N  + +GRG   GL   +G GKS LL  +A         V 
Sbjct: 118 NPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVG 177

Query: 65  IHGLPP---AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
           + G          +N L         V  A     +  ++  +             DR  
Sbjct: 178 LIGERGREVKDFIENILGPDGRARSVVIAAPA--DVSPLLRMQGAAYATRIAEDFRDRGQ 235

Query: 122 VAEALERTGLTDL--AHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERT 179
               L    LT    A R+I    G           +       L++    G+      T
Sbjct: 236 HV-LLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPA-LVERAGNGIHGGGSIT 293

Query: 180 IV-RVLREMRD 189
               VL E  D
Sbjct: 294 AFYTVLTEGDD 304


>1cs4C [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 329

 Score = 60.7 bits (146), Expect = 4e-12
 Identities = 12/82 (14%), Positives = 22/82 (26%), Gaps = 9/82 (10%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LPPAQARKNGLLGYVPQSE 86
                LLGA  SGKST++K +  L   +                           +    
Sbjct: 2   THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAM--SNLVPPV 59

Query: 87  QVDWAFPVRVIDVVMMGRYGHM 108
           ++          V  +    ++
Sbjct: 60  ELANPENQF--RVDYILSVMNV 79


>3bv4A [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 341

 Score = 60.7 bits (146), Expect = 4e-12
 Identities = 10/75 (13%), Positives = 20/75 (26%)

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL 201
               +++ + IA  I       L  +   G      ++I     E        L+ T D 
Sbjct: 5   TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADD 64

Query: 202 AGVGELCDEAILLHR 216
                +    +    
Sbjct: 65  RVNPCIGGVILFHET 79


>2c7cH [x.x.x] 60 KDA CHAPERONIN
          Length = 522

 Score = 60.6 bits (146), Expect = 5e-12
 Identities = 11/130 (8%), Positives = 28/130 (21%), Gaps = 2/130 (1%)

Query: 100 VMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQG 159
           V       M    +      +      +   + +      G LS     +        + 
Sbjct: 156 VGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELES 215

Query: 160 ATVFLLDEPFAGVD-KPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-R 217
             + L D+  + +         V    +     A  +        V       + +   +
Sbjct: 216 PFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVK 275

Query: 218 VLAHGSPDRV 227
               G   + 
Sbjct: 276 APGFGDRRKA 285


>1e9sH [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 424

 Score = 60.5 bits (145), Expect = 5e-12
 Identities = 15/110 (13%), Positives = 35/110 (31%), Gaps = 2/110 (1%)

Query: 8   EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27  KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67  GLPPAQ-ARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPR 115
                  ++       +               ++     +    L+  PR
Sbjct: 87  DPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR 136


>1bglA [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
          Length = 1021

 Score = 60.4 bits (144), Expect = 5e-12
 Identities = 8/82 (9%), Positives = 19/82 (23%), Gaps = 1/82 (1%)

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHD 200
           +S   R          + A  +  +         +    V +      +     L  +  
Sbjct: 793 VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRK 852

Query: 201 LAGVGELCDEAILLHRRVLAHG 222
              +      AI +   V +  
Sbjct: 853 TYRIDGSGQMAITVDVEVASDT 874


>3a00A [x.x.x] GUANYLATE KINASE
          Length = 153

 Score = 60.3 bits (144), Expect = 6e-12
 Identities = 19/164 (11%), Positives = 42/164 (25%), Gaps = 16/164 (9%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVR 95
            + G +G+GKSTLLK +        G                     P++ +V+      
Sbjct: 5   VISGPSGTGKSTLLKKLFAEYPDSFGFSVSST------------TRTPRAGEVNGKDYNF 52

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
           V          +       + S             +  ++      +     +     + 
Sbjct: 53  VSVDEFKSMIKNNEFIEWAQFSGNY---YGSTVASVKQVSKSGKTCILDIDMQGVKSVKA 109

Query: 156 IAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTH 199
           I +    FL   P +      +  +   L +   +     +   
Sbjct: 110 IPELNARFLFIAPPSVTGAHDKVIVNDDLDKAY-KELKDFIFAE 152


>3cnlA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 233

 Score = 59.7 bits (143), Expect = 8e-12
 Identities = 17/165 (10%), Positives = 38/165 (23%), Gaps = 19/165 (11%)

Query: 15  RYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQAR 74
             G+   +    +   R     ++G   +GKST++  +            +         
Sbjct: 74  HKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLE-------- 125

Query: 75  KNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLT------RRPRKSDRDAVAEALER 128
               +   P     +         ++++G      +       R      R    E+   
Sbjct: 126 NGVKILDTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFS 185

Query: 129 TGLTDLAHRQIGALSGGQRKRAFIARGIAQGA-----TVFLLDEP 168
               D A ++     GG                         + P
Sbjct: 186 EFFEDFARKRGLLKKGGVPDIERALMLFFTEVAQGKAGRVSFERP 230


>3dfqC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 353

 Score = 59.5 bits (143), Expect = 1e-11
 Identities = 13/91 (14%), Positives = 23/91 (25%), Gaps = 2/91 (2%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR--RVLAHGSP 224
           + T D      +    +      +    G P
Sbjct: 62  LLTADDRVNPCIGGVILFHETLYQKADDGRP 92


>3cmvB [x.x.x] PROTEIN RECA
          Length = 1163

 Score = 59.0 bits (141), Expect = 1e-11
 Identities = 21/227 (9%), Positives = 51/227 (22%), Gaps = 11/227 (4%)

Query: 1   MTTPPALEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTP 58
           +         +V         L +      +  G +  + G   SGK+TL   +      
Sbjct: 295 IMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR 354

Query: 59  QSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSD 118
           +           A             + ++       +      G           R   
Sbjct: 355 EGKTCAFIDAEHAL--------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA 406

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
            D +                   +     ++       +    +F+     A     S R
Sbjct: 407 VDVIVVDSVAALTPKAEIGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVR 466

Query: 179 TIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPD 225
             +R +  +++    ++ S   +  V              + +G   
Sbjct: 467 LDIRRIGAVKEGE-NVVGSETRVKVVKNKIAAPFKQAEFQILYGEGI 512



 Score = 55.6 bits (132), Expect = 2e-10
 Identities = 23/220 (10%), Positives = 49/220 (22%), Gaps = 11/220 (5%)

Query: 7   LEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               +V         L +      +  G +  + G   SGK+TL   +      +     
Sbjct: 599 DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCA 658

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                 A          V               +  +      +        +    V +
Sbjct: 659 FIDAEHALDPIYARKLGVDIDN--LLCSQPDTGEQALE-----ICDALARSGAVDVIVVD 711

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
           ++               +S   RK A   +       +F+     A     +   +    
Sbjct: 712 SVAALTPKAEIGLAARMMSQAMRKLAGNLKQSNT-LLIFINQGGNAL-KFYASVRLDIRR 769

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSP 224
                EG  ++ S   +  V              + +G  
Sbjct: 770 IGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEG 809



 Score = 52.9 bits (125), Expect = 1e-09
 Identities = 23/240 (9%), Positives = 57/240 (23%), Gaps = 30/240 (12%)

Query: 9   VREVTVRYGDVLALDNV--TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           V  ++       +LD       +  G +  + G   SGK+TL   +      +       
Sbjct: 1   VETISTGSL---SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT-CAF 56

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                              + +  + P      + +                       +
Sbjct: 57  IDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEI---------CDALARSGAVDVIVV 107

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPF------AGVDKPSERTI 180
           +            G +S        +++ + + A                G       ++
Sbjct: 108 DSVAALTPKAEIEGEISHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASV 167

Query: 181 VRVLREMR---------DEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPE 231
              +R +               + V  + +A   +  +  IL    +  +G    + V E
Sbjct: 168 RLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKE 227


>1culC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 328

 Score = 59.0 bits (142), Expect = 1e-11
 Identities = 15/82 (18%), Positives = 25/82 (30%), Gaps = 9/82 (10%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LPPAQARKNGLLGYVPQSE 86
                LLGA  SGKST++K +  L   +                        +  +    
Sbjct: 2   THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAA--MSNLVP-- 57

Query: 87  QVDWAFPVRVIDVVMMGRYGHM 108
            V+ A P     V  +    ++
Sbjct: 58  PVELANPENQFRVDYILSVMNV 79


>1e2iB [c.37.1] THYMIDINE KINASE
          Length = 313

 Score = 59.0 bits (141), Expect = 1e-11
 Identities = 16/177 (9%), Positives = 40/177 (22%), Gaps = 21/177 (11%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +  L +          +                    
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM-----------------TYW 43

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                   I  +   ++           +     +  +       +    +    GG+  
Sbjct: 44  RVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAH 103

Query: 149 RAFIARGIAQGATVF--LLDEPFAGVDKPSER--TIVRVLREMRDEGATLLVSTHDL 201
               A  +         LL  P A     S     ++  +  +        +    L
Sbjct: 104 APPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGAL 160


>2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 289

 Score = 59.0 bits (141), Expect = 1e-11
 Identities = 23/247 (9%), Positives = 53/247 (21%), Gaps = 29/247 (11%)

Query: 1   MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQS 60
            T     + R V        ALD +             G  GSGK+ L   ++  V    
Sbjct: 65  KTALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPP 124

Query: 61  GHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
               +                          +                 L       +  
Sbjct: 125 EKGGLS---------------------GKAVYIDTEGTFRWERIENAKALGLDIDNVNNI 163

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
               A+       +       +S     +  +   +               V +      
Sbjct: 164 YYIRAINTDHQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKH 223

Query: 181 VRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL-VPELMLRAF 237
           +  L  + +     ++++   +     +  +       R +A       L   E++    
Sbjct: 224 LHQLTRLAEVYDIAVIITNQVVP---GIRIQLKKSRGNRRIARVVDAPHLPEGEVVFALT 280

Query: 238 --GLEEP 242
             G+ + 
Sbjct: 281 EEGIRDA 287


>2aumB [x.x.x] HYPOTHETICAL PROTEIN
          Length = 294

 Score = 59.0 bits (142), Expect = 1e-11
 Identities = 17/145 (11%), Positives = 30/145 (20%), Gaps = 18/145 (12%)

Query: 92  FPVR-VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLT----DLAHRQIGALSGGQ 146
            P+   + ++                   +A    LE  G+          +   L+G  
Sbjct: 6   QPIDGRVALIAPAS--------AIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTV 57

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGE 206
            +R            +  +     G         +   R        L+           
Sbjct: 58  EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISV---- 113

Query: 207 LCDEAILLHRRVLAHGSPDRVLVPE 231
               A   H     HG     L  E
Sbjct: 114 -LLSAFHRHGLPAIHGPVATGLGLE 137


>1akeA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score = 58.8 bits (140), Expect = 2e-11
 Identities = 21/208 (10%), Positives = 41/208 (19%), Gaps = 21/208 (10%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVR 95
            LLGA G+GK T  + I E                 ++            +         
Sbjct: 4   ILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDEL 63

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
           VI +V                     +    +   + +        L         + R 
Sbjct: 64  VIALVKERIAQEDCRNGFLLDGFPRTIP---QADAMKEAGINVDYVLEFDVPDELIVDRI 120

Query: 156 IAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGA-----------------TLLVST 198
           + +              + P       V  E                       T  +  
Sbjct: 121 VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIG 180

Query: 199 HDLAGVGELCDEAILLHR-RVLAHGSPD 225
           +          +   +   + +A    D
Sbjct: 181 YYSKEAEAGNTKYAKVDGTKPVAEVRAD 208


>1e2iA [c.37.1] THYMIDINE KINASE
          Length = 300

 Score = 58.6 bits (140), Expect = 2e-11
 Identities = 22/201 (10%), Positives = 46/201 (22%), Gaps = 15/201 (7%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI--HGLPPAQARKNGLLGYVPQSE 86
           +   +   + G +G GK+  +  + E +T                   +           
Sbjct: 1   MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDA 60

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
            V        + +        +            A+    +R  +  L          G 
Sbjct: 61  AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGS 120

Query: 147 RKRAFIARGIAQGATVFLLDEPF-------------AGVDKPSERTIVRVLREMRDEGAT 193
                +   +A                         A   +P ER  + +L  +R     
Sbjct: 121 MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL 180

Query: 194 LLVSTHDLAGVGELCDEAILL 214
           L  +   L   G   ++   L
Sbjct: 181 LANTVRYLQCGGSWREDWGQL 201


>3bpbA [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
          Length = 254

 Score = 58.6 bits (140), Expect = 2e-11
 Identities = 12/226 (5%), Positives = 42/226 (18%), Gaps = 24/226 (10%)

Query: 9   VREVTVRYGDVLALDNVTVEIGRG---VVCGLLGANGSGKSTLLKTIAELV---TPQSGH 62
                V       L                  L       + L                 
Sbjct: 10  PARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVFVEDPVL 69

Query: 63  VRIHG--LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRD 120
                  +    A        + +     +                         ++   
Sbjct: 70  CTSRCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTV-----------EAGDI 118

Query: 121 AVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTI 180
            +       G +   + +         ++  ++  + +   V  L    A ++  +    
Sbjct: 119 MMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAA 178

Query: 181 VRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPD 225
              + +   +   ++    +           I ++   ++  G P 
Sbjct: 179 GEFVSKPEFQDFNIIEIPEEE----SYAANCIWVNERVIMPAGYPR 220


>3dffA [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
          Length = 263

 Score = 58.5 bits (140), Expect = 2e-11
 Identities = 22/182 (12%), Positives = 40/182 (21%), Gaps = 11/182 (6%)

Query: 50  KTIAELVTPQSGHVRIHGLPPAQARKNGL-LGYVPQSEQVDWAFPVRVIDVVMMGRYGHM 108
           + +A         +   G   AQA ++G  +                      +     +
Sbjct: 2   RLLAISPHLDDAVLS-FGAGLAQAAQDGANVLVYTVFAGAAQPPYSPAAQRHTIW---GL 57

Query: 109 GLTRRPRKSDRDAVAEALERTGLTDLAHRQ-IGALSGGQRKRAFIARGIAQGATVFLLDE 167
                     R     AL+   +     R            R   A    +         
Sbjct: 58  APDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHVEGRQKLAVNDHS 117

Query: 168 PFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDR 226
           P +  D   E     +   + +   TL+V+   +    E  D            H     
Sbjct: 118 PDSDHDLVGEV-ADDIRSIIDEFDPTLVVTCAAIG---EHPDHEATRDAALFATHEKNVP 173

Query: 227 VL 228
           V 
Sbjct: 174 VR 175


>1e2kA [c.37.1] THYMIDINE KINASE
          Length = 308

 Score = 58.2 bits (139), Expect = 2e-11
 Identities = 13/173 (7%), Positives = 31/173 (17%), Gaps = 20/173 (11%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +             +                      
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYW--------------------R 40

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                  + ++         G       +     A+                 + G    
Sbjct: 41  VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGP 100

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL 201
              +     +     LL  P A     S      +             +    
Sbjct: 101 PPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLG 153


>3dfoC [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
          Length = 351

 Score = 58.0 bits (139), Expect = 3e-11
 Identities = 11/81 (13%), Positives = 20/81 (24%)

Query: 136 HRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLL 195
           H         +++ + IA  I       L      G      ++I     E        L
Sbjct: 2   HSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQL 61

Query: 196 VSTHDLAGVGELCDEAILLHR 216
           + T D      +    +    
Sbjct: 62  LLTADDRVNPCIGGVILFHET 82


>3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
          Length = 483

 Score = 57.9 bits (139), Expect = 3e-11
 Identities = 25/203 (12%), Positives = 55/203 (27%), Gaps = 24/203 (11%)

Query: 8   EVREVTVRYGDVLALDNVT-VEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           E + +      +   D+++   +  G    + G +G+GK+            +     + 
Sbjct: 1   EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVF 60

Query: 67  GLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
                          V   E               + +    G       S      E +
Sbjct: 61  ---------------VTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVV 105

Query: 127 ERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE 186
               L+ L  R   A+   + +R  I                         R + R++  
Sbjct: 106 GGFDLSALIERINYAIQKYRARRVSIDS--------VTSVFQQYDASSVVRRELFRLVAR 157

Query: 187 MRDEGATLLVSTHDLAGVGELCD 209
           ++  GAT +++T  +   G +  
Sbjct: 158 LKQIGATTVMTTERIEEYGPIAR 180


>2anbA [x.x.x] GUANYLATE KINASE
          Length = 206

 Score = 57.5 bits (137), Expect = 4e-11
 Identities = 25/210 (11%), Positives = 54/210 (25%), Gaps = 12/210 (5%)

Query: 30  GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVD 89
            +G +  +   +G+GKS+L++ + +        V +                    E   
Sbjct: 1   AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP------GEVHGEHYF 54

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
           +       +++    +                  E +  TG+              ++K 
Sbjct: 55  FVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKM 114

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR-----EMRDEGATLLVSTHDLAGV 204
                      +   LD    G  + SE  I + +               L+   D    
Sbjct: 115 PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA 174

Query: 205 GELCDEAILLHR-RVLAHGSPDRVLVPELM 233
                  I   R R+         L+ +L+
Sbjct: 175 LTDLKTIIRAERLRMSRQKQRHDALISKLL 204


>3be4A [x.x.x] ADENYLATE KINASE
          Length = 215

 Score = 57.0 bits (136), Expect = 6e-11
 Identities = 20/213 (9%), Positives = 42/213 (19%), Gaps = 19/213 (8%)

Query: 27  VEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQ-S 85
                 ++  L+GA GSGK T  + I +                 +         + +  
Sbjct: 2   NSKKHNLI--LIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGLEAKSIIESG 59

Query: 86  EQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALS-- 143
             V     + ++           G                 +       +   +      
Sbjct: 60  NFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEID 119

Query: 144 --------GGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATL 194
                    G+       R                   +P           ++       
Sbjct: 120 DSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFH 179

Query: 195 LVSTHDLAGVGELCDEAILLHRRVLAHGSPDRV 227
             +   +    +L        +RV A   P  V
Sbjct: 180 KQTAPLVKFYEDLGI-----LKRVNAKLPPKEV 207


>1dw9A [a.35.1 - d.72.1] CYANATE LYASE
          Length = 152

 Score = 56.8 bits (136), Expect = 6e-11
 Identities = 10/148 (6%), Positives = 37/148 (25%), Gaps = 11/148 (7%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLL-GANGSGKSTLLKTIAELVTPQSGHV 63
            +   R + +   D +    +  +  + +    +    G  ++ +   +       +   
Sbjct: 2   QSQINRNIRLDLADAI----LLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAA 57

Query: 64  RIHGL----PPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMG--LTRRPRKS 117
           R+ G              +       +++      R  ++ + G                
Sbjct: 58  RLVGAKLDLDEDSILLLQIPLRGCIDDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGII 117

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGG 145
                   +++    +   R +  L G 
Sbjct: 118 SAINFKLDVKKVADPEGGERAVITLDGK 145


>1dekA [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
          Length = 240

 Score = 56.7 bits (135), Expect = 7e-11
 Identities = 12/143 (8%), Positives = 20/143 (13%), Gaps = 7/143 (4%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
           +  L G   SGK T    I    +     +                              
Sbjct: 3   LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPLTRKEFEG 62

Query: 94  VRVIDVVMMGR-------YGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
           +       +                    KS    V    +    +              
Sbjct: 63  IDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVIN 122

Query: 147 RKRAFIARGIAQGATVFLLDEPF 169
                 +      A    L    
Sbjct: 123 NIEDQWSVRRLMQALGTDLIVNN 145


>3ec1A [x.x.x] YQEH GTPASE
          Length = 311

 Score = 56.4 bits (134), Expect = 8e-11
 Identities = 14/185 (7%), Positives = 39/185 (21%), Gaps = 5/185 (2%)

Query: 58  PQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKS 117
            +   +     P        +      +                +           P++ 
Sbjct: 130 GKGNVITTSYFPGTTLDMIEIPLESGATLYDTPGIINHHQMAHFVDARDLKI--ITPKRE 187

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
               V +  E   L      ++  + GG+R                L ++  +       
Sbjct: 188 IHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCYMANELTVHRTKL-EKADSLYANQLG 246

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAF 237
             +    +    E     +    L+      D        V  +    +++V        
Sbjct: 247 ELLSPPSKRYAAE--FPPLVPRSLSVKERKTDIVFSGLGWVTCNDPGAQLVVHAPKGVDV 304

Query: 238 GLEEP 242
            + + 
Sbjct: 305 FIRQS 309


>1dekB [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
          Length = 230

 Score = 56.4 bits (134), Expect = 9e-11
 Identities = 22/178 (12%), Positives = 42/178 (23%), Gaps = 24/178 (13%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
           +  L G   SGK T    I    +     +               L Y       +  +P
Sbjct: 3   LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDA--------LAYAWGVFAANTDYP 54

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
           +   +                           L +  +  +  +    L+G    +    
Sbjct: 55  LTRKE--------------FEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFV 100

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDE 210
               +G             D  +       +R  M+  G  L+V+  D     +L   
Sbjct: 101 F-DDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFAL 157


>1c9kC [c.37.1] ADENOSYLCOBINAMIDE KINASE
          Length = 165

 Score = 56.3 bits (134), Expect = 9e-11
 Identities = 18/188 (9%), Positives = 36/188 (19%), Gaps = 26/188 (13%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
           +  + G   SGKS   + +               L     R      +            
Sbjct: 1   MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGRPA---HWRTARHLDTLITA 57

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
               D  ++       +T                                    +   + 
Sbjct: 58  DLAPDDAILLECITTMVTNLLFALGDPE-------------QWDYAAMERAIDDEIQILI 104

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAIL 213
               +     +L     G+    E  + R  R++       L             DE  L
Sbjct: 105 AACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLA---------AAADEVWL 155

Query: 214 L-HRRVLA 220
           +     + 
Sbjct: 156 VVSGIGVK 163


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 41/225 (18%), Positives = 79/225 (35%), Gaps = 18/225 (8%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
                 E+  +      L ++  +I RG +  + G+ G+GK++LL  I   + P  G ++
Sbjct: 12  WEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK 71

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
                              +         +    +            R         + E
Sbjct: 72  HS----------------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEE 115

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
            + +    D        LSGGQR R  +AR + + A ++LLD PF  +D  +E+ I    
Sbjct: 116 DISKFAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESC 175

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                   T ++ T  +    +  D+ ++LH      +G+   + 
Sbjct: 176 VCKLMANKTRILVTSKME-HLKKADKILILHEGSSYFYGTFSELQ 219


>2ancF [x.x.x] GUANYLATE KINASE
          Length = 153

 Score = 56.0 bits (133), Expect = 1e-10
 Identities = 11/152 (7%), Positives = 31/152 (20%), Gaps = 8/152 (5%)

Query: 30  GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI-------HGLPPAQARKNGLLGYV 82
            +G +  +   +G+GKS+L++ + +          I         +      +       
Sbjct: 1   AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQ 60

Query: 83  PQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGAL 142
                            +     G    +              +      D         
Sbjct: 61  KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFD 120

Query: 143 SGGQRKRA-FIARGIAQGATVFLLDEPFAGVD 173
           +     +    A  +         D   + + 
Sbjct: 121 TALTDLKTIIRAERLRMSRQKQRHDALISKLL 152


>1e9sE [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 425

 Score = 55.8 bits (133), Expect = 1e-10
 Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 8  EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 26 KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 85

Query: 67 G 67
           
Sbjct: 86 D 86


>2a1fC [x.x.x] URIDYLATE KINASE
          Length = 237

 Score = 55.6 bits (132), Expect = 1e-10
 Identities = 13/87 (14%), Positives = 25/87 (28%), Gaps = 6/87 (6%)

Query: 143 SGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLA 202
           S    KR  +       +   L  E   G+D      +   ++E+ + G  + V      
Sbjct: 1   SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 203 GVGELCDEAILLHR-RVLAHGSPDRVL 228
                      ++R      G    V+
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLATVM 82


>1cjtC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 330

 Score = 55.6 bits (133), Expect = 2e-10
 Identities = 14/61 (22%), Positives = 19/61 (31%), Gaps = 10/61 (16%)

Query: 32 GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP--------PAQARKNGLLGYVP 83
               LLGA  SGKST++K +  L   +                     A  N  L    
Sbjct: 2  THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIETIVAAMSN--LVPPV 59

Query: 84 Q 84
          +
Sbjct: 60 E 60


>2ahwD [x.x.x] PUTATIVE ENZYME YDIF
          Length = 487

 Score = 55.3 bits (131), Expect = 2e-10
 Identities = 16/207 (7%), Positives = 47/207 (22%), Gaps = 15/207 (7%)

Query: 9   VREVTVRYGD-VLALDNVTVEIGRG---VVCGLLGANGSGKSTLLKTIAE---------- 54
           V+   +     VL+       I       V G  G      + +     +          
Sbjct: 1   VKPPRINGRVPVLSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKYKQTQTPRNL 60

Query: 55  -LVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRR 113
            +++P     R        A++  +   +                  ++      G+  +
Sbjct: 61  SIISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQ 120

Query: 114 PRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVD 173
             ++        +   G+      +       +  +  + + +      +L  +  A   
Sbjct: 121 TLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDI 180

Query: 174 KPSERTIVRVLREMRDEGATLLVSTHD 200
                T          E   + +    
Sbjct: 181 AFIRATTCDSEGYATFEDEVMYLDALV 207


>2a1fD [x.x.x] URIDYLATE KINASE
          Length = 236

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 14/98 (14%), Positives = 26/98 (26%), Gaps = 6/98 (6%)

Query: 143 SGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLA 202
           S    KR  +           L  E   G+D      +   ++E+ + G  + V      
Sbjct: 1   SQPIYKRILLKLS-----GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 203 GVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGL 239
                      ++R      G    V+    M  +   
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFR 93


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 54.9 bits (130), Expect = 2e-10
 Identities = 32/245 (13%), Positives = 69/245 (28%), Gaps = 14/245 (5%)

Query: 6   ALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRI 65
           +++++ VT  +G+V+   ++ ++I  G     +G +G GKSTLL+ IA L T  SG + I
Sbjct: 2   SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 61

Query: 66  HGLPPAQARKNGLLGYVPQSEQVDW-------AFPVRVIDVVMMGRYGHMGLTRRPRKSD 118
                           + +                   I++  + +     +        
Sbjct: 62  GEKRMNDTPPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQV 121

Query: 119 RDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSER 178
                             +    L            G      +  L            +
Sbjct: 122 EAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQ 181

Query: 179 TIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAF 237
                  E+       +    +   V    + ++ +    +L     D +L  E+ +   
Sbjct: 182 ------VELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQ 235

Query: 238 GLEEP 242
              E 
Sbjct: 236 LGNET 240


>2b8tD [x.x.x] THYMIDINE KINASE
          Length = 204

 Score = 54.9 bits (130), Expect = 2e-10
 Identities = 20/207 (9%), Positives = 46/207 (22%), Gaps = 14/207 (6%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG------LPPAQARKNGLLGYVPQS 85
           G +  + G   +GK+  L      +        +        +          +      
Sbjct: 1   GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIRNIQSRTGTSLPSVEVESAP 60

Query: 86  EQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGG 145
           E +++       D   +     +           + +AE      ++ L     G   G 
Sbjct: 61  EILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGP 120

Query: 146 QRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVG 205
             K    A  I +   +       A                  D    ++          
Sbjct: 121 IAKLFTYADKITKLTAICNECGAEATHSLRKIDGK------HADYNDDIVKIGCQEF-YS 173

Query: 206 ELCDEAILLHR-RVLAHGSPDRVLVPE 231
            +C     +     L   S + +   +
Sbjct: 174 AVCRHHHKVPNRPYLNSNSEEFIKFFK 200


>1ek0A [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
          Length = 168

 Score = 54.9 bits (131), Expect = 2e-10
 Identities = 14/127 (11%), Positives = 26/127 (20%), Gaps = 6/127 (4%)

Query: 35  CGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL------LGYVPQSEQV 88
             LLG    GKS+++         ++    I      Q            +      E+ 
Sbjct: 6   LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERF 65

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
               P        +  Y         +               +          L  G  +
Sbjct: 66  ASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQEGGER 125

Query: 149 RAFIARG 155
           +     G
Sbjct: 126 KVAREEG 132


>3dlbB [x.x.x] ARGONAUTE
          Length = 614

 Score = 54.9 bits (131), Expect = 2e-10
 Identities = 18/191 (9%), Positives = 33/191 (17%), Gaps = 16/191 (8%)

Query: 27  VEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSE 86
           V +    V     A G G   L   + +L    SG   +   P  +      L       
Sbjct: 122 VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQG 181

Query: 87  QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQ 146
                      D              +                           +    Q
Sbjct: 182 HPLPKRVRNAYDRRTWELLRLGEEDPKEL------------PLPGGLSLLDYHASKGRLQ 229

Query: 147 RKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVG 205
            +       +A         +P   +           L    +E           +    
Sbjct: 230 GREGGRVAWVAD---PKDPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRRL 286

Query: 206 ELCDEAILLHR 216
            L     +  +
Sbjct: 287 GLGTPEAVRAQ 297


>1av6A [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
          Length = 289

 Score = 54.7 bits (130), Expect = 3e-10
 Identities = 12/240 (5%), Positives = 52/240 (21%), Gaps = 18/240 (7%)

Query: 8   EVREVTVRY-----------GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
           E      +            G++  L  +            +   GS   T ++ + +  
Sbjct: 23  ESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDG--ATVVYIGSAPGTHIRYLRDHF 80

Query: 57  TPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRK 116
                 ++   +                                 +     +        
Sbjct: 81  YNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKII----LISD 136

Query: 117 SDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPS 176
               + A+ L    L ++    +  ++   + R        +   +   ++         
Sbjct: 137 VRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSY 196

Query: 177 ERTIVRVLREMRDEG-ATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLR 235
              +  +     +    T +  +  +    ++     ++  +V+ +            + 
Sbjct: 197 SAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMY 256


>3d1mB [x.x.x] SONIC HEDGEHOG PROTEIN
          Length = 150

 Score = 54.2 bits (129), Expect = 4e-10
 Identities = 16/130 (12%), Positives = 35/130 (26%), Gaps = 7/130 (5%)

Query: 120 DAVAEALERTGLTDLAHRQIGALSGGQRKRAFIAR--GIAQGATVFLLDEPFAGVDKPSE 177
             +A       + +      G   G   + +   +         +   DE   G D+   
Sbjct: 2   TPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMT 61

Query: 178 RTIVRVLREM----RDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPEL 232
           +     L  +     ++   + +   +         E  L +  R +   + DR      
Sbjct: 62  QRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYG 121

Query: 233 MLRAFGLEEP 242
           ML    +E  
Sbjct: 122 MLARLAVEAG 131


>3bb1H [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 248

 Score = 54.0 bits (128), Expect = 4e-10
 Identities = 13/104 (12%), Positives = 30/104 (28%), Gaps = 2/104 (1%)

Query: 7   LEVREVTVRYGDVL--ALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +          L   L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 5   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 64

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHM 108
             G  P    ++     +   +         + D+ +      +
Sbjct: 65  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFL 108


>3a00B [x.x.x] GUANYLATE KINASE
          Length = 151

 Score = 53.6 bits (127), Expect = 6e-10
 Identities = 21/166 (12%), Positives = 41/166 (24%), Gaps = 18/166 (10%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
              + G +G+GKSTLLK +        G          +A +     Y   S     +  
Sbjct: 3   PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMI 62

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
                +      G+   +                       +      +     +     
Sbjct: 63  KNNEFIEWAQFSGNYYGSTVASVKQV---------------SKSGKTCILDIDMQGVKSV 107

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTH 199
           + I +    FL   P +G     +  +   L +   E    +    
Sbjct: 108 KAIPELNARFLFIAPPSGAH--DKVIVNDDLDKAYKELKDFIF-AE 150


>2dpyA [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
          Length = 422

 Score = 53.5 bits (128), Expect = 6e-10
 Identities = 29/149 (19%), Positives = 42/149 (28%), Gaps = 8/149 (5%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             L+   +       +   N  + +GRG   GL   +G GKS LL  +A         V 
Sbjct: 114 NPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVG 173

Query: 65  IHGLPP---AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
           + G          +N L         V  A        ++  +             DR  
Sbjct: 174 LIGERGREVKDFIENILGPDGRARSVVIAAPADV--SPLLRMQGAAYATRIAEDFRDRGQ 231

Query: 122 VAEALERTGLTDL--AHRQIGALSGGQRK 148
               L    LT    A R+I    G    
Sbjct: 232 -HVLLIMDSLTRYAMAQREIALAIGEPPA 259


>3do6A [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
          Length = 530

 Score = 53.5 bits (127), Expect = 6e-10
 Identities = 13/84 (15%), Positives = 22/84 (26%), Gaps = 6/84 (7%)

Query: 3  TPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLL---GANGSGKSTLLKTIAELVTPQ 59
              L      +   D   L ++       ++          G GK+T    ++ L    
Sbjct: 14 KDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKTTTSIGLSSLNRIG 73

Query: 60 SGHVRIHGLP---PAQARKNGLLG 80
             +     P   P    K G  G
Sbjct: 74 KKSIVTLREPSLGPTLGLKGGATG 97


>3c7kA [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
          Length = 305

 Score = 53.1 bits (125), Expect = 8e-10
 Identities = 15/80 (18%), Positives = 26/80 (32%), Gaps = 7/80 (8%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHG-----LPPAQARKNGL--LGYVPQSEQV 88
            LLGA  SGKST++K +  + + +             +    A    +  LG     ++ 
Sbjct: 3   LLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKER 62

Query: 89  DWAFPVRVIDVVMMGRYGHM 108
                +    V  M      
Sbjct: 63  KTDSKMVCDVVSRMEDTEPF 82


>3dyoA [x.x.x] BETA-GALACTOSIDASE
          Length = 1011

 Score = 53.0 bits (125), Expect = 9e-10
 Identities = 10/133 (7%), Positives = 24/133 (18%), Gaps = 1/133 (0%)

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
                 +       ++                      R   T         +S   R  
Sbjct: 731 SEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRID 790

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGELC 208
                   + A  +  +         +    V +      +     L  +     +    
Sbjct: 791 PNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSG 850

Query: 209 DEAILLHRRVLAH 221
             AI +   V + 
Sbjct: 851 QMAITVDVEVASD 863


>1e2kB [c.37.1] THYMIDINE KINASE
          Length = 316

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 12/159 (7%), Positives = 36/159 (22%), Gaps = 17/159 (10%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +  L                 +R + +    P +   
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALG----------------SRDDIVYVPEPMTYWR 44

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                   I  +   ++           +     +  +       +    +    GG+  
Sbjct: 45  V-LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAH 103

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
               A  +            +            + +   
Sbjct: 104 APPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF 142


>3e8aC [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 328

 Score = 52.8 bits (124), Expect = 1e-09
 Identities = 14/77 (18%), Positives = 23/77 (29%), Gaps = 2/77 (2%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
                LLGA  SGKST++K +  L        ++         K  +   V     +   
Sbjct: 2   THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD--IKNNLKEAIETIVAAMSNLVPP 59

Query: 92  FPVRVIDVVMMGRYGHM 108
             +   +      Y   
Sbjct: 60  VELANPENQFRVDYILS 76


>3cmuA [x.x.x] PROTEIN RECA
          Length = 1937

 Score = 52.6 bits (124), Expect = 1e-09
 Identities = 13/90 (14%), Positives = 23/90 (25%), Gaps = 6/90 (6%)

Query: 9  VREVTVRYGDVLALDNV--TVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          V  ++       +LD       +  G +  + G   SGK+TL   +      +       
Sbjct: 1  VETISTGSL---SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFI 57

Query: 67 GLPPAQAR-KNGLLGYVPQSEQVDWAFPVR 95
              A        LG    +          
Sbjct: 58 DAEHALDPIYARKLGVDIDNLLCSQPDTGE 87


>2dftA [x.x.x] SHIKIMATE KINASE
          Length = 156

 Score = 52.5 bits (124), Expect = 1e-09
 Identities = 19/153 (12%), Positives = 40/153 (26%), Gaps = 5/153 (3%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL----LGYVPQSEQVDWA 91
            L+G  GSGKST+ + +A+ +        +            +         +  + D  
Sbjct: 5   VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVV 64

Query: 92  FPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAF 151
                    ++   G    +   R +        LE +    +        +   R    
Sbjct: 65  RAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDRAEKYRALMA 124

Query: 152 IARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
               + +      +D           R I+  L
Sbjct: 125 KRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL 156


>3crmA [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
          Length = 236

 Score = 52.3 bits (124), Expect = 1e-09
 Identities = 18/207 (8%), Positives = 38/207 (18%), Gaps = 12/207 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
                 L+G   +GK+ L   +A+ +  +   V    +                +     
Sbjct: 2   LPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIGTAKPSRELLARYPHR 61

Query: 91  AFPVRVID-VVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
              +R                  R       A A A  R  L                  
Sbjct: 62  LIDIRDPAESYSAAE-------FRADALAAMAKATARGRIPLLVGGTMLYYKALLEGLPY 114

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCD 209
                 IA      L         +  E+  +  +  +                   +  
Sbjct: 115 TVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSI----RAVGY 170

Query: 210 EAILLHRRVLAHGSPDRVLVPELMLRA 236
             +  +       +           + 
Sbjct: 171 RQVWDYLDGKLSYAEMTERGIIATRQL 197


>2ccjA [x.x.x] THYMIDYLATE KINASE
          Length = 196

 Score = 52.2 bits (123), Expect = 2e-09
 Identities = 21/194 (10%), Positives = 48/194 (24%), Gaps = 13/194 (6%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFP 93
                G  GSGK+T++  +   +      +                  VP  E++     
Sbjct: 3   FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPG-----------GVPTGEEIRKIVL 51

Query: 94  VRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIA 153
                 +           R           +  +           +      +       
Sbjct: 52  EGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEV 111

Query: 154 RGIAQGATVFLLDEPFAGVDKPSERTIVR-VLREMRDEGATLLVSTHDLAGVGELCDEAI 212
           R + + A   L  +    ++  +E    R +    R +   L      + G  E+     
Sbjct: 112 RALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFK 171

Query: 213 LLHR-RVLAHGSPD 225
            ++  + L +   D
Sbjct: 172 SVNADQPLENVVED 185


>2a1fE [x.x.x] URIDYLATE KINASE
          Length = 235

 Score = 52.1 bits (123), Expect = 2e-09
 Identities = 14/98 (14%), Positives = 25/98 (25%), Gaps = 6/98 (6%)

Query: 143 SGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLA 202
           S    KR  +           L  E   G+D      +   ++E+ + G  + V      
Sbjct: 1   SQPIYKRILLKLS-----GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGN 55

Query: 203 GVGELCDE-AILLHRRVLAHGSPDRVLVPELMLRAFGL 239
                    A +        G    V+    M  +   
Sbjct: 56  LFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFR 93


>1azsC [c.37.1 - a.66.1] GS-ALPHA
          Length = 339

 Score = 51.6 bits (121), Expect = 2e-09
 Identities = 13/81 (16%), Positives = 23/81 (28%), Gaps = 2/81 (2%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
                   LLGA  SGKST++K +  L        ++  +         +   V     +
Sbjct: 2   YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA--IETIVAAMSNL 59

Query: 89  DWAFPVRVIDVVMMGRYGHMG 109
                +   +      Y    
Sbjct: 60  VPPVELANPENQFRVDYILSV 80


>1e4vA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 214

 Score = 51.4 bits (121), Expect = 3e-09
 Identities = 19/209 (9%), Positives = 42/209 (20%), Gaps = 23/209 (11%)

Query: 36  GLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVR 95
            LLGA  +GK T  + I E                 ++            +         
Sbjct: 4   ILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVT--- 60

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
             ++V+      +           D     + +      A   +  +         I   
Sbjct: 61  -DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDR 119

Query: 156 IAQGATVFLLDEPFAGVDKPSERTIVRVL------------------REMRDEGATLLVS 197
           I            +     P +      +                  R +     T  + 
Sbjct: 120 IVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLI 179

Query: 198 THDLAGVGELCDEAILLHR-RVLAHGSPD 225
            +          +   +   + +A    D
Sbjct: 180 GYYSKEAEAGNTKYAKVDGTKPVAEVRAD 208


>3b9qA [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
          Length = 298

 Score = 51.4 bits (121), Expect = 3e-09
 Identities = 22/225 (9%), Positives = 59/225 (26%), Gaps = 15/225 (6%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
              +  + +V      +   + +   +  V  ++G NG GK+T L  +A  +  +   V 
Sbjct: 71  EIKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVL 130

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
           +      +A  +  L    +    +     +     ++ +    G               
Sbjct: 131 MAAGDTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDV-------- 182

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
                  +   H     +      +  + + ++      LL              + +  
Sbjct: 183 --VLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILLVLDG----NTGLNMLPQAR 236

Query: 185 REMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                 G T L+ T         C  +++      +        +
Sbjct: 237 EFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAV 281


>3cmwC [x.x.x] PROTEIN RECA
          Length = 1608

 Score = 51.3 bits (121), Expect = 3e-09
 Identities = 10/90 (11%), Positives = 21/90 (23%), Gaps = 6/90 (6%)

Query: 9  VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL 68
          V  ++     +         +  G +  + G   SGK+TL   +      +         
Sbjct: 1  VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA 59

Query: 69 P---PAQARKNGLLGYVPQSEQVDWAFPVR 95
                   +   LG    +          
Sbjct: 60 EHALDPIYARK--LGVDIDNLLCSQPDTGE 87


>1dp0A [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
          Length = 1011

 Score = 51.1 bits (120), Expect = 3e-09
 Identities = 9/116 (7%), Positives = 21/116 (18%), Gaps = 1/116 (0%)

Query: 101 MMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGA 160
              ++                      R   T         +S   R          + A
Sbjct: 742 KRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAA 801

Query: 161 TVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHDLAGVGELCDEAILLH 215
             +  +         +    V +      +     L  +     +      AI + 
Sbjct: 802 GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVD 857


>1dyhA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 51.0 bits (121), Expect = 4e-09
 Identities = 10/116 (8%), Positives = 28/116 (24%), Gaps = 2/116 (1%)

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
             +A+   L         +     +  G+     I R +     + L  +P         
Sbjct: 16  MENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWV 75

Query: 178 RTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPE 231
           +++   +          ++              +  L H    +   +      P+
Sbjct: 76  KSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPD 131


>1e2nA [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 50.9 bits (120), Expect = 4e-09
 Identities = 10/140 (7%), Positives = 26/140 (18%), Gaps = 1/140 (0%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +  L +          +   +                
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR-VLGASETIANIYTTQ 59

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                  +             +T     +  DAV                +         
Sbjct: 60  HRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAA 119

Query: 149 RAFIARGIAQGATVFLLDEP 168
                       ++      
Sbjct: 120 LLCYPAARYLMGSMTPQAVL 139


>1e9rB [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 50.9 bits (120), Expect = 4e-09
 Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 8  EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27 KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67 G 67
           
Sbjct: 87 D 87


>2e85B [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
          Length = 157

 Score = 50.7 bits (121), Expect = 4e-09
 Identities = 14/106 (13%), Positives = 33/106 (31%), Gaps = 7/106 (6%)

Query: 131 LTDLAHRQIGALSGGQRKRAFIAR-GIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRD 189
                      + GG      I      +   + ++D    G++    R I     +  D
Sbjct: 29  CAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRII-----DPDD 83

Query: 190 EGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLR 235
                +++TH++  +  L D+       V+  G    ++     + 
Sbjct: 84  IAEMFMMTTHNM-PLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMT 128


>2bhvD [x.x.x] COMB10
          Length = 189

 Score = 50.6 bits (120), Expect = 5e-09
 Identities = 10/167 (5%), Positives = 39/167 (23%), Gaps = 27/167 (16%)

Query: 79  LGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ 138
           L     ++++       +  +          +  +        + +A+     + +    
Sbjct: 3   LLRTITADKMIP--AFLITPISSQI---AGKVIAQVESDIFAHMGKAVLIPKGSKVIGYY 57

Query: 139 IGALSGG-QRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM---------- 187
                 G  R     +R I       +L   + G+         +               
Sbjct: 58  SNNNKMGEYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPLLLSTLTNGL 117

Query: 188 -----RDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLV 229
                  +   + +      G+ ++       ++ +        ++V
Sbjct: 118 LIGITFGDYLLMQLMRQSGMGINQVV------NQILRDKSKIAPIVV 158


>3di4A [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
          Length = 275

 Score = 50.5 bits (119), Expect = 5e-09
 Identities = 22/240 (9%), Positives = 39/240 (16%), Gaps = 19/240 (7%)

Query: 4   PPALEVR--EVTVRY---GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTP 58
           P     R    + R      V   +    E+  G    +    G     L       +T 
Sbjct: 32  PDLALYRAARASARKTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTE 91

Query: 59  QSGHVRIHGLPPAQARKNGLL-----GYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRR 113
           +    +   L          L        P +   D      +                 
Sbjct: 92  RFFSGKTRALHGTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDP 151

Query: 114 PRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGAT-----VFLLDEP 168
              +                 A      L   + +       +           +    P
Sbjct: 152 YTGNLLAGGHYHHCCHSNLTRALADHTGLPLHEAELVHDVLNVFCTGFTRDTGQYFKASP 211

Query: 169 FAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVL 228
               D       + +L  +         S              I      L       V 
Sbjct: 212 VRPGDYLEFFAEIDLLGNLSACPGGDCSSEA----SCHPLLVEIFAPAEGLGDWPSPSVN 267


>2dftC [x.x.x] SHIKIMATE KINASE
          Length = 155

 Score = 50.2 bits (118), Expect = 6e-09
 Identities = 20/154 (12%), Positives = 41/154 (26%), Gaps = 4/154 (2%)

Query: 34  VCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSE---QVDW 90
              L+G  GSGKST+ + +A+ +        +            +     + E     + 
Sbjct: 3   KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEED 62

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                + D   +   G   +T    ++               +   R  G  +   R   
Sbjct: 63  VVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEKYRALM 122

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
                + +      +D           R I+  L
Sbjct: 123 AKRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL 155


>1e9sA [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 427

 Score = 50.2 bits (118), Expect = 6e-09
 Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 8  EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 27 KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 86

Query: 67 G 67
           
Sbjct: 87 D 87


>2bhvA [x.x.x] COMB10
          Length = 191

 Score = 50.1 bits (119), Expect = 7e-09
 Identities = 15/158 (9%), Positives = 43/158 (27%), Gaps = 19/158 (12%)

Query: 79  LGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ 138
           L     ++++       +  +          +  +        + +A+     + +    
Sbjct: 3   LLRTITADKMI--PAFLITPISSQI---AGKVIAQVESDIFAHMGKAVLIPKGSKVIGYY 57

Query: 139 IGALS-GGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVS 197
                 G  R     +R I       +L   + G+         +           LL+S
Sbjct: 58  SNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG------VPLLLS 111

Query: 198 THD---LAGVGELCDEA----ILLHRRVLAHGSPDRVL 228
           T     L G+     +     ++    +  +   +++L
Sbjct: 112 TLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQIL 149


>3cphA [x.x.x] RAS-RELATED PROTEIN SEC4
          Length = 175

 Score = 49.8 bits (117), Expect = 8e-09
 Identities = 24/171 (14%), Positives = 45/171 (26%), Gaps = 4/171 (2%)

Query: 35  CGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLP----PAQARKNGLLGYVPQSEQVDW 90
             L+G +G GKS LL    E     S    I             K   L     + Q  +
Sbjct: 4   ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERF 63

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                      MG      +T     ++     + +      +     +G  S  + +  
Sbjct: 64  RTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVV 123

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL 201
              +G A    + +     +  +  +   I   L ++  E           
Sbjct: 124 TADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVG 174


>3brwA [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
          Length = 336

 Score = 49.8 bits (117), Expect = 8e-09
 Identities = 19/237 (8%), Positives = 44/237 (18%), Gaps = 39/237 (16%)

Query: 2   TTPPALEVREVTVRY----GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVT 57
           TT   LE       Y          +  +++   G +   L  +  G    L+ +     
Sbjct: 1   TTKVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKC 60

Query: 58  PQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKS 117
                V                                 +  +       + + R     
Sbjct: 61  RTYHDVIPI----------------------SCLTEFPNVVQMAKLVCEDVNVDRFYPVL 98

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
              A    +         + + G +       +                E    + +  +
Sbjct: 99  YPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFSTNEE-SPAFVEFLEFLGQKVK 157

Query: 178 RTIVRVLREM-----RDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLV 229
               +  R          G   +              E +      L +   D   +
Sbjct: 158 LQDFKGFRGGLDVTHGQTGTESVYCNFRN-------KEIMFHVSTKLPYTEGDAQQL 207


>2d4uB [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
          Length = 155

 Score = 49.8 bits (119), Expect = 8e-09
 Identities = 7/100 (7%), Positives = 19/100 (19%), Gaps = 9/100 (9%)

Query: 96  VIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARG 155
           V +++       +    +          +  + T       R          +   +   
Sbjct: 57  VAELMESASI-SLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGA 115

Query: 156 IAQGATVFLLDEPFAGVDKPSE----RTIVRVLREMRDEG 191
                     D+P  G             +     + D  
Sbjct: 116 GKINE---FFDQPTQGYQ-DGFEKQYVAYMEQNDRLHDIA 151


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score = 49.6 bits (116), Expect = 9e-09
 Identities = 32/241 (13%), Positives = 70/241 (29%), Gaps = 15/241 (6%)

Query: 6   ALEVREVTVRYG--DVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
           ++ VR  T  +   D   L+ +T  I  G +  ++G  G GKS+LL  +   +    GHV
Sbjct: 2   SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHV 61

Query: 64  RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
            I G      ++  +     +   +            ++     +         DR    
Sbjct: 62  AIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRT--- 118

Query: 124 EALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV 183
                    ++  + +    G +++ +      +        D   A      +     V
Sbjct: 119 ---------EIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV 169

Query: 184 LREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLEEP 242
           +           +            D  I++   ++   GS   +L  +     F     
Sbjct: 170 IGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYA 229

Query: 243 A 243
           +
Sbjct: 230 S 230


>2ancD [x.x.x] GUANYLATE KINASE
          Length = 204

 Score = 49.5 bits (116), Expect = 1e-08
 Identities = 25/209 (11%), Positives = 55/209 (26%), Gaps = 12/209 (5%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           +G +  +   +G+GKS+L++ + +        V +                    E   +
Sbjct: 1   QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVS------HTTRQPRPGEVHGEHYFF 54

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRA 150
                  +++    +                  E +  TG+              ++K  
Sbjct: 55  VNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMP 114

Query: 151 FIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLRE-----MRDEGATLLVSTHDLAGVG 205
                     +   LD    G  + SE  I + + +             L+   D     
Sbjct: 115 HARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL 174

Query: 206 ELCDEAILLHR-RVLAHGSPDRVLVPELM 233
                 I   R R+         L+ +L+
Sbjct: 175 TDLKTIIRAERLRMSRQKQRHDALISKLL 203


>4dfrA [c.71.1] DIHYDROFOLATE REDUCTASE
          Length = 159

 Score = 49.4 bits (117), Expect = 1e-08
 Identities = 10/116 (8%), Positives = 28/116 (24%), Gaps = 2/116 (1%)

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
             +A+   L         +     +  G+     I R +     + L  +P         
Sbjct: 16  MENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWV 75

Query: 178 RTIVRVLRE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPE 231
           +++   +          ++              +  L H    +   +      P+
Sbjct: 76  KSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPD 131


>3cnnA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 227

 Score = 49.1 bits (115), Expect = 1e-08
 Identities = 15/158 (9%), Positives = 35/158 (22%), Gaps = 8/158 (5%)

Query: 16  YGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARK 75
            G+   +    +   R     ++G   +GKST++  +             +G+       
Sbjct: 71  KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPG 130

Query: 76  NGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLA 135
                   +           +    +  +           +S      E+       D A
Sbjct: 131 ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGI---ESSFSEFFEDFA 187

Query: 136 HRQIGALSGGQRKRAFIARGIAQGAT-----VFLLDEP 168
            ++     GG                         + P
Sbjct: 188 RKRGLLKKGGVPDIERALMLFFTEVAQGKAGRVSFERP 225


>1e1qB [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
          Length = 479

 Score = 48.8 bits (115), Expect = 2e-08
 Identities = 10/64 (15%), Positives = 20/64 (31%)

Query: 4   PPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHV 63
           P  +    V       +   +  V IGRG    ++G   +GK+++           +   
Sbjct: 111 PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGT 170

Query: 64  RIHG 67
               
Sbjct: 171 DEKK 174


>1eamA [c.66.1] PROTEIN (VP39)
          Length = 285

 Score = 48.4 bits (114), Expect = 2e-08
 Identities = 13/206 (6%), Positives = 38/206 (18%), Gaps = 14/206 (6%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
               +    +   GS   T ++ + +        ++   +                    
Sbjct: 49  RHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRH----------HDPILN 98

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALER-TGLTDLAHRQIGALSGGQR 147
                  V   V       +     P K    +   +      L++ A + +        
Sbjct: 99  GLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPV 158

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR--VLREMRDEGATLLVSTHDLAGVG 205
             +   R       +     P                +       G  + ++    +   
Sbjct: 159 ASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAV 218

Query: 206 ELCDEAILLH-RRVLAHGSPDRVLVP 230
               +   L+                
Sbjct: 219 NYAKKMYYLNKIVRNKVVVNFDYPNQ 244


>1ckvA [x.x.x] PROTEIN (PROTEIN B)
          Length = 141

 Score = 48.3 bits (114), Expect = 2e-08
 Identities = 5/114 (4%), Positives = 21/114 (18%), Gaps = 21/114 (18%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH---- 62
             +  +  +        +    +       L+       +T ++ I      ++ +    
Sbjct: 10  AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVN 69

Query: 63  ------------VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGR 104
                            +   +  +   LG                  +     
Sbjct: 70  VEDRAGYWWIKANGKIEVDCDEISEL--LGRQFNV---YDFLVDVSSTIGRAYT 118


>3dm5B [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
          Length = 413

 Score = 48.1 bits (113), Expect = 3e-08
 Identities = 19/228 (8%), Positives = 55/228 (24%), Gaps = 25/228 (10%)

Query: 5   PALEVREVTVRY--GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGH 62
               + ++        +           +  +  ++G  GSGK+T +  +A     +   
Sbjct: 71  KKEHIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYK 130

Query: 63  VRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAV 122
           V +      +      L  +     ++     +  D + + + G      +         
Sbjct: 131 VGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG-------- 182

Query: 123 AEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVR 182
                           I   + G+ K       + Q + V    E    +D    +    
Sbjct: 183 -------------VDIIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYN 229

Query: 183 VLREMRDEGATL-LVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
                ++      ++ T            + +      +        +
Sbjct: 230 QALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKI 277


>2ancB [x.x.x] GUANYLATE KINASE
          Length = 204

 Score = 47.7 bits (111), Expect = 4e-08
 Identities = 23/210 (10%), Positives = 53/210 (25%), Gaps = 12/210 (5%)

Query: 30  GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVD 89
            +G +  +   +G+GKS+L++ + +        V +               +       +
Sbjct: 1   AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDE 60

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
           +   +     +                 ++         TG+              ++K 
Sbjct: 61  FKEMISRDAFLEHAEVFGNYYGTSREAIEQV------LATGVDVFLDIDWQGAQQIRQKM 114

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLR-----EMRDEGATLLVSTHDLAGV 204
                      +   LD    G  + SE  I + +               L+   D    
Sbjct: 115 PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA 174

Query: 205 GELCDEAILLHR-RVLAHGSPDRVLVPELM 233
                  I   R R+         L+ +L+
Sbjct: 175 LTDLKTIIRAERLRMSRQKQRHDALISKLL 204


>1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 220

 Score = 47.1 bits (110), Expect = 5e-08
 Identities = 30/210 (14%), Positives = 45/210 (21%), Gaps = 16/210 (7%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGL---LGYVPQSEQ 87
             +   L+G  G+GK T    + E                              + Q   
Sbjct: 3   ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGL 62

Query: 88  VDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
           V     V +I   +                     AE L    L +       A+     
Sbjct: 63  VSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKL-DQMLKEQGTPLEKAIELKVD 121

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGA--------TLLVSTH 199
               +AR   +              + P E     V  E   + +          L + H
Sbjct: 122 DELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYH 181

Query: 200 DLAG--VGELCDEAILLHRRVLAHGSPDRV 227
                 V       I     V A   P  V
Sbjct: 182 AQTEPIVDFYKKTGI--WAGVDASQPPATV 209


>3c14C [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
          Length = 329

 Score = 46.7 bits (109), Expect = 7e-08
 Identities = 11/36 (30%), Positives = 16/36 (44%)

Query: 32 GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
               LLGA  SGKST++K +  L        ++  
Sbjct: 2  THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD 37


>1d8jA [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
          Length = 81

 Score = 46.6 bits (110), Expect = 8e-08
 Identities = 6/80 (7%), Positives = 23/80 (28%), Gaps = 9/80 (11%)

Query: 108 MGLTRRPRKSDRDAVAEALERTGLTDLA--------HRQIGALSGGQRKR-AFIARGIAQ 158
           +  +   +      +   ++                  +   L  G +++   +   +  
Sbjct: 2   LSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVN 61

Query: 159 GATVFLLDEPFAGVDKPSER 178
              + ++D  +A   K + R
Sbjct: 62  NPKIEVIDGKYAFKPKYNVR 81


>3bb1D [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
          Length = 247

 Score = 46.4 bits (108), Expect = 9e-08
 Identities = 26/233 (11%), Positives = 62/233 (26%), Gaps = 39/233 (16%)

Query: 7   LEVREVTVRYGD--VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
             +           +  L N+  E    +   ++G  G GKS+ + +I           +
Sbjct: 6   SGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQ 65

Query: 65  IHGLPPAQARKNGL---LGYVPQSEQVDWAFPVRVIDVVMM---------GRYGHMGLTR 112
             G  P    ++     L  +     ++  +   +   ++                 L  
Sbjct: 66  SEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDA 125

Query: 113 RPRKSDRDAVAEALERTGLTDLAHRQIGAL------------------------SGGQRK 148
               +    VA+A+  +    + ++ I AL                            R 
Sbjct: 126 YRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRS 185

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDL 201
            A + +  A    V L++      D+      +  +  +  +  T +      
Sbjct: 186 GASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLV-QTITEVALNKSE 237


>3b85B [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
          Length = 180

 Score = 46.3 bits (108), Expect = 9e-08
 Identities = 20/181 (11%), Positives = 42/181 (23%), Gaps = 14/181 (7%)

Query: 22  LDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGY 81
             +    I    +   LG  GSGK+ L     + +  +     I   P  +A +      
Sbjct: 9   QKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGE-----K 63

Query: 82  VPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGA 141
           +              +  V       +         +   +A          +   +   
Sbjct: 64  LGFLPDPYLRPLHDALRDVEPEVIPKL----EAGIVEVAPLAYRGRTLNDAFVILDEAQN 119

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVSTHD 200
            +  Q+        +  G+ V   D     V             E+         +  H 
Sbjct: 120 TTPAQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHI 175

Query: 201 L 201
           +
Sbjct: 176 V 176


>3ed8A [x.x.x] YELLOW FLUORESCENCE PROTEIN
          Length = 228

 Score = 45.8 bits (108), Expect = 1e-07
 Identities = 8/78 (10%), Positives = 21/78 (26%), Gaps = 1/78 (1%)

Query: 7   LEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
           +E++    +  D   L +            +    G+ K+ +          + G V++ 
Sbjct: 119 IELKGTDFKE-DGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLA 177

Query: 67  GLPPAQARKNGLLGYVPQ 84
                          +P 
Sbjct: 178 DHYQQNTPIGDGPVLLPD 195


>1e9sK [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
          Length = 422

 Score = 45.2 bits (105), Expect = 2e-07
 Identities = 12/60 (20%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 8  EVREVTVRYGDVLALDNVTVEIG-RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIH 66
          +++ +T      + +  V +          + GA G+GKS LL+ +A     +   + I 
Sbjct: 26 KLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV 85


>3cqcA [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
          Length = 247

 Score = 45.0 bits (105), Expect = 2e-07
 Identities = 21/251 (8%), Positives = 49/251 (19%), Gaps = 37/251 (14%)

Query: 1   MTTPPALEVREVTVRY---GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVT 57
                  +   +  ++       A   V V+I +  +  +        +           
Sbjct: 18  QRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYL 77

Query: 58  PQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKS 117
                                           +     V     +               
Sbjct: 78  EAHETFNEW-----------------------FKHMNSVPQKPALIPQPTFTEKVAHEHK 114

Query: 118 DRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE 177
           ++    +     G  D     +                +          E    +    +
Sbjct: 115 EKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRK 174

Query: 178 RTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPD--RVLVPE---- 231
             +  +   +       L ST       +L D       ++    S +  R L+ +    
Sbjct: 175 LCLPMLCFLLHTI----LHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRES 230

Query: 232 -LMLRAFGLEE 241
            LML   GL+ 
Sbjct: 231 SLMLLDQGLDP 241


>1cjuC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 331

 Score = 44.8 bits (104), Expect = 3e-07
 Identities = 12/78 (15%), Positives = 21/78 (26%), Gaps = 1/78 (1%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKN-GLLGYVPQSEQVDW 90
                LLGA  SGKST++K +  L        ++  +          ++  +        
Sbjct: 2   THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE 61

Query: 91  AFPVRVIDVVMMGRYGHM 108
                    V        
Sbjct: 62  LANPENQFRVDYILSVMN 79


>1e2hB [c.37.1] THYMIDINE KINASE
          Length = 311

 Score = 44.8 bits (104), Expect = 3e-07
 Identities = 14/184 (7%), Positives = 38/184 (20%), Gaps = 11/184 (5%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG-----HVRIHGLPPAQARKNGLLGYVP 83
           +   +   + G +G GK+T  + +  L +          +    +  A      +     
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 84  QSE-----QVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQ 138
           + +       D A  +    + M   Y        P                        
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAA 120

Query: 139 IGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE-GATLLVS 197
           +      +     +           +                 R +  +       +L +
Sbjct: 121 LLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA 180

Query: 198 THDL 201
              +
Sbjct: 181 IRRV 184


>3dfdA [x.x.x] PROTEIN YQBN
          Length = 120

 Score = 44.8 bits (105), Expect = 3e-07
 Identities = 8/94 (8%), Positives = 19/94 (20%), Gaps = 9/94 (9%)

Query: 7   LEVREVTVRYGD-----VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
           ++  EV V            +     +         L    + K    +     +  ++ 
Sbjct: 14  IDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTKELDSQRFYARIAVETT 73

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVR 95
                     + R+          E       V 
Sbjct: 74  --VYPTFKAKELREA--YKTEDPVEVAKRVLSVG 103


>2a5vA [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
          Length = 210

 Score = 44.2 bits (104), Expect = 4e-07
 Identities = 18/128 (14%), Positives = 28/128 (21%), Gaps = 13/128 (10%)

Query: 6   ALEVREVTVRY-GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
              VR         VL      V +    +  +LG +  G            T   G+VR
Sbjct: 75  MFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVR 134

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVR-VIDVVMMGRYGHMGLTRRPRKSDRDAVA 123
                 A +          +      +         V         L  R          
Sbjct: 135 DVVERVAPSV-----LLGRRDGL---SRVDEFEQRHVH---ETVAILMARSSAISERIAG 183

Query: 124 EALERTGL 131
            +L   G+
Sbjct: 184 GSLAIVGV 191


>3cddA [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 322

 Score = 43.2 bits (101), Expect = 8e-07
 Identities = 23/211 (10%), Positives = 55/211 (26%), Gaps = 36/211 (17%)

Query: 37  LLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRV 96
                    +     I  +   Q+  V I G                  +    ++    
Sbjct: 34  ETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERV----------ITGYVDDWVPSYDEST 83

Query: 97  IDVVMMGR-----YGHMGLTRRPR----KSDRDAVAEALERTGLTDLAHRQIGA------ 141
           I + + GR          +         ++         +  G+  + +  +G       
Sbjct: 84  ITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQ 143

Query: 142 LSGGQRKRAFIARGIAQGATVFLLDEPFAGV--------DKPSERTIVRVLREMRDE-GA 192
           +  G+     +AR +A+   V L  + F  +               +   ++  R     
Sbjct: 144 IEQGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSW 202

Query: 193 TLLVSTHDL-AGVGELCDEAILLHRRVLAHG 222
               S   + A   ++ D  I  +R ++   
Sbjct: 203 RQRFSKFTIKAAKADVTDSEIGRYRPLIIVN 233


>2aexA [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
          Length = 336

 Score = 43.2 bits (101), Expect = 8e-07
 Identities = 4/71 (5%), Positives = 10/71 (14%), Gaps = 12/71 (16%)

Query: 158 QGATVFLLDEPFAGVDKPSERTIVRVLREM------------RDEGATLLVSTHDLAGVG 205
           +   +      F          + R   +M                  L           
Sbjct: 1   EEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSV 60

Query: 206 ELCDEAILLHR 216
           +  +       
Sbjct: 61  DRWERKEGGGG 71


>2axnA [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
          Length = 451

 Score = 43.2 bits (99), Expect = 8e-07
 Identities = 6/44 (13%), Positives = 14/44 (31%), Gaps = 1/44 (2%)

Query: 5  PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTL 48
              V+++ V           +       V  ++G    GK+ +
Sbjct: 4  TQSRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYI 46


>1cjvC [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
          Length = 329

 Score = 43.0 bits (99), Expect = 9e-07
 Identities = 14/77 (18%), Positives = 25/77 (32%), Gaps = 1/77 (1%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDWA 91
                LLGA  SGKST++K +  L   ++  V+       +A +  ++  +         
Sbjct: 2   THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIET-IVAAMSNLVPPVEL 60

Query: 92  FPVRVIDVVMMGRYGHM 108
                   V        
Sbjct: 61  ANPENQFRVDYILSVMN 77


>2b0lC [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
          Length = 94

 Score = 42.8 bits (100), Expect = 1e-06
 Identities = 8/85 (9%), Positives = 24/85 (28%), Gaps = 7/85 (8%)

Query: 160 ATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTH------DLAGVGELCDEAIL 213
           A V +     +  +  +   I   L           ++         +       + A +
Sbjct: 8   AVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGV 67

Query: 214 LHR-RVLAHGSPDRVLVPELMLRAF 237
           +    +   G+  +VL  + ++   
Sbjct: 68  IESRSLGMKGTYIKVLNNKFLIELE 92


>2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 195

 Score = 42.7 bits (99), Expect = 1e-06
 Identities = 20/101 (19%), Positives = 35/101 (34%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG    L G +G+GK+T+   + E +   +           +   N  LG+ P   + + 
Sbjct: 18  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENI 77

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL 131
                V  +        +     P   DR+   +  E  GL
Sbjct: 78  RRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGL 118


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 41.9 bits (96), Expect = 2e-06
 Identities = 34/242 (14%), Positives = 82/242 (33%), Gaps = 18/242 (7%)

Query: 5   PALEVREVTVRYGD---VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSG 61
             + +  VT  + +      L ++  +I RG +  + G+ G+GK++LL  I   + P  G
Sbjct: 2   TEVVMENVTAFWEEGLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG 61

Query: 62  HVRIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDA 121
            ++  G     ++ + ++    +   +            ++          +  + D   
Sbjct: 62  KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKD--- 118

Query: 122 VAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIV 181
                       +       LS GQ+ +  +AR + + A ++LLD PF G         +
Sbjct: 119 ----------NIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPF-GYLDVLTEKEI 167

Query: 182 RVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVLVPELMLRAFGLE 240
                 +       +         +  D+ ++LH      +G+   +   +    +  + 
Sbjct: 168 FESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMS 227

Query: 241 EP 242
             
Sbjct: 228 FD 229


>2a5vB [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
          Length = 210

 Score = 41.1 bits (96), Expect = 3e-06
 Identities = 18/125 (14%), Positives = 28/125 (22%), Gaps = 13/125 (10%)

Query: 9   VREVTVRYGD-VLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
           VR         VL      V +    +  +LG +  G            T   G+VR   
Sbjct: 76  VRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVV 135

Query: 68  LPPAQARKNGLLGYVPQSEQVDWAFPVR-VIDVVMMGRYGHMGLTRRPRKSDRDAVAEAL 126
              A +          +      +         V         L  R           +L
Sbjct: 136 ERVAPSV-----LLGRRDG---LSRVDEFEQRHVH---ETVAILMARSSAISERIAGGSL 184

Query: 127 ERTGL 131
              G+
Sbjct: 185 AIVGV 189


>3dmdA [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 310

 Score = 40.6 bits (93), Expect = 5e-06
 Identities = 9/41 (21%), Positives = 14/41 (34%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGK 45
              E     +     + L     +  +  V   +G NGSGK
Sbjct: 88  AVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK 128


>1d6aA [d.165.1] POKEWEED ANTIVIRAL PROTEIN
          Length = 262

 Score = 40.0 bits (92), Expect = 7e-06
 Identities = 13/125 (10%), Positives = 25/125 (20%), Gaps = 14/125 (11%)

Query: 17  GDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKN 76
            ++  +  V     +     LL A             E    ++   R     P      
Sbjct: 147 SNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIEN-QVKTNFNRAFNPNPKVLNLQ 205

Query: 77  GLLGYVPQS--EQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDL 134
              G +  +  +  +   P                +     K     V E      L + 
Sbjct: 206 ETWGKISTAIHDAKNGVLPKP-----------LELVDASGAKWIVLRVDEIKPDVALLNY 254

Query: 135 AHRQI 139
                
Sbjct: 255 VGGSC 259


>1e2lA [c.37.1] THYMIDINE KINASE
          Length = 304

 Score = 39.8 bits (91), Expect = 8e-06
 Identities = 16/204 (7%), Positives = 41/204 (20%), Gaps = 7/204 (3%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +  +  P+                     +     ++
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEI 60

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                  V+    +       +T           A +            +    +     
Sbjct: 61  SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI--FDRHPIAALLCYP 118

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRV-----LREMRDEGATLLVSTHDLAG 203
            A    G      V             +   +  +     +  +             +  
Sbjct: 119 AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLA 178

Query: 204 VGELCDEAILLHRRVLAHGSPDRV 227
                   +    R L  G   R 
Sbjct: 179 AIRRVYGLLANTVRYLQCGGSWRE 202


>1e2mA [c.37.1] THYMIDINE KINASE
          Length = 305

 Score = 39.7 bits (91), Expect = 9e-06
 Identities = 15/172 (8%), Positives = 39/172 (22%), Gaps = 17/172 (9%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + + + +      +    +  A      +     + +Q 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQG 60

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
           + +     + +        M     P       +A  +                      
Sbjct: 61  EISAGDAAVVMTSAQITMGM-----PYAVTDAVLAPHIGGE------------AGSPPAL 103

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHD 200
                R        +       G   P        L      G  +++    
Sbjct: 104 TLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP 155


>2e85A [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
          Length = 156

 Score = 39.5 bits (91), Expect = 1e-05
 Identities = 12/136 (8%), Positives = 33/136 (24%), Gaps = 13/136 (9%)

Query: 112 RRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIAR-GIAQGATVFLLDEPFA 170
                 D  A     E+             + GG      I      +   + ++D    
Sbjct: 12  GNSMMGDDGAGPLLAEK--CAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDM 69

Query: 171 GVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE-----AILLHRRVLAHGSPD 225
           G++    R       +  D     +++TH++     +         ++            
Sbjct: 70  GLNPGEIRI-----IDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFY 124

Query: 226 RVLVPELMLRAFGLEE 241
             +   +      + +
Sbjct: 125 YPMTQPIKDAVETVYQ 140


>1e2lB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 22/193 (11%), Positives = 52/193 (26%), Gaps = 11/193 (5%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + +  L +          +         +LG       +
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM-----TYWRVLGASETIANI 55

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                      +  G    +  + +       AV +A+    +   A           R 
Sbjct: 56  FTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRH 115

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELC 208
              IA  +   A  +L+      +   +    V ++         +L +  +   +  L 
Sbjct: 116 P--IAALLCYPAARYLMG----SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLA 169

Query: 209 DEAILLHRRVLAH 221
               L     +  
Sbjct: 170 KRLDLAMLAAIRR 182


>2cdnA [x.x.x] ADENYLATE KINASE
          Length = 186

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 23/183 (12%), Positives = 46/183 (25%), Gaps = 1/183 (0%)

Query: 30  GRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVD 89
           G  +   LLG  G+GK T    +AE +               +      +      +  D
Sbjct: 3   GSHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGD 62

Query: 90  WAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKR 149
                   ++V                    +V +A     + +     I A+   +   
Sbjct: 63  LVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSE 122

Query: 150 AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCD 209
             +   +         D+      K   R     L E   +    + +   +  V     
Sbjct: 123 EVLLERLKGRGRADDTDDVILNRMK-VYRDETAPLLEYYRDQLKTVDAVGTMDEVFARAL 181

Query: 210 EAI 212
            A+
Sbjct: 182 RAL 184


>2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 198

 Score = 38.8 bits (89), Expect = 2e-05
 Identities = 20/101 (19%), Positives = 35/101 (34%)

Query: 31  RGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQVDW 90
           RG    L G +G+GK+T+   + E +   +           +   N  LG+ P   + + 
Sbjct: 21  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENI 80

Query: 91  AFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL 131
                V  +        +     P   DR+   +  E  GL
Sbjct: 81  RRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGL 121


>3e70C [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
          Length = 307

 Score = 38.7 bits (88), Expect = 2e-05
 Identities = 29/226 (12%), Positives = 54/226 (23%), Gaps = 23/226 (10%)

Query: 5   PALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
               V E+      +  L     +  +  V   +G NGSGK+T +  +A  +      V 
Sbjct: 86  VKEAVSEILETSRRI-DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVV 144

Query: 65  IHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAE 124
           I      +A     L    +   V         D   +          R           
Sbjct: 145 IAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARG---------- 194

Query: 125 ALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVL 184
                         +   +G       +   + + A V   +      D  +   IV   
Sbjct: 195 ----------IDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQA 244

Query: 185 RE-MRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSPDRVL 228
           R+         ++ T   A        +I       +      +  
Sbjct: 245 RQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGY 290


>1e2jB [c.37.1] THYMIDINE KINASE
          Length = 314

 Score = 38.2 bits (87), Expect = 3e-05
 Identities = 6/39 (15%), Positives = 14/39 (35%)

Query: 29 IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
          +   +   + G +G GK+T  + +  L +          
Sbjct: 1  MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP 39


>2bwjB [x.x.x] ADENYLATE KINASE 5
          Length = 195

 Score = 38.1 bits (87), Expect = 3e-05
 Identities = 7/37 (18%), Positives = 15/37 (40%)

Query: 28 EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
          ++ +  +  ++G  GSGK T  + + E          
Sbjct: 4  DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG 40


>1e2hA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 37.9 bits (86), Expect = 3e-05
 Identities = 8/80 (10%), Positives = 26/80 (32%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + + + +      +    +  A      +     + +Q 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQG 60

Query: 89  DWAFPVRVIDVVMMGRYGHM 108
           + +     + +        M
Sbjct: 61  EISAGDAAVVMTSAQITMGM 80


>1e2mB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 37.0 bits (84), Expect = 6e-05
 Identities = 21/234 (8%), Positives = 52/234 (22%), Gaps = 23/234 (9%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL----PPAQARKNGLLGYVPQ 84
           +   +   + G +G GK+T  + +  L +          +        +     +     
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 85  SEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDR---------------DAVAEALERT 129
                         V+   +                                    +   
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL 120

Query: 130 GLTDLAHRQIGALSGGQRKR--AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREM 187
                A   +G+++        A I   +     V         +D+ ++R  + +L  +
Sbjct: 121 LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAI 180

Query: 188 RDEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAFGLEE 241
           R     L  +   L                     +  R  + + +   F   E
Sbjct: 181 RRVYGLLANTVRYLQCG--GSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRAPE 232


>2bwjD [x.x.x] ADENYLATE KINASE 5
          Length = 192

 Score = 36.9 bits (84), Expect = 6e-05
 Identities = 7/36 (19%), Positives = 14/36 (38%)

Query: 29 IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR 64
          + +  +  ++G  GSGK T  + + E          
Sbjct: 4  LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG 39


>3bjqB [x.x.x] PHAGE-RELATED PROTEIN
          Length = 297

 Score = 36.8 bits (83), Expect = 7e-05
 Identities = 3/52 (5%), Positives = 9/52 (17%)

Query: 160 ATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEA 211
               L                +  +  +   G  +L    +   +       
Sbjct: 5   VDPILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRNT 56


>1e2nB [c.37.1] THYMIDINE KINASE
          Length = 309

 Score = 36.7 bits (83), Expect = 7e-05
 Identities = 24/235 (10%), Positives = 53/235 (22%), Gaps = 22/235 (9%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGL-------PPAQARKNGLLGY 81
           +   +   + G +G GK+T  + +  L +          +                   +
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQH 60

Query: 82  VPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGA 141
                ++       V+    +       +T           A +     L    H     
Sbjct: 61  RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL 120

Query: 142 LSG-------------GQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMR 188
           L                      +      G  + L   P         +  + +L  +R
Sbjct: 121 LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIR 180

Query: 189 DEGATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLVPELMLRAFGLEEPA 243
                L  +   L   G   ++   L        +  R  + + +   F   E  
Sbjct: 181 RVYGLLANTVRYLQCGGSWREDWGQLSGPQ--SNAGPRPHIGDTLFTLFRAPELL 233


>2bhvC [x.x.x] COMB10
          Length = 188

 Score = 36.6 bits (84), Expect = 8e-05
 Identities = 11/85 (12%), Positives = 22/85 (25%), Gaps = 7/85 (8%)

Query: 115 RKSDRDAVAEALERTGLTDLAHRQIGALSG-GQRKRAFIARGIAQGATVFLLDEPFAGVD 173
                  + +A+     + +             R     +R I       +L   + G+ 
Sbjct: 34  ESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLV 93

Query: 174 KPSERTIVRVLREMRDEGATLLVST 198
                   +        G  LL+ST
Sbjct: 94  GELIERNFQRY------GVPLLLST 112


>1d2zD [a.77.1] DEATH DOMAIN OF TUBE
          Length = 153

 Score = 36.3 bits (83), Expect = 1e-04
 Identities = 7/84 (8%), Positives = 18/84 (21%), Gaps = 12/84 (14%)

Query: 1   MTTPPALEVREVTVRYG--DVLALDNVTVEIGRGVVCGLL-------GANGSGKSTLLKT 51
                     +   +Y   DV  +D     +        +           + + T+   
Sbjct: 51  AGCLNFPAEIKKGFKYTAQDVFQIDEAANRLPPDQSKSQMMIDEWKTSGKLNERPTVGVL 110

Query: 52  IAELVTPQ---SGHVRIHGLPPAQ 72
           +  LV  +   +            
Sbjct: 111 LQLLVQAELFSAADFVALDFLNES 134


>1bccF [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
          Length = 100

 Score = 35.9 bits (82), Expect = 1e-04
 Identities = 5/95 (5%), Positives = 13/95 (13%), Gaps = 11/95 (11%)

Query: 70  PAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERT 129
             +               +     +   +   +         R P     D +       
Sbjct: 6   GIRKWYYNAA--GFNKYGLMRDDTIY--ENDDVKEAIR----RLPENLYDDRMFRIKRAL 57

Query: 130 GLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFL 164
            L                K       +       +
Sbjct: 58  DLNMRQQILP---KEQWTKYEEDVPYLEPYLKEVI 89


>2aqwA [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
          Length = 310

 Score = 35.6 bits (81), Expect = 2e-04
 Identities = 7/94 (7%), Positives = 22/94 (23%), Gaps = 2/94 (2%)

Query: 99  VVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQ 158
              +    +         S+         +   + +    IGA +G   K          
Sbjct: 217 ATELKIEQNNEFIGFVVGSNAFEEKIIRNKFPDSYILSPGIGAQNGDLYKTLKNGYNKDY 276

Query: 159 GATVFLLDEPFAGVDKPSE--RTIVRVLREMRDE 190
              +  +         P +   +    + ++  +
Sbjct: 277 EKLLINVGRAITKSPDPKKSSESYYNQIIQIFKD 310


>1e2jA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 35.6 bits (80), Expect = 2e-04
 Identities = 14/163 (8%), Positives = 41/163 (25%), Gaps = 1/163 (0%)

Query: 29  IGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
           +   +   + G +G GK+T  + + + +      +    +  A      +     + +Q 
Sbjct: 1   MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQG 60

Query: 89  DWAFPVRVIDVVMMGRYGHMGL-TRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQR 147
           + +     + +        M         +             LT +  R   A      
Sbjct: 61  EISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYP 120

Query: 148 KRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDE 190
              ++   +   A +  +      +   +            D 
Sbjct: 121 AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR 163


>1dwmA [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
          Length = 69

 Score = 35.6 bits (82), Expect = 2e-04
 Identities = 4/50 (8%), Positives = 11/50 (22%), Gaps = 1/50 (2%)

Query: 176 SERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSP 224
           S       +         +++           CD   ++     +    P
Sbjct: 17  SGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVP 66


>3cddE [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
          Length = 316

 Score = 34.8 bits (79), Expect = 3e-04
 Identities = 23/218 (10%), Positives = 40/218 (18%), Gaps = 25/218 (11%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAELVT--PQSGHVRIHGLPPAQARKNGLLGYVPQSEQVD 89
                +        S                    I  +   QA    + G    +  VD
Sbjct: 16  QGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVD 75

Query: 90  WAFP---VRVIDVVMMGRYGHMGLTRRPRKSD----RDAVAEALERTGLTDLAHRQIGAL 142
              P      I + + GR     L             +     +          + I   
Sbjct: 76  DWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNT 135

Query: 143 SGGQRKR-----------AFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG 191
             G+  +             +AR   Q   V L  +           T     +      
Sbjct: 136 DVGEPFQRIQIEQGETPHELLARLAKQ-RGVLLTSDT----FGNLVITRASKTKAGVSLI 190

Query: 192 ATLLVSTHDLAGVGELCDEAILLHRRVLAHGSPDRVLV 229
               V                 +     +     R L+
Sbjct: 191 LGDNVKAARGRFSWRQRFSKFTIKDVTDSEIGRYRPLI 228


>2a78A [x.x.x] RAS-RELATED PROTEIN RAL-A
          Length = 170

 Score = 34.7 bits (78), Expect = 3e-04
 Identities = 6/33 (18%), Positives = 10/33 (30%)

Query: 35 CGLLGANGSGKSTLLKTIAELVTPQSGHVRIHG 67
            ++G+ G GKS L          +        
Sbjct: 5  VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKAD 37


>3ci2A [x.x.x] CHYMOTRYPSIN INHIBITOR 2
          Length = 64

 Score = 34.4 bits (79), Expect = 3e-04
 Identities = 6/50 (12%), Positives = 15/50 (30%), Gaps = 1/50 (2%)

Query: 176 SERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHR-RVLAHGSP 224
           S     +V+ + + E   +++    +  +    D   L           P
Sbjct: 12  SVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVP 61


>1ckeA [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
          Length = 212

 Score = 34.2 bits (77), Expect = 4e-04
 Identities = 29/175 (16%), Positives = 52/175 (29%), Gaps = 6/175 (3%)

Query: 32  GVVCGLLGANGSGKSTLLKTIAE---LVTPQSGHVRIHGLPPAQARKNGLLGYVPQSEQV 88
             V  + G +G+GK TL K +AE        SG +    L  A    +  +        +
Sbjct: 3   APVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAI-YRVLALAALHHHVDVASEDALVPL 61

Query: 89  DWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRK 148
                VR +           G         ++    A +      +    +      +  
Sbjct: 62  ASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFREL 121

Query: 149 RAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEG--ATLLVSTHDL 201
              IA G   G  VF        +D  SE    R + +++ +G          ++
Sbjct: 122 PGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEI 176


>3dkvA [x.x.x] ADENYLATE KINASE
          Length = 217

 Score = 34.2 bits (77), Expect = 4e-04
 Identities = 20/95 (21%), Positives = 32/95 (33%), Gaps = 6/95 (6%)

Query: 37  LLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYV--PQSEQVDWAFPV 94
           L+G  G+GK T  + I E       H+    +  A  ++   LG       ++ +     
Sbjct: 5   LMGLPGAGKGTQAERIVE--KYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDE 62

Query: 95  RVIDVVMMG--RYGHMGLTRRPRKSDRDAVAEALE 127
             I +V     +                A AEALE
Sbjct: 63  VTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALE 97


>2bsqE [x.x.x] TRAFFICKING PROTEIN A
          Length = 68

 Score = 34.2 bits (78), Expect = 4e-04
 Identities = 4/61 (6%), Positives = 14/61 (22%), Gaps = 4/61 (6%)

Query: 93  PVRVIDVVMMGRYGHMGLTRRPRKSD-RDAVAEALERTGLTDLAHRQ---IGALSGGQRK 148
              + +              R  +++ R  +    +      L          + G + +
Sbjct: 5   IRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMLASIGQEIGGVELE 64

Query: 149 R 149
            
Sbjct: 65  D 65


>2bwjF [x.x.x] ADENYLATE KINASE 5
          Length = 194

 Score = 33.9 bits (76), Expect = 5e-04
 Identities = 14/107 (13%), Positives = 30/107 (28%), Gaps = 3/107 (2%)

Query: 28  EIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVR---IHGLPPAQARKNGLLGYVPQ 84
           ++ +  +  ++G  GSGK T  + + E                L     R   +   + +
Sbjct: 3   DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMER 62

Query: 85  SEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGL 131
            + V     + ++   M+   G                 E   R   
Sbjct: 63  GDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIG 109


>3c85A [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
          Length = 148

 Score = 33.9 bits (76), Expect = 5e-04
 Identities = 14/144 (9%), Positives = 27/144 (18%), Gaps = 9/144 (6%)

Query: 55  LVTPQSGHVRIHG-----LPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMG 109
           L+ P    V I G         + R     G +    ++      +          G   
Sbjct: 2   LINPGHAQVLILGGRIGTGAYDELRARY--GKISLGIEIREEAAQQHRSEGRNVISGDAT 59

Query: 110 LTRRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIA-QGATVFLLDEP 168
                 +       + +            +  L     K    A           L    
Sbjct: 60  DPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGV 119

Query: 169 FAGVDKPSERTIVRVLREMRDEGA 192
            A  +           R +  +  
Sbjct: 120 DAAFN-IYSEAGSGFARHVCKQLE 142


>1chdA [x.x.x] CHEB METHYLESTERASE
          Length = 198

 Score = 33.7 bits (77), Expect = 6e-04
 Identities = 9/69 (13%), Positives = 18/69 (26%), Gaps = 7/69 (10%)

Query: 162 VFLLDEPFAGVDKPSERTIVRVLREMRDEGAT-LLVSTHDLAGVGELCDE-AILLHRRVL 219
           +  +     G +      I  VL+ +       ++             +    L    V 
Sbjct: 7   LIAIGASTGGTE-----AIRHVLQPLPLSSPAVIITQHMPPGFTRSFAERLNKLCQISVK 61

Query: 220 AHGSPDRVL 228
                +RVL
Sbjct: 62  EAEDGERVL 70


>3bm2B [x.x.x] PROTEIN YDJA
          Length = 160

 Score = 33.3 bits (75), Expect = 8e-04
 Identities = 19/130 (14%), Positives = 32/130 (24%), Gaps = 5/130 (3%)

Query: 112 RRPRKSDRDAVAEALERTGLTDLAHRQIGALSGGQRKRAFIARGIAQGATVFLLDEPFAG 171
           R  R  D        E          Q    +G   K    AR     A + +       
Sbjct: 30  RAGRAPDWHFFVIEGEGRERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKVP 89

Query: 172 VDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDEAILLHRRV----LAHGSPDRV 227
             +        V +    +G   +  +  L     + +      +      L  G+P  V
Sbjct: 90  RWEQESAGCA-VAQAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGFLYLGTPQLV 148

Query: 228 LVPELMLRAF 237
             P   +  F
Sbjct: 149 PDPTPFVTYF 158


>3c5vA [x.x.x] PROTEIN PHOSPHATASE METHYLESTERASE 1
          Length = 294

 Score = 33.3 bits (74), Expect = 8e-04
 Identities = 16/118 (13%), Positives = 31/118 (26%), Gaps = 13/118 (11%)

Query: 1   MTTPPALE----VREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELV 56
            +  P  +    + +V V          V      G V  LL   G    +     A ++
Sbjct: 3   FSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAII 62

Query: 57  TPQSGHV-----RIHGLPPAQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMG 109
           +     +     R HG    +           ++   D    V  +   +      +G
Sbjct: 63  SRVQCRIVALDLRSHGETKVKNP----EDLSAETMAKDVGNVVEAMYGDLPPPIMLIG 116


>3e3xA [x.x.x] BIPA
          Length = 267

 Score = 33.2 bits (75), Expect = 8e-04
 Identities = 16/58 (27%), Positives = 22/58 (37%), Gaps = 7/58 (12%)

Query: 166 DEPFAGVDKPSERTIVRVLREMRDEGATLLVST------HDLAGVGELCDEAILLHRR 217
             PFAG    + R I+  L +       L V          ++G GEL    IL+  R
Sbjct: 13  TSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLS-ILIENR 69


>2c95B [x.x.x] ADENYLATE KINASE 1
          Length = 194

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 20/197 (10%), Positives = 48/197 (24%), Gaps = 16/197 (8%)

Query: 24  NVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPPAQARKNGLLGYVP 83
              ++    +   ++G  GSGK T  + I +       H+    L  ++       G   
Sbjct: 1   EEKLKKTNIIF--VVGGPGSGKGTQCEKIVQ--KYGYTHLSTGDLLRSEVSSGSARGKKL 56

Query: 84  QSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVA----EALERTGLTDLAHRQI 139
                             +       +  +   S    +     E  +         +  
Sbjct: 57  SEIMEKGQLVPLET----VLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPT 112

Query: 140 GALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSE--RTIVRVLREMRDEGATLLV- 196
             L           R + +G T   +D+    + K  E        +    ++   +   
Sbjct: 113 LLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKV 172

Query: 197 -STHDLAGVGELCDEAI 212
            +   +  V       +
Sbjct: 173 NAEGSVDSVFSQVCTHL 189


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.139    0.403 

Gapped
Lambda     K      H
   0.267   0.0480    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 26,350,862
Number of extensions: 1641188
Number of successful extensions: 20936
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 10321
Number of HSP's successfully gapped: 1096
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)