RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ54134.1 tfus0 AAZ54134.1 GIB00263CH01 "Phenazine
biosynthesis PhzC/PhzF protein"
         (267 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF02567 PhzC-PhzF "Phenazine biosynthesis-like protein"               164   1e-43

>PF02567 PhzC-PhzF "Phenazine biosynthesis-like protein"
          Length = 274

 Score =  164 bits (417), Expect = 1e-43
 Identities = 128/273 (46%), Positives = 150/273 (54%), Gaps = 17/273 (6%)

Query: 7   VDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTP 66
           VDAFTD+PF GNPAAV++      D   Q +A EFNLSETAFV P    DADY LR FTP
Sbjct: 1   VDAFTDEPFGGNPAAVVLDADGLSDEQMQAIAREFNLSETAFVLPPTDPDADYRLRIFTP 60

Query: 67  TTEVDLCXXXXXXXXXXXXXXXXXXPFR--FASRSGVLTVTARD---GLLWLDFPANPPY 121
           T EV  C                    R  F +++G+L V   D   GLL LDFP   P 
Sbjct: 61  TGEVPFCGHATLATAHALLERGGLGGGRITFETKAGLLPVRGDDDEGGLLELDFPRFRPT 120

Query: 122 AKDVPD--GLVAALG-----GEPVWAGFSDVNDYFVVYPDEATVRALAPDL-AEVARCTV 173
             D  +   L+AALG     G P+    + + D  V    E  + AL PD  A +A    
Sbjct: 121 PVDAEELAALLAALGLDLDEGLPIQVVSTGLPDLLVPLKSEEALLALRPDFAAALAALGG 180

Query: 174 RGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSAHTALGPYWAQRLG----RTRLDA 229
           RGV V A A  G   DFVSR+FAPA+GIPEDPVTGSAH AL PY A++LG    R  L+ 
Sbjct: 181 RGVIVFAAAAAGAEADFVSRMFAPAVGIPEDPVTGSAHAALAPYLAEKLGKGPARYTLEQ 240

Query: 230 VQCSARGGRLVVELPADAPDRVLIGGTAVTVSE 262
            Q S R GRL VE+     +RV IGGTAVTV E
Sbjct: 241 GQASGRPGRLRVEVDGGEDERVRIGGTAVTVME 273


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.317    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0521    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 11,516,646
Number of extensions: 632294
Number of successful extensions: 82871
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1586
Number of HSP's successfully gapped: 242
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)