RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ56191.1 tfus0 AAZ56191.1 GIB00263CH01 "putative
long-chain-fatty-acid-CoA ligase"
         (515 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00501 AMP-binding "AMP-binding enzyme"                              273   5e-76

>PF00501 AMP-binding "AMP-binding enzyme"
          Length = 405

 Score =  273 bits (698), Expect = 5e-76
 Identities = 178/429 (41%), Positives = 235/429 (54%), Gaps = 36/429 (8%)

Query: 30  YALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYFGALKAGAVVVPLNVLLTPR 89
           YA ++   N++A  L + G++PGD+VA+  PN P F       LKAGAV VPLN  L   
Sbjct: 2   YAELDERVNRLAAGLRALGVKPGDRVAILLPNSPEFVVALLACLKAGAVAVPLNPTLPAE 61

Query: 90  EIEYHLRDSGAKALFA--------FTGTPELPLGERAWQAFQEVAECELYIDLPAAAGAT 141
           E+ Y L DSGAK L               +LPL          + E  L +D   AA A 
Sbjct: 62  ELAYILNDSGAKVLITDDELLEKLLEALAKLPL---LLAIIVSLGEEGLLLDALLAAAAP 118

Query: 142 TSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVA 201
             A P                  V  + DD+A IIYTSGTTG+PKG  LTH NLL NA A
Sbjct: 119 APAPP------------------VPVDPDDLAYIIYTSGTTGKPKGVVLTHRNLLANAAA 160

Query: 202 SSALFDQAPDSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEK 261
            +A     P   D  L+VLPL H  G   ++   L    T+VL+P FD +  L L+EK +
Sbjct: 161 LAAALGLTPG--DRVLSVLPLHHDGGVGGLLGP-LLAGATLVLLPGFDPERLLELIEKYR 217

Query: 262 VTIFAGVPTMYWGLLNAQGDHDIKQISQTLHTAVSGGASLPAEVARKVKEKFG-IEILEG 320
           VT+   VPT+   LL A  +   K    +L   +SGG  LP E+  + +E+FG I ++ G
Sbjct: 218 VTVLFAVPTLLRALLKAPEER--KYDLSSLRLVLSGGEPLPPELLERFRERFGGIPLVNG 275

Query: 321 YGLSETSPVVSFNNPKRKAKPGSIGLPIWGVEMKLVDENFNTIEGEGPGEIAVRGHCVMK 380
           YGL+ET  VV+ N P    KPGS+G P+ GVE+++VD +   +     GE+ VRG  VM+
Sbjct: 276 YGLTETGGVVTVNPPGDPDKPGSVGRPLPGVEVRIVDPDGRPVPPGEVGELVVRGPGVMR 335

Query: 381 GYHNRPEANAQVM-RDGWFRTGDIARRDEEGFYFIIDRSKDMIIRGGYNVYPREIEEVLM 439
           GY N PEA A+    DGW+RTGD+ R DE+G+ FI+ R KD+I  GG NV P EIE  L+
Sbjct: 336 GYWNDPEATAEAFDADGWYRTGDLGRLDEDGYLFILGRKKDLIKVGGENVEPAEIEAALL 395

Query: 440 THPQVSLAA 448
           +HP V+ AA
Sbjct: 396 SHPGVAEAA 404


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.311    0.127    0.379 

Gapped
Lambda     K      H
   0.267   0.0525    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 19,083,225
Number of extensions: 1102267
Number of successful extensions: 130886
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2672
Number of HSP's successfully gapped: 240
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)