RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ54441.1 tfus0 AAZ54441.1 GIB00263CH01 "hypothetical protein"
         (1523 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ddbA [f.1.4.1] PROTEIN (BID)                                          64   3e-13
1w3bA [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE                     64   4e-13
1hz4A [a.118.8.2] MALT REGULATORY PROTEIN                              54   3e-10
2a5yB3 [c.37.1.20] CED-4 B:109 -- 385                                  53   7e-10
1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70...    48   2e-08
1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497               45   2e-07
1a87A [f.1.1.1] COLICIN N                                              41   4e-06
1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365                         40   6e-06
1d8dA [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)                  39   9e-06
2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:2...    36   9e-05
1fchA [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR              36   9e-05
2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129           35   1e-04
2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111               35   2e-04
2hr2A1 [a.118.8.8] HYPOTHETICAL PROTEIN A:2 -- 157                     35   2e-04
1ouvA [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN             34   3e-04
1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 ...    34   5e-04
3ck7A1 [a.118.8.6] SUSD A:42 -- 551                                    33   6e-04
1wfdA [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18                       33   0.001

>1ddbA [f.1.4.1] PROTEIN (BID)
          Length = 195

 Score = 64.5 bits (156), Expect = 3e-13
 Identities = 15/182 (8%), Positives = 39/182 (21%), Gaps = 11/182 (6%)

Query: 1244 NEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAA 1303
            N   LG  + + L        S     +              + + +  +    L+   +
Sbjct: 7    NGSGLGAKHITDLLVFGFLQSSGCTRQEL-----EVLGRELPVQAYWEADLEDELQTDGS 61

Query: 1304 LAAVLRRTGNLERAVKISGEVWRETKD-----RFGEDSMIXXXXXXXXXXXLRSVNRYHE 1358
             A+     G +E   +   E+               D  I             + +   E
Sbjct: 62   QASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEE 121

Query: 1359 ALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRLGE 1418
                         +             +   ++L +      A  +         + + +
Sbjct: 122  DKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAK-KVASHAPSLLRDVFHTTVNFINQ 180

Query: 1419 YH 1420
              
Sbjct: 181  NL 182



 Score = 52.9 bits (126), Expect = 8e-10
 Identities = 17/182 (9%), Positives = 34/182 (18%), Gaps = 11/182 (6%)

Query: 1203 RRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVDGY 1262
               LG      +        +     +               +     +    L      
Sbjct: 8    GSGLGAKHITDLLVFGFLQSSGCTRQELEVLG-----RELPVQAYWEADLEDELQTDGSQ 62

Query: 1263 AGSLMEAGDYFKALRYQEDNTERI-----YSLFGINHRGTLENMAALAAVLRRTGNLERA 1317
            A      G        QE+    I          ++H      +  LAA        E  
Sbjct: 63   ASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEED 122

Query: 1318 VKISGEVWRETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGED 1377
             +       +         M            L +      A  L+   +      + ++
Sbjct: 123  KRNCLAKALDEVKTAFPRDMENDKAMLIMTMLL-AKKVASHAPSLLRDVFHTTVNFINQN 181

Query: 1378 HP 1379
              
Sbjct: 182  LF 183



 Score = 50.6 bits (120), Expect = 4e-09
 Identities = 17/160 (10%), Positives = 33/160 (20%), Gaps = 7/160 (4%)

Query: 1354 NRYHEALDLVEKAYRRCAE-LLGEDHPHVAAINVNRAVVLRQMGRTEEA-----RVIDER 1407
            +      +L         +     D       + ++A      GR E        +I   
Sbjct: 27   SSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNI 86

Query: 1408 ALQVLTDRLGEYHXXXXXXXXXXXXDFFGLDDVAESVRRDTETLARCRRALSERHPLTLL 1467
            A  +        H             F       E  R          +    R      
Sbjct: 87   ARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDK 146

Query: 1468 ARRNL-VLGRKAMNEDVAEEIAAVERLYAEVMGDQHPATL 1506
            A   + +L  K +       +  V       +     + +
Sbjct: 147  AMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYV 186



 Score = 44.1 bits (103), Expect = 4e-07
 Identities = 11/143 (7%), Positives = 26/143 (18%), Gaps = 6/143 (4%)

Query: 1185 AGRFHDSVEL-ARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADL---FWEI 1240
                    EL         +     D  + +      A      G     ++        
Sbjct: 26   QSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHN 85

Query: 1241 Y--QTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTL 1298
                  ++    ++      V   A   M      +  R                     
Sbjct: 86   IARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMEND 145

Query: 1299 ENMAALAAVLRRTGNLERAVKIS 1321
            + M  +  +L +         + 
Sbjct: 146  KAMLIMTMLLAKKVASHAPSLLR 168


>1w3bA [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
          Length = 388

 Score = 64.0 bits (154), Expect = 4e-13
 Identities = 48/362 (13%), Positives = 98/362 (27%), Gaps = 29/362 (8%)

Query: 1056 QDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATL 1115
            Q+  + G  +  + +       +      +   +            G     +   +  +
Sbjct: 28   QEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAI 87

Query: 1116 SVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEAS 1175
              +R  L +  P+ +   + L  AL   G+ + A +     L+     + PD        
Sbjct: 88   EHYRHAL-RLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQ-----YNPDLYCVRSDL 141

Query: 1176 LEFVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAAD 1235
                  L+  GR  ++        +       P+      A           G+   A  
Sbjct: 142  GNL---LKALGRLEEAKACYLKAIE-----TQPNFAV---AWSNLGCVFNAQGEIWLAIH 190

Query: 1236 LFWEIYQTNEMILGPNNPST---LAAVDGYAGSLMEAGDYF-KALRYQEDNTERIYSLFG 1291
             F +        L PN       L  V   A     A   + +AL    ++     +L  
Sbjct: 191  HFEKAVT-----LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLAC 245

Query: 1292 INHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIXXXXXXXXXXXLR 1351
            + +   L ++A                          +     ++               
Sbjct: 246  VYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHA 305

Query: 1352 SVNRYHEALDLVEKAYRRCAELL---GEDHPHVAAINVNRAVVLRQMGRTEEARVIDERA 1408
                    +   +        L     E  P  AA + N A VL+Q G+ +EA +  + A
Sbjct: 306  DSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEA 365

Query: 1409 LQ 1410
            ++
Sbjct: 366  IR 367



 Score = 45.9 bits (107), Expect = 1e-07
 Identities = 44/277 (15%), Positives = 69/277 (24%), Gaps = 48/277 (17%)

Query: 1120 EKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFV 1179
             K  +T P    A   L       GE   A    E+ + +      P+  +A        
Sbjct: 159  LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-----DPNFLDAYIN---LG 210

Query: 1180 RDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWE 1239
              L+ A  F  +V         Y R L    P         A      G    A D +  
Sbjct: 211  NVLKEARIFDRAVAA-------YLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRR 262

Query: 1240 IYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLE 1299
              +       P+    LA      GS+ EA D +              +      R    
Sbjct: 263  AIELQPHF--PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN 320

Query: 1300 NMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEA 1359
               A+           +A+++  E                          L+   +  EA
Sbjct: 321  IEEAVRL-------YRKALEVFPEFAA---------------AHSNLASVLQQQGKLQEA 358

Query: 1360 LDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMG 1396
                   Y+    +     P  A    N    L++M 
Sbjct: 359  ----LMHYKEAIRI----SPTFADAYSNMGNTLKEMQ 387


>1hz4A [a.118.8.2] MALT REGULATORY PROTEIN
          Length = 366

 Score = 54.2 bits (129), Expect = 3e-10
 Identities = 40/287 (13%), Positives = 76/287 (26%), Gaps = 17/287 (5%)

Query: 1128 ETLRAELYLVRA--LRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFV-RDLRY 1184
            +T+ AE   +RA    N G      +  ER+ ++  E+  P    +   +   +   L  
Sbjct: 8    DTMHAEFNALRAQVAINDGN----PDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHC 63

Query: 1185 AGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTN 1244
             G    S+ L + T    R+         + +    +  L   G  + A +   + +Q  
Sbjct: 64   KGELTRSLALMQQTEQMARQH--DVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLI 121

Query: 1245 EMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAAL 1304
                    P     V   A  L       +A        E + S         L  +   
Sbjct: 122  NEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQC 181

Query: 1305 AAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVE 1364
            +       N    +     +    K      S                  +         
Sbjct: 182  SLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVR--------VIYWQMTGDKAAAA 233

Query: 1365 KAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERALQV 1411
               R  A+    ++  +     N A     +G  E A ++ E   + 
Sbjct: 234  NWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNEN 280



 Score = 44.9 bits (105), Expect = 2e-07
 Identities = 37/312 (11%), Positives = 73/312 (23%), Gaps = 15/312 (4%)

Query: 1101 RGEHSDSKQLAEATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRIL 1160
            +GE + S  L + T  + R+         L + +     L   G  + A+E  E+  +++
Sbjct: 64   KGELTRSLALMQQTEQMARQH--DVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLI 121

Query: 1161 TEQHGPDSEEALEASLEFVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVY 1220
             EQH               + L    R  ++           R  +            + 
Sbjct: 122  NEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEAS-------ARSGI-EVLSSYQPQQQLQ 173

Query: 1221 AYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQE 1280
              A+L+     R               L  N       +       +             
Sbjct: 174  CLAMLIQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYWQMTGDKAAAA 233

Query: 1281 DNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKD-RFGEDSMIX 1339
            +           N+         +A      G  E A  +  E+    +  R   D    
Sbjct: 234  NWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARSLRLMSD---L 290

Query: 1340 XXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAEL-LGEDHPHVAAINVNRAVVLRQMGRT 1398
                           R  +A  ++  A +                    +   L Q+   
Sbjct: 291  NRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQLIQLNTL 350

Query: 1399 EEARVIDERALQ 1410
             E      + + 
Sbjct: 351  PELEQHRAQRIL 362



 Score = 43.0 bits (100), Expect = 8e-07
 Identities = 26/155 (16%), Positives = 51/155 (32%), Gaps = 5/155 (3%)

Query: 1266 LMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVW 1325
             +  G+  +A R  +   E +   +  +          L  VL   G L R++ +  +  
Sbjct: 22   AINDGNPDEAERLAKLALEELPPGWFYSRIVATSV---LGEVLHCKGELTRSLALMQQTE 78

Query: 1326 RETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAIN 1385
            +  +    +               L +      A +  EKA++   E   E  P    + 
Sbjct: 79   QMARQH--DVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLV 136

Query: 1386 VNRAVVLRQMGRTEEARVIDERALQVLTDRLGEYH 1420
              RA +L    R +EA       ++VL+    +  
Sbjct: 137  RIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQ 171


>2a5yB3 [c.37.1.20] CED-4 B:109 -- 385
          Length = 275

 Score = 53.1 bits (127), Expect = 7e-10
 Identities = 37/197 (18%), Positives = 74/197 (37%), Gaps = 31/197 (15%)

Query: 697 GDIPPRNALFTGRDDLILRLREQL--RSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFR 754
           G++P +   +  R+  + R+ ++L      +   +    L G  G GK+ +A++      
Sbjct: 14  GNVPKQMTCY-IREYHVDRVIKKLDEMCDLDSFFLF---LHGRAGSGKSVIASQ-ALSKS 68

Query: 755 D-----EYDLVWWVRGGQTHQIHEAYTLLAQELDVFRDNTSIN--STIHSVREALRR--- 804
           D      YD + W++   T             L +  ++  +N  S  H     L+R   
Sbjct: 69  DQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMIC 128

Query: 805 ----GKPRSRWLLIFDDVRQPDDIMRYLPIAGPGH--VIITTRN--LTWPEGGYFKTLPV 856
                +P +  L +FDDV Q +     +  A       ++TTR+  ++       + + V
Sbjct: 129 NALIDRPNT--LFVFDDVVQEET----IRWAQELRLRCLVTTRDVEISNAASQTCEFIEV 182

Query: 857 EVFSLQESVALLSKCGL 873
               + E    L   G+
Sbjct: 183 TSLEIDECYDFLEAYGM 199


>1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70) A:1
            -- 450
          Length = 450

 Score = 48.3 bits (113), Expect = 2e-08
 Identities = 20/296 (6%), Positives = 48/296 (16%), Gaps = 26/296 (8%)

Query: 1118 WREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLE 1177
                +   A +       +  A+ +L           R            + +       
Sbjct: 169  NTGLVTVLAGQMPADYQTIASAIISLANNPNTVLTFARTT-----GATDFTRQM------ 217

Query: 1178 FVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLF 1237
                + +A       E AR       +     + + I          L+  D       +
Sbjct: 218  --AAVAFASVARQDAENARLMIPSLAQAQ-QLNEDQIQELRDIVAWRLMGNDVTDEQAKW 274

Query: 1238 WEIYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGT 1297
             +                  A+       +      +     ++  E             
Sbjct: 275  RDDAIMRSQSTSLIERRVRMALGTGDRRGLNT-WLARLPMEAKEKDE-WRYWQADLLLER 332

Query: 1298 LENMAALAAVLRRTGNLERAVKI---SGEVWRETKDRFGEDSMIXXXXXXXXXXXLRSVN 1354
                 A          L + ++       V  +      E  +                 
Sbjct: 333  GREAEAKEI-------LHQLMQQRGFYPMVAAQRIGEEYELKIDKAPQNVDSALTQGPEM 385

Query: 1355 RYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERALQ 1410
                 L          +E                A         + +         
Sbjct: 386  ARVRELMYWNLDNTARSEWANLVKSKSKTEQAQLARYAFNNQWWDLSVQATIAGKL 441


>1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
          Length = 458

 Score = 44.7 bits (104), Expect = 2e-07
 Identities = 28/319 (8%), Positives = 54/319 (16%), Gaps = 48/319 (15%)

Query: 1120 EKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILT------------EQHGPD 1167
             +      +   ++L       +    +  Y+                            
Sbjct: 10   RQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQI 69

Query: 1168 SEEALEASLEFVRDLRYAGRFHDSVELARDTRD------RYRRILGPDDPETISASHVYA 1221
            +    +A      +             A              +                 
Sbjct: 70   TTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSS-CSYICQHCLVHLG 128

Query: 1222 YALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQED 1281
                      +A   +          L P+N          A      GD+   + Y   
Sbjct: 129  DIARYRNQTSQAESYYRHA-----AQLVPSNGQPYN---QLAILASSKGDHLTTIFY--- 177

Query: 1282 NTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIXXX 1341
                 Y                L   L +       VK    V    K            
Sbjct: 178  -----YCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGH---- 228

Query: 1342 XXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEA 1401
                    +       +   L EK   +  ELL +     +   V+  V+          
Sbjct: 229  --------VYLSKSLEKLSPLREKLEEQFKELLFQ-KAFNSQQLVHVTVINLFQLHHLRD 279

Query: 1402 RVIDERALQVLTDRLGEYH 1420
               +        D    + 
Sbjct: 280  FSNETEQHTYSQDEQLCWT 298



 Score = 36.6 bits (83), Expect = 7e-05
 Identities = 38/459 (8%), Positives = 90/459 (19%), Gaps = 69/459 (15%)

Query: 1052 KNDPQDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDSKQLA 1111
                       +++  A++          D     +   +   +     +   + + +  
Sbjct: 14   VLKADM---TDSKLGPAEVWTSRQ--ALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQ 68

Query: 1112 EATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEA 1171
              TL    +         ++A L L     +    +   ELC +             +  
Sbjct: 69   ITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSC-----SYICQHC 123

Query: 1172 LEASLEFVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHR 1231
            L   +      RY  +   +          YR       P      +  A      GDH 
Sbjct: 124  L---VHLGDIARYRNQTSQAESY-------YRHAA-QLVPSNGQPYNQLAILASSKGDHL 172

Query: 1232 RAADLFWEIYQTNEMILGPNNPSTLA--------------AVDGY------------AGS 1265
                 +               P+                  V                  
Sbjct: 173  TTIFYYCRSIAVK-----FPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHG 227

Query: 1266 LMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVW 1325
             +      + L    +  E  +           + +  +  +     +  R      E  
Sbjct: 228  HVYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQH 287

Query: 1326 RETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDL------VEKAYRRCAELLGE--- 1376
              ++D     + +                  +   +                  L     
Sbjct: 288  TYSQDEQLCWTQLLALFMSFLGIL-CKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVF 346

Query: 1377 ---DHPHVAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRLGEYHXXXXXXXXXXXXD 1433
                      I      +L      EE   I    L    +  G                
Sbjct: 347  QEAVVDERQYIWPWLISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKG 406

Query: 1434 FFGLDDVAESVRRDTETLARCRRALSERHPLTLLARRNL 1472
                +     +R+  + L    + +++  P  +     +
Sbjct: 407  H--KEGQQRRIRQ--QRLISIGKWIADNQPRLIQCENEV 441


>1a87A [f.1.1.1] COLICIN N
          Length = 297

 Score = 40.6 bits (94), Expect = 4e-06
 Identities = 17/181 (9%), Positives = 42/181 (23%), Gaps = 14/181 (7%)

Query: 1225 LLAGDHRRAADLFWEIY-QTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNT 1283
            L++G   +  +     Y    + +              +  ++    +   +L     N 
Sbjct: 112  LVSGMGDKLGEYLGVKYKNVAKEVANDIKNF-------HGRNIRSYNEAMASLNKVLANP 164

Query: 1284 ERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIXXXXX 1343
            +   +    +             +  + GNL +A K         K     +  I     
Sbjct: 165  KMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFK---VADLAIKVEKIREKSIEGYNT 221

Query: 1344 XXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHP--HVAAINVNRAVVL-RQMGRTEE 1400
                  L  V  +     +   A      +L                 ++    +    +
Sbjct: 222  GNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGIMTISYLSSFID 281

Query: 1401 A 1401
            A
Sbjct: 282  A 282



 Score = 36.8 bits (84), Expect = 6e-05
 Identities = 12/152 (7%), Positives = 39/152 (25%), Gaps = 9/152 (5%)

Query: 1269 AGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRET 1328
            +G   K   Y     + +      + +            +R       ++       +  
Sbjct: 114  SGMGDKLGEYLGVKYKNVAKEVANDIK------NFHGRNIRSYNEAMASLNKVLANPKMK 167

Query: 1329 KDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNR 1388
             ++  +D+++              +    +A  + + A +        +         N 
Sbjct: 168  VNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKI---REKSIEGYNTGNW 224

Query: 1389 AVVLRQMGRTEEARVIDERALQVLTDRLGEYH 1420
              +L ++       V+   A+ +    L    
Sbjct: 225  GPLLLEVESWIIGGVVAGVAISLFGAVLSFLP 256


>1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
          Length = 169

 Score = 40.2 bits (93), Expect = 6e-06
 Identities = 22/148 (14%), Positives = 50/148 (33%), Gaps = 10/148 (6%)

Query: 1264 GSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGE 1323
            GS     D+ +       + ++I  +         E++  +     ++ N E A+K   +
Sbjct: 1    GSGDSHPDFPEDADVDLKDVDKILLIS--------EDLKNIGNTFFKSQNWEMAIKKYTK 52

Query: 1324 VWR-ETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVA 1382
            V R     R   +              + ++      +   + A   C E L  D  +  
Sbjct: 53   VLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTK 112

Query: 1383 AINVNRAVVLRQMGRTEEARVIDERALQ 1410
            A+   RA   + +   ++A    ++A +
Sbjct: 113  ALY-RRAQGWQGLKEYDQALADLKKAQE 139


>1d8dA [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
          Length = 323

 Score = 39.4 bits (90), Expect = 9e-06
 Identities = 33/316 (10%), Positives = 77/316 (24%), Gaps = 25/316 (7%)

Query: 1101 RGEHSDSKQLAEATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRI- 1159
            R E +D   + +        ++   + +      Y    L+     +RA++L    + + 
Sbjct: 15   RAEWADIDPVPQNDGPSPVVQI-IYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELN 73

Query: 1160 ------------LTEQHGPDSEEALEASLEFVRDLRYAGRFHDSVELARDTRDRYRRILG 1207
                        L      D +E +   +  + +     +      +  +      + L 
Sbjct: 74   AANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELE 133

Query: 1208 PDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMI-LGPNNPSTLAAVDGYAGSL 1266
                     +  Y          +       E+   ++++     N S           +
Sbjct: 134  FIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQ---RHFVI 190

Query: 1267 MEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWR 1326
                 Y      + +    +  +  + H  +  N   L  +L+  G           +  
Sbjct: 191  SNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNY--LKGILQDRGLSRYP-----NLLN 243

Query: 1327 ETKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINV 1386
            +  D     S                 N+     D++ KA   C  L  E          
Sbjct: 244  QLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWR 303

Query: 1387 NRAVVLRQMGRTEEAR 1402
                 L+     E   
Sbjct: 304  YIGRSLQSKHSRESDI 319


>2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22 --
            174
          Length = 153

 Score = 36.2 bits (83), Expect = 9e-05
 Identities = 15/133 (11%), Positives = 38/133 (28%), Gaps = 17/133 (12%)

Query: 1269 AGDYFKALRYQEDNTERIYSLFGINHR-GTLENMAALAAVLRRTGNLERAVKISGEVWRE 1327
               Y +AL +     E    +     +   +     LA    +  +  +A+  + +V + 
Sbjct: 37   IVKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKI 96

Query: 1328 TKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVN 1387
             K+                           EA     +   + A L    +P+   I  +
Sbjct: 97   DKNNV--------KALYKLGVANMYFGFLEEAK----ENLYKAASL----NPNNLDIRNS 140

Query: 1388 RAVVLRQMGRTEE 1400
              + + ++    +
Sbjct: 141  YELCVNKLKEARK 153



 Score = 33.5 bits (76), Expect = 6e-04
 Identities = 10/56 (17%), Positives = 19/56 (33%), Gaps = 1/56 (1%)

Query: 1354 NRYHEALDLVEKAYRRCAEL-LGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERA 1408
             +Y EALD          ++ L +      + N+N A    +     +A     + 
Sbjct: 38   VKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKV 93


>1fchA [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
          Length = 302

 Score = 36.1 bits (81), Expect = 9e-05
 Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 3/63 (4%)

Query: 1350 LRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERAL 1409
              ++  + EA++   +A     +  G    ++ +      + L  +G+++     D R L
Sbjct: 235  CINLGAHREAVEHFLEALNMQRKSGGAMSENIWS---TLRLALSMLGQSDAYGAADARDL 291

Query: 1410 QVL 1412
              L
Sbjct: 292  STL 294


>2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129
          Length = 126

 Score = 35.4 bits (81), Expect = 1e-04
 Identities = 5/61 (8%), Positives = 14/61 (22%), Gaps = 7/61 (11%)

Query: 1350 LRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERAL 1409
               VN     + ++            E             +   ++G    A+   +   
Sbjct: 49   STDVNDERLGVKILTDI-------YKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLF 101

Query: 1410 Q 1410
            +
Sbjct: 102  E 102


>2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111
          Length = 104

 Score = 35.3 bits (81), Expect = 2e-04
 Identities = 8/45 (17%), Positives = 16/45 (35%)

Query: 1376 EDHPHVAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRLGEYH 1420
              +   A    ++A    + G  EEA  + + A+Q     +    
Sbjct: 5    SPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEA 49


>2hr2A1 [a.118.8.8] HYPOTHETICAL PROTEIN A:2 -- 157
          Length = 156

 Score = 34.7 bits (78), Expect = 2e-04
 Identities = 23/124 (18%), Positives = 39/124 (31%), Gaps = 7/124 (5%)

Query: 1304 LAAVLRRTGNLERAVK-------ISGEVWRETKDRFGEDSMIXXXXXXXXXXXLRSVNRY 1356
             A      G  + A         IS     E                      LRS +  
Sbjct: 15   DAQRQLVAGEYDEAAANCRRAXEISHTXPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEA 74

Query: 1357 HEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERALQVLTDRL 1416
              + D     + R  EL  ++     +   +RA+ L  +GR  EA    ++ ++ + +R 
Sbjct: 75   LHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAXPEFKKVVEXIEERK 134

Query: 1417 GEYH 1420
            GE  
Sbjct: 135  GETP 138



 Score = 33.6 bits (75), Expect = 5e-04
 Identities = 25/157 (15%), Positives = 38/157 (24%), Gaps = 15/157 (9%)

Query: 1127 PETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAG 1186
                   L   +     GE   A   C R   I       ++ +           L  A 
Sbjct: 6    VVGAYLALSDAQRQLVAGEYDEAAANCRRAXEISHTXPPEEAFDHAGFDAFCHAGLAEAL 65

Query: 1187 RFHDSVELARDTRDRYR-------RILGPDDPETISASHVYAYALLLAGDHRRAADLFWE 1239
                S + A  + D+          +   +    ISA +  A AL   G    A   F +
Sbjct: 66   AGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAXPEFKK 125

Query: 1240 IYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKAL 1276
            + +                  G       A D    L
Sbjct: 126  VVEXI-----EERK---GETPGKERXXEVAIDRIAQL 154


>1ouvA [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
          Length = 265

 Score = 34.3 bits (77), Expect = 3e-04
 Identities = 7/61 (11%), Positives = 13/61 (21%), Gaps = 8/61 (13%)

Query: 1350 LRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERAL 1409
                  + +A    EKA         +   +    N+       Q       +     A 
Sbjct: 12   SYKEKDFTQAKKYFEKAC--------DLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAK 63

Query: 1410 Q 1410
             
Sbjct: 64   A 64


>1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
           COIL(x) 65]
          Length = 357

 Score = 33.6 bits (77), Expect = 5e-04
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 708 GRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYR 752
           GRD+ I   R  ++      +  P VL G PG+GKT +      R
Sbjct: 26  GRDEEI---RRVIQILLRRTKNNP-VLIGEPGVGKTAIVEGLAQR 66


>3ck7A1 [a.118.8.6] SUSD A:42 -- 551
          Length = 496

 Score = 33.4 bits (74), Expect = 6e-04
 Identities = 21/203 (10%), Positives = 35/203 (17%), Gaps = 34/203 (16%)

Query: 1210 DPETISASHVYAYALL-LAGDHRRAADLFWEIYQTNEMI-LGPNNPSTLAAVDGYAGSLM 1267
              E  S  +   +    L  D    A    +       I   P++  T      Y     
Sbjct: 17   TDEGESGFYRTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQRTEWV---YVRLGY 73

Query: 1268 EAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRE 1327
            +   Y   L   E  T+          R   E     A       +L            +
Sbjct: 74   DITQYNFFLDQTEGMTDAET------LRQRAEIRFLRALHYWYFLDLFGKAPFKEHFSND 127

Query: 1328 TKDRFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVN 1387
                                        Y    +          E    +         +
Sbjct: 128  LPVEKKGT------------------ELYTYIQN-----ELNEIEADMYEPRQAPFGRAD 164

Query: 1388 RAVVLRQMGRTEEARVIDERALQ 1410
            +A       R      +      
Sbjct: 165  KAANWLLRARLYLNAGVYTGQTD 187


>1wfdA [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
          Length = 93

 Score = 32.7 bits (74), Expect = 0.001
 Identities = 7/67 (10%), Positives = 17/67 (25%), Gaps = 8/67 (11%)

Query: 1350 LRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEARVIDERAL 1409
            L + +RY +AL   ++        +      +       +       +        E   
Sbjct: 25   LDAESRYQQALVCYQEG-------IDMLLQVLKGTK-ESSKRCVLRTKISGYMDRAENIK 76

Query: 1410 QVLTDRL 1416
            + L    
Sbjct: 77   KYLDQEK 83


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.319    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0637    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 20,857,653
Number of extensions: 1485262
Number of successful extensions: 7767
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 7571
Number of HSP's successfully gapped: 305
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)