RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ55524.1 tfus0 AAZ55524.1 GIB00263CH01 "NADH:flavin
oxidoreductases, Old Yellow enzyme f.."
         (656 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00724 Oxidored_FMN "NADH:flavin oxidoreductase / NADH oxidase ...   155   4e-41
PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"      54   2e-10
PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"    42   5e-07
PF01210 NAD_Gly3P_dh_N "NAD-dependent glycerol-3-phosphate dehyd...    41   2e-06
PF01494 FAD_binding_3 "FAD binding domain"                             36   4e-05
PF01070 FMN_dh "FMN-dependent dehydrogenase"                           33   4e-04
PF05834 Lycopene_cycl "Lycopene cyclase protein"                       32   6e-04
PF04321 RmlD_sub_bind "RmlD substrate binding domain"                  32   0.001
PF00743 FMO-like "Flavin-binding monooxygenase-like"                   32   0.001

>PF00724 Oxidored_FMN "NADH:flavin oxidoreductase / NADH oxidase
           family"
          Length = 340

 Score =  155 bits (393), Expect = 4e-41
 Identities = 100/258 (38%), Positives = 146/258 (56%), Gaps = 16/258 (6%)

Query: 103 RKLTDTLHEAGAYVTAQLIMQGG------MPHGP-SPTVTAYV------ANQVSHALDRD 149
           +K+TD +H AG  +  QL   G       +P GP +P+  + +      A     AL  +
Sbjct: 83  KKVTDAVHAAGGKIFIQLWHAGRKASPDLLPGGPVAPSAPSALPAPIGAAGTPPRALTTE 142

Query: 150 EIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFL 209
           EI   I ++A++A+R K AG DGVE+H  H  LL+ FLSP +N R DEYGG L  R RFL
Sbjct: 143 EIKEIIEDFAQAAKRAKEAGFDGVEIHGAHGYLLDQFLSPLTNKRTDEYGGSLENRARFL 202

Query: 210 LEIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGD-- 267
           LE++DA+RA VG DF +GVR++  + ++GG    E  ++AK LE  G +D L V  G   
Sbjct: 203 LEVVDAVRAAVGADFPVGVRLSPTDFVEGGLTLEETAELAKLLEELG-VDLLDVSGGAYV 261

Query: 268 NWGAPSYIQPHYYQPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMA 327
           +   P        +P      A  + +AV +PVI  G +T P  AE+ +A+G ADLV + 
Sbjct: 262 HIAEPRPRGAFPVEPGYQLPFAEAIRKAVGIPVIAVGGITTPEQAEEALAEGDADLVALG 321

Query: 328 RAIITDPEIITKTAQGRV 345
           R  + DP+++ K A+GR+
Sbjct: 322 RPFLADPDLVKKLAEGRL 339


>PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"
          Length = 78

 Score = 53.5 bits (128), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 11/75 (14%)

Query: 392 RVLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMRIXXXXXXXXXYHDFVTWQEGR 451
           +V VVGGGPAG+E AG+LA  GH+VTL ER ++LG Q+             +   + + R
Sbjct: 1   KVAVVGGGPAGLEAAGVLARLGHKVTLVERRDRLGPQLD-----------EEISKYLQER 49

Query: 452 LRRAGVTVELGRTAT 466
           L + GV V L    T
Sbjct: 50  LEKLGVEVRLNTRVT 64


>PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
          Length = 275

 Score = 42.4 bits (99), Expect = 5e-07
 Identities = 22/36 (61%), Positives = 27/36 (75%)

Query: 390 PRRVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           P+RV+VVGGG  G+ELAG LA  G EVT+ ER  +L
Sbjct: 136 PKRVVVVGGGNTGLELAGALARLGAEVTVVERRRRL 171



 Score = 33.9 bits (77), Expect = 2e-04
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 393 VLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMR 430
           V+++GGGPAG+  A  LA  G +VTL ERE   GG  R
Sbjct: 2   VVIIGGGPAGLAAALRLARAGLKVTLIEREPGGGGLNR 39


>PF01210 NAD_Gly3P_dh_N "NAD-dependent glycerol-3-phosphate
           dehydrogenase N-terminus"
          Length = 159

 Score = 40.5 bits (94), Expect = 2e-06
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 392 RVLVVGGGPAGMELAGLLAERGHEVTLWEREEQL 425
           ++ V+G G  G  LA +LA  GHEVTLW R+E+L
Sbjct: 2   KIAVLGAGSWGTALAKVLARNGHEVTLWGRDEEL 35


>PF01494 FAD_binding_3 "FAD binding domain"
          Length = 338

 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 19/32 (59%), Positives = 23/32 (71%)

Query: 390 PRRVLVVGGGPAGMELAGLLAERGHEVTLWER 421
           PR VL+VG GPAG+ LA  LA  G +VT+ ER
Sbjct: 1   PRDVLIVGAGPAGLALALALARAGIDVTVLER 32


>PF01070 FMN_dh "FMN-dependent dehydrogenase"
          Length = 328

 Score = 32.8 bits (74), Expect = 4e-04
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 31/131 (23%)

Query: 127 PHGPSP--TVTAYVANQVSHALDRDEIAWFINEY-----------AESARRGKAAGLDGV 173
           P GP+    + A++A+Q   +L  D+I W   ++            E ARR   AG+DG+
Sbjct: 163 PKGPTGLGALAAWLASQFDPSLSWDDIEWLREQWDLPIILKGVLSPEDARRAVDAGVDGI 222

Query: 174 ELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLLEIIDAI--RAEVGPDFTLGVRMN 231
                            SNH   +  G     +  L EI+DA+  R EV  D  +   ++
Sbjct: 223 ---------------VVSNHGGRQLDGG-PSTIDALPEIVDAVGGRIEVLADGGIRRGLD 266

Query: 232 LYEALDGGYDA 242
           + +AL  G DA
Sbjct: 267 VLKALALGADA 277


>PF05834 Lycopene_cycl "Lycopene cyclase protein"
          Length = 368

 Score = 32.3 bits (73), Expect = 6e-04
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 393 VLVVGGGPAGMELAGLLAERGHEVTL 418
           V+VVGGGPAG+ LA  LA+ G  V L
Sbjct: 2   VVVVGGGPAGLALAARLAKAGLSVLL 27


>PF04321 RmlD_sub_bind "RmlD substrate binding domain"
          Length = 282

 Score = 31.7 bits (71), Expect = 0.001
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 391 RRVLVVGG-GPAGMELAGLLAERGHEVTLWEREE 423
           +++L+ G  G  G EL  LLAERG+EV   +R E
Sbjct: 1   KKILITGANGQLGRELQRLLAERGYEVVALDRSE 34


>PF00743 FMO-like "Flavin-binding monooxygenase-like"
          Length = 247

 Score = 31.6 bits (71), Expect = 0.001
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 393 VLVVGGGPAGMELAGLLAERGHEVTLWEREEQLGGQMR 430
           V ++G GP+G+  A  L E G +  ++E+ + +GG  R
Sbjct: 4   VAIIGAGPSGLAAAKRLLEEGLDPVVFEKADDIGGTWR 41


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0520    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 18,784,054
Number of extensions: 1079953
Number of successful extensions: 133053
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2433
Number of HSP's successfully gapped: 208
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)