RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ55755.1 tfus0 AAZ55755.1 GIB00263CH01 "conserved
hypothetical protein"
         (388 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1dhpA [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE                          69   1e-14
1fdyA [c.1.10.1] N-ACETYLNEURAMINATE LYASE                             46   9e-08

>1dhpA [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE
          Length = 292

 Score = 68.6 bits (167), Expect = 1e-14
 Identities = 36/276 (13%), Positives = 73/276 (26%), Gaps = 31/276 (11%)

Query: 60  LDWDATLAFRHYLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGV 119
           +   +      Y    G     ++ T      L+    A+++     +      P++ G 
Sbjct: 19  VCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMM-TLDLADGRIPVIAGT 77

Query: 120 GTDHLEPSQATLESVIKAYREQLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLA 179
           G +                        D+G    +  +        S +   + +  +  
Sbjct: 78  GANATA-----------EAISLTQRFNDSGIVGCLTVTPYY--NRPSQEGLYQHFKAIAE 124

Query: 180 DVDRPVILHWLGAVFDPALDGYWGYTXXXXXXXXXXXXXXXXXXRVDGIKVSLLDDTLEV 239
             D P IL+ + +     L                          + GIK +  + T   
Sbjct: 125 HTDLPQILYNVPSRTGCDLL-------------PETVGRLAKVKNIIGIKEATGNLTRVN 171

Query: 240 RLRTLLPDGVRLYTGDDFNYPDLILGDADGHSHXXXXXXXXXXXXXXXXXXXXDDGDTDR 299
           +++ L+ D   L +GDD +  D +     G                        +G    
Sbjct: 172 QIKELVSDDFVLLSGDDASALDFMQLGGHGVIS---VTANVAARDMAQMCKLAAEGHFAE 228

Query: 300 YRALLAPTVPLSRHLFAAPTY-YYKTGITFVAWLNG 334
            R +    +PL   LF  P     K     +  +  
Sbjct: 229 ARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVAT 264


>1fdyA [c.1.10.1] N-ACETYLNEURAMINATE LYASE
          Length = 292

 Score = 45.7 bits (108), Expect = 9e-08
 Identities = 38/261 (14%), Positives = 70/261 (26%), Gaps = 32/261 (12%)

Query: 59  QLDWDATLAFRHYLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCG 118
            LD  +      +   QG+       +         +   +++    AE       L+  
Sbjct: 18  ALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSEREQVLEI-VAEEGKGKIKLIAH 76

Query: 119 VGTDHLEPSQATLESVIKAYREQLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLL 178
           VG         T ES      +  A  +  G   V   +        S +++   Y  ++
Sbjct: 77  VG------CVTTAESQ-----QLAASAKRYGFDAVSAVTPFYYPF--SFEEHCDHYRAII 123

Query: 179 ADVDR-PVILHWLGAVFDPALDGYWGYTXXXXXXXXXXXXXXXXXXRVDGIKVSLLDDTL 237
              D  P++++ + A+    L                          V  +K +  D   
Sbjct: 124 DSADGLPMVVYNIPALSGVKLT-------------LDQINTLVTLPGVGALKQTSGDLYQ 170

Query: 238 EVRLRTLLPDGVRLYTGDDFNYPDLILGDADGHSHXXXXXXXXXXXXXXXXXXXXDDGDT 297
             ++R   PD V     D+     L+ G ADG                        +GD 
Sbjct: 171 MEQIRREHPDLVLYNGYDEIFASGLLAG-ADG---GIGSTYNIMGWRYQGIVKALKEGDI 226

Query: 298 DRYRALLAPTVPLSRHLFAAP 318
              + L      +   L    
Sbjct: 227 QTAQKLQTECNKVIDLLIKTG 247


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.313    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0498    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 15,533,821
Number of extensions: 1055786
Number of successful extensions: 5447
Number of sequences better than 1.0e-03: 9
Number of HSP's gapped: 5269
Number of HSP's successfully gapped: 166
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)