RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAZ56219.1 tfus0 AAZ56219.1 GIB00263CH01 "Sfr protein"
         (407 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01098 FTSW_RODA_SPOVE "Cell cycle protein"                          133   5e-34

>PF01098 FTSW_RODA_SPOVE "Cell cycle protein"
          Length = 357

 Score =  133 bits (335), Expect = 5e-34
 Identities = 100/271 (36%), Positives = 136/271 (50%), Gaps = 5/271 (1%)

Query: 124 NGSRSWIALGDLRVQPAETAKXXXXXXXXXXXGXXXXXXXXXXASDVLISLGVAAVPIGL 183
           NG++ WI LG    QP+E AK                         +L  L +  +P+ L
Sbjct: 88  NGAKRWIRLGGFSFQPSEFAKIALILFLASYLSRKQKEKRPRLKG-LLPPLLLVLLPLLL 146

Query: 184 ILLQPDLGSALVLTAIYLALLACSGAPLRWPLALLGCGAFTGLA-VWQLGLLKDYQVARF 242
           ILLQPDLG+ALVL AI+L +L  +G  +RW   L       G+A +  L LLK YQ AR 
Sbjct: 147 ILLQPDLGTALVLFAIFLGMLFLAG--IRWKYILGLLLLLIGVAGLVLLILLKPYQKARI 204

Query: 243 TAFLDPHADPLGAGYNVNQALIAVXXXXXXXXXXXXXXQTSGKFVPEQHTDFVFSVAAEE 302
            AFLDP +DPLGAGY + Q+LIA+              Q  G ++PE HTDF+F+V  EE
Sbjct: 205 LAFLDPESDPLGAGYQLIQSLIAIGSGGLFGKGLGNGTQKLG-YLPEAHTDFIFAVIGEE 263

Query: 303 LGFAGGCAXXXXXXXXXXXXXXXASRCDEVHGRLVCIGVAAWFCVQVFVNIXXXXXXXXX 362
           LGF G                  A R  +  GRL+  G+A+    QVF+NI         
Sbjct: 264 LGFIGALLVLLLFLLLILRGLRIALRAKDPFGRLLAAGIASMIFFQVFINIGMVIGLLPV 323

Query: 363 XXXXXXFVSYGGSAAVANFAALGLVMAVHAH 393
                 F+SYGGS+ +AN  A+G+++++  H
Sbjct: 324 TGIPLPFISYGGSSLLANMIAIGILLSISRH 354


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.320    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0525    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 14,056,572
Number of extensions: 762807
Number of successful extensions: 104985
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2060
Number of HSP's successfully gapped: 224
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)