RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ56050.1 tfus0 AAZ56050.1 GIB00263CH01
"glyceraldehyde-3-phosphate dehydrogenase"
         (335 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00044 Gp_dh_N "Glyceraldehyde 3-phosphate dehydrogenase, NAD b...   174   2e-46
PF02800 Gp_dh_C "Glyceraldehyde 3-phosphate dehydrogenase, C-ter...   157   2e-41

>PF00044 Gp_dh_N "Glyceraldehyde 3-phosphate dehydrogenase, NAD
           binding domain"
          Length = 148

 Score =  174 bits (441), Expect = 2e-46
 Identities = 90/151 (59%), Positives = 109/151 (72%), Gaps = 3/151 (1%)

Query: 4   RVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVG 63
           +VG+NGFGRIGR   RA  A    D+E+VA+NDL D   LA+LLKYD+V G   G VEV 
Sbjct: 1   KVGINGFGRIGRLVLRA--ALKRPDIEVVAINDLFDPEYLAYLLKYDSVHGRFKGTVEVD 58

Query: 64  EDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISA 123
           +D + V G  +K  A+RDPA LPWG+LGVD+VVESTG FT  E A  HL AGAKKV+ISA
Sbjct: 59  DDKLVVNGKKIKVFAERDPANLPWGELGVDVVVESTGVFTTKEKASAHLKAGAKKVVISA 118

Query: 124 PAKGEDLTVVMGVNDDKYDPANHHILSNASC 154
           P+K +  T VMGVN D+YDP +  I+SNASC
Sbjct: 119 PSKDDAPTFVMGVNHDEYDP-DDDIVSNASC 148


>PF02800 Gp_dh_C "Glyceraldehyde 3-phosphate dehydrogenase,
           C-terminal domain"
          Length = 156

 Score =  157 bits (398), Expect = 2e-41
 Identities = 87/156 (55%), Positives = 101/156 (64%), Gaps = 1/156 (0%)

Query: 159 VAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPTTTGAAKAT 218
           +AP+AK L +NFGI +GLMTTVHAYT  Q  +D P KD RR RAAA NIIPT+TGAAKA 
Sbjct: 1   LAPLAKVLNDNFGIEEGLMTTVHAYTATQKTVDGPSKDWRRGRAAALNIIPTSTGAAKAV 60

Query: 219 ALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYT 278
             VLPEL GKL G+A+RVP P+ SV DL V LE+  T                  IL YT
Sbjct: 61  GKVLPELNGKLTGMAVRVPTPNVSVVDLTVRLEKPATYEEINAALKEASEGPLKGILGYT 120

Query: 279 EDPIVSSDIVGTPASCTFDASLTMAFGTQ-VKVVGW 313
           EDP+VSSD +G P S  FDA+ T+  G   VKVV W
Sbjct: 121 EDPLVSSDFIGDPHSSIFDATATIVLGGNFVKVVSW 156


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.329    0.141    0.368 

Gapped
Lambda     K      H
   0.267   0.0564    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 15,231,123
Number of extensions: 849108
Number of successful extensions: 116050
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 298
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)