RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ56050.1 tfus0 AAZ56050.1 GIB00263CH01
"glyceraldehyde-3-phosphate dehydrogenase"
         (335 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1a7kA1 [c.2.1.3] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:1 --...   157   2e-41
1a7kA2 [d.81.1.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:166...   145   9e-38
1r4mA [c.111.1.2] AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1    140   2e-36
1b7gO1 [c.2.1.3] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:1 -- 138 ...   137   1e-35
1r4mB [c.111.1.2] UBIQUITIN-ACTIVATING ENZYME E1C                     126   3e-32
1evjA1 [c.2.1.3] GLUCOSE-FRUCTOSE OXIDOREDUCTASE A:30 -- 160 A:3...   121   2e-30
1k6dA [c.124.1.2] ACETATE COA-TRANSFERASE ALPHA SUBUNIT               119   4e-30
2gyyA2 [d.81.1.1] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:12...   116   5e-29
1mg7A1 [d.14.1.6] EARLY SWITCH PROTEIN XOL-1 2.2K SPLICE FORM A:...   112   5e-28
2hjsA2 [d.81.1.1] USG-1 PROTEIN HOMOLOG A:130 -- 319                   99   4e-24
1b26A1 [c.2.1.7] GLUTAMATE DEHYDROGENASE A:179 -- 412                  97   3e-23
1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM ...    96   5e-23
1b7gO2 [d.81.1.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:139 -- 300     93   7e-22
1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386               83   6e-19
1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 1...    81   2e-18
2gyyA1 [c.2.1.3] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:2 -...    80   5e-18
1e5lA1 [c.2.1.3] SACCHAROPINE REDUCTASE A:2 -- 124 A:392 -- 450        78   1e-17
2nvwA1 [c.2.1.3] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN...    76   5e-17
1bw9A1 [c.2.1.7] PHENYLALANINE DEHYDROGENASE A:149 -- 350              74   3e-16
1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133...    66   5e-14
1dapA1 [c.2.1.3] DIAMINOPIMELIC ACID DEHYDROGENASE A:1 -- 118 A:...    65   1e-13
1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122 ...    64   2e-13
1gpjA2 [c.2.1.7] GLUTAMYL-TRNA REDUCTASE A:144 -- 302                  62   1e-12
1ydwA1 [c.2.1.3] AX110P-LIKE PROTEIN A:6 -- 133 A:305 -- 360           51   2e-09
1arzA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:4 -- 130 A:241 ...    50   4e-09
1o2dA [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING                41   2e-06
2a2pA1 [c.47.1.23] SELENOPROTEIN M A:25 -- 144                         37   4e-05
1gcuA1 [c.2.1.3] BILIVERDIN REDUCTASE A A:1 -- 128 A:247 -- 292        35   1e-04
1xcbA2 [c.2.1.12] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:...    34   2e-04
1jcjA [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE                        34   2e-04
2pv7A2 [c.2.1.6] T-PROTEIN [INCLUDES: CHORISMATE MUTASE (EC A:92...    34   3e-04
1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:71...    34   3e-04
1zh8A1 [c.2.1.3] OXIDOREDUCTASE A:4 -- 131 A:276 -- 328                32   0.001

>1a7kA1 [c.2.1.3] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:1 --
           165 A:335 -- 358
          Length = 189

 Score =  157 bits (398), Expect = 2e-41
 Identities = 71/192 (36%), Positives = 103/192 (53%), Gaps = 23/192 (11%)

Query: 2   TIRVGVNGFGRIGRNFWRAVQA--AGGSDVEIVAVNDLT-DKATLAHLLKYDTVLGTLPG 58
            I+VG+NGFGRIGR  ++A+      G+++++VAV D++ +    A+ +K+DTV G    
Sbjct: 2   PIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKHDTVHGRPKY 61

Query: 59  EVEVGEDSITVGGTTMK---------ALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAK 109
            VE  + S +V    +            AQR+PA LPWG LGVD V+ESTG FT    A+
Sbjct: 62  TVEAVKSSPSVETADVLVVNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLKAE 121

Query: 110 KHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMEN 169
            H+  GAKKV+ISAPA G   T+VMGVN  +Y   +       S  +N  A   + +   
Sbjct: 122 GHIKGGAKKVVISAPASGGAKTIVMGVNQHEY---SPASHHVVSNASNEWAYSHRVV--- 175

Query: 170 FGIVKGLMTTVH 181
                 L+  + 
Sbjct: 176 -----DLVRYMA 182



 Score = 42.4 bits (99), Expect = 8e-07
 Identities = 27/186 (14%), Positives = 44/186 (23%), Gaps = 19/186 (10%)

Query: 148 ILSNASCTTNCVAPMAKTLMENFGIVKGL-----MTTVHAYTNDQVILDYPH-KDLRRAR 201
           +  N       +   A       G    +     M+T   Y   Q+  D  H +      
Sbjct: 5   VGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKHDTVHGRPKYTVE 64

Query: 202 AAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXX 261
           A   +    T                          V        +   +  V       
Sbjct: 65  AVKSSPSVETADVLVVNG-------------HRIKCVKAQRNPADLPWGKLGVDYVIEST 111

Query: 262 XXXXXXXXXXXDILVYTEDPIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWYDNEWGYS 321
                       I    +  ++S+   G   +     +          VV    NEW YS
Sbjct: 112 GLFTDKLKAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSPASHHVVSNASNEWAYS 171

Query: 322 NRLVDL 327
           +R+VDL
Sbjct: 172 HRVVDL 177


>1a7kA2 [d.81.1.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE A:166 --
           334
          Length = 169

 Score =  145 bits (366), Expect = 9e-38
 Identities = 73/169 (43%), Positives = 94/169 (55%), Gaps = 7/169 (4%)

Query: 154 CTTNCVAPMAKTLM-ENFGIVKGLMTTVHAYTNDQVILDYP-HKDLRRARAAAQNIIPTT 211
           CTTNC+AP+   L  ENFGI  GLMTT+H+YT  Q  +D    KD R  RAAA NIIP+T
Sbjct: 1   CTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAAAVNIIPST 60

Query: 212 TGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXX 271
           TGAAKA  +V+P  KGKL G++ RVP PD SV DL     R+ +                
Sbjct: 61  TGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDKAIKKAAQTYM 120

Query: 272 XDILVYTEDPIVSSDIVGTPASCTFDASLTMAF-----GTQVKVVGWYD 315
             IL +T++ +VS+D +    S  +D+  T+           KVV WYD
Sbjct: 121 KGILGFTDEELVSADFINDNRSSVYDSKATLQNNLPGEKRFFKVVSWYD 169


>1r4mA [c.111.1.2] AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1
          Length = 516

 Score =  140 bits (353), Expect = 2e-36
 Identities = 19/219 (8%), Positives = 50/219 (22%), Gaps = 11/219 (5%)

Query: 1   MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV 60
            +  V +      G    + +   G     I+  N ++ +    +     + +G    E 
Sbjct: 24  ESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEA 83

Query: 61  EVGEDSITVGG---TTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAK 117
            +            + ++   +      P       +VV +    + +      L     
Sbjct: 84  AMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQI 143

Query: 118 KVIISAPAKGEDLTVVMGVNDDKY-----DPANHHILSNASCTTNCVAPMAKTLMENFGI 172
            ++I           ++            +      L             +        I
Sbjct: 144 PLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPEL-REHFQSYDHSHTPWI 202

Query: 173 VKGLMTTVHAYTNDQVILDYPHK--DLRRARAAAQNIIP 209
           V         Y+     +   +K  +  R       + P
Sbjct: 203 VIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKP 241


>1b7gO1 [c.2.1.3] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:1 -- 138
           O:301 -- 340
          Length = 178

 Score =  137 bits (346), Expect = 1e-35
 Identities = 26/183 (14%), Positives = 57/183 (31%), Gaps = 15/183 (8%)

Query: 3   IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLT--------DKATLAHLLKYDTVLG 54
           + V VNG+G IG+    A+      D+++V V   +         +  +   +   ++  
Sbjct: 2   VNVAVNGYGTIGKRVADAIIKQP--DMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQSIKK 59

Query: 55  TLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDA 114
                + V    +     T   +    P  +      + + ++    F   E       A
Sbjct: 60  FEESGIPVAGT-VEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGGEK---AEVA 115

Query: 115 GAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIVK 174
                 +    +      +  V++    P  +     AS          +   E+ GI+K
Sbjct: 116 DISFSALCNYNEALGKKYIRVVSESIVVP-ENIDAIRASMKLMSAEDSMRITNESLGILK 174

Query: 175 GLM 177
           G +
Sbjct: 175 GYL 177


>1r4mB [c.111.1.2] UBIQUITIN-ACTIVATING ENZYME E1C
          Length = 418

 Score =  126 bits (317), Expect = 3e-32
 Identities = 22/208 (10%), Positives = 52/208 (25%), Gaps = 2/208 (0%)

Query: 1   MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV 60
            T +V V G G +G    + +  +G   + ++ ++ +         L     +G    EV
Sbjct: 36  DTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEV 95

Query: 61  EVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVI 120
                +  V    +     +             I+V               L +      
Sbjct: 96  AAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYED 155

Query: 121 ISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTV 180
                    + ++ G  +         IL   +    C   +    +         M  +
Sbjct: 156 GVLDPS-SIVPLIDGGTEGFKGN-ARVILPGMTACIECTLELYPPQVNFPMATIASMPRL 213

Query: 181 HAYTNDQVILDYPHKDLRRARAAAQNII 208
             +  + V +    K+         +  
Sbjct: 214 PEHCIEYVRMLQWPKEQPFGEGVPLDGD 241


>1evjA1 [c.2.1.3] GLUCOSE-FRUCTOSE OXIDOREDUCTASE A:30 -- 160 A:323
           -- 381
          Length = 190

 Score =  121 bits (302), Expect = 2e-30
 Identities = 17/204 (8%), Positives = 37/204 (18%), Gaps = 19/204 (9%)

Query: 3   IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAV-NDLTDKATLAHLLKYDTVLGTLPGEVE 61
               + G G+   N      A          V  +      +A     D          +
Sbjct: 3   FGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFD 62

Query: 62  VGEDSITVGGTTMKALAQRDPAQLPWGD-LGVDIVVESTGFFTKAEDAKKHLDAGAKKVI 120
                  +    +                 G  ++ E     + A+  +    A A    
Sbjct: 63  KIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKK 122

Query: 121 ISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTV 180
           +           ++G        +                   K +          +  +
Sbjct: 123 L-----------MIGYRCHYNQFSAQL------DHLAEAVINNKPVRSPGEEGMQDVRLI 165

Query: 181 HAYTNDQVILDYPHKDLRRARAAA 204
            A           + D    R   
Sbjct: 166 QAIYEAARTGRPVNTDWGYVRQGG 189


>1k6dA [c.124.1.2] ACETATE COA-TRANSFERASE ALPHA SUBUNIT
          Length = 217

 Score =  119 bits (300), Expect = 4e-30
 Identities = 20/157 (12%), Positives = 41/157 (26%), Gaps = 9/157 (5%)

Query: 102 FTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAP 161
               +DA      G   ++      G   + ++    +        I ++ +     + P
Sbjct: 5   LMTLQDATGFFRDGMTIMVGGFMGIG-TPSRLVEALLESGVRDLTLIANDTAFVDTGIGP 63

Query: 162 MAKT------LMENFGIVKGLMTTVHAYTNDQVILDYPH-KDLRRARAAAQNIIPTTTGA 214
           +         +  + G        + +   D V++      +  R   A      T TG 
Sbjct: 64  LIVNGRVRKVIASHIGTNPETGRRMISGEMDVVLVPQGTLIEQIRCGGAGLGGFLTPTGV 123

Query: 215 AKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLE 251
                     L GK   L  R    D ++        
Sbjct: 124 GTVEGKQTLTLDGK-TWLLERPLRADLALIRAHRCDT 159


>2gyyA2 [d.81.1.1] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:128
           -- 329
          Length = 202

 Score =  116 bits (290), Expect = 5e-29
 Identities = 15/199 (7%), Positives = 42/199 (21%), Gaps = 37/199 (18%)

Query: 154 CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPH----------KDLRRARAA 203
           C+T  +    + + + +G+ + +++T  A +   +                        A
Sbjct: 1   CSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHA 60

Query: 204 AQNIIPTTTGAAKATALVLPELKG--------------------------KLDGLAMRVP 237
                             LP++                             +    +R+P
Sbjct: 61  EILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIP 120

Query: 238 VPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYTEDPIVSSDIVGTPASCTFD 297
           V       + +  +                     D + +   P   + +          
Sbjct: 121 VLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRI 180

Query: 298 ASLTMAFGTQVKVVGWYDN 316
                     + +    DN
Sbjct: 181 RKDLD-AEKGIHMWVVSDN 198


>1mg7A1 [d.14.1.6] EARLY SWITCH PROTEIN XOL-1 2.2K SPLICE FORM A:14
           -- 187
          Length = 164

 Score =  112 bits (282), Expect = 5e-28
 Identities = 16/172 (9%), Positives = 43/172 (25%), Gaps = 18/172 (10%)

Query: 128 EDLTVVMGVNDDKYDP--ANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTN 185
           E    ++G++  +  P       L+ A  T + +      +     +    +      ++
Sbjct: 1   ERRVKILGIDRSENSPVLTYMSKLAAAPHTVHMMDSGFLAINRQCLVKGKAILAREPKSS 60

Query: 186 DQVILDYPHKDL------RRARAAAQNIIPTTTGAAKATALVLPELKGKLDGLAMRVPVP 239
           ++ ++D   K           R     +                     LD    ++ V 
Sbjct: 61  NEHMIDDLPKHAHDQHTLSILRDFIDQLKLHNVYEINF--------YDPLDSSG-KLAVI 111

Query: 240 DGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYTE-DPIVSSDIVGT 290
              +      L  E                     L     + ++ + + G+
Sbjct: 112 PMLIALWKCMLASETDICDQEVLKSIMNSVIAKFELQIPCKNAVIDATLSGS 163


>2hjsA2 [d.81.1.1] USG-1 PROTEIN HOMOLOG A:130 -- 319
          Length = 190

 Score =   99 bits (248), Expect = 4e-24
 Identities = 23/189 (12%), Positives = 51/189 (26%), Gaps = 29/189 (15%)

Query: 154 CTTN-CVAPMAKTLMENFGIVKGLMTTVHAYTNDQ-------------VILDYPHKDLRR 199
           C     +  +   L+      +  +T   + ++               ++   P +    
Sbjct: 1   CAVAAELCEVLAPLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLF 60

Query: 200 ARAAAQNIIPTT-----TGAAKATALVLPELKG-------KLDGLAMRVPVPDGSVTDLV 247
            R  A N++         G +     +  E++         L+   ++ PV  G    + 
Sbjct: 61  DRQIAFNLLAQVGAVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVT 120

Query: 248 VTLEREVTXXXXXXXXXXXXXXXXXDILVYTEDPIVSSDIVGTPASCTFDASLTMAFGTQ 307
           +     V                  + +   + P V  D +G   +         A   Q
Sbjct: 121 LQCAEPVDLAAVTRVLDATKGI---EWVGEGDYPTVVGDALGQDETYVGRVRAGQADPCQ 177

Query: 308 VKVVGWYDN 316
           V +    DN
Sbjct: 178 VNLWIVSDN 186


>1b26A1 [c.2.1.7] GLUTAMATE DEHYDROGENASE A:179 -- 412
          Length = 234

 Score = 97.1 bits (240), Expect = 3e-23
 Identities = 33/211 (15%), Positives = 55/211 (26%), Gaps = 23/211 (10%)

Query: 1   MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAV-------NDLTDKATLAHLLKYDTVL 53
               V V GFG +G+     +    GS V  V+         +  D   L    K    +
Sbjct: 30  KKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYNPEGFDVEELIRYKKEHGTV 89

Query: 54  GTLPGEVEVGEDSIT--VGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKH 111
            T P    +  + +        + A  +          +    VVE     T  E  +  
Sbjct: 90  VTYPKGERITNEELLELDVDILVPAALEGAIHAGNAERIKAKAVVEGANGPTTPEADEIL 149

Query: 112 LDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFG 171
              G   V       G      + V+  ++      + S           + K +   F 
Sbjct: 150 SRRGILVVPDILANAG-----GVTVSYFEWV---QDLQSFFWDLDQVRNALEKMMKGAFN 201

Query: 172 IV------KGLMTTVHAYTNDQVILDYPHKD 196
            V        +     AY      + Y  K 
Sbjct: 202 DVMKVKEKYNVDMRTAAYILAIDRVAYATKK 232


>1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM A:5
           -- 127 A:268 -- 308
          Length = 164

 Score = 96.2 bits (238), Expect = 5e-23
 Identities = 22/160 (13%), Positives = 43/160 (26%), Gaps = 7/160 (4%)

Query: 3   IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEV 62
           +R+GV G G I +  W  V AA   D  +      T    L     +          +  
Sbjct: 2   LRIGVVGLGGIAQKAWLPVLAAAS-DWTLQGAWSPTRAKALPICESWRIPYADSLSSLAA 60

Query: 63  GEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKK-VII 121
             D++ V  +T               + GV + V+        +  +    A  KK  ++
Sbjct: 61  SCDAVFVHSSTA----SHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLM 116

Query: 122 SAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAP 161
               +   +       +   +       +           
Sbjct: 117 VGFNRRFFVGCARHFIECVQNQT-VPQTAGEQAVLAQRIV 155


>1b7gO2 [d.81.1.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE O:139 -- 300
          Length = 162

 Score = 92.5 bits (230), Expect = 7e-22
 Identities = 16/102 (15%), Positives = 35/102 (34%), Gaps = 8/102 (7%)

Query: 154 CTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPTTTG 213
           C T  +     T+ +   + K   T V    + + +     K    +       +P+   
Sbjct: 1   CNTTALLRTICTVNKVSKVEKVRATIVRRAADQKEV----KKGPINSLVPDPATVPSHHA 56

Query: 214 AAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVT 255
             K    V+  L   +  +A+  P     +  + +TL+ +V 
Sbjct: 57  --KDVNSVIRNL--DIATMAVIAPTTLMHMHFINITLKDKVE 94


>1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386
          Length = 189

 Score = 82.6 bits (204), Expect = 6e-19
 Identities = 12/129 (9%), Positives = 27/129 (20%), Gaps = 18/129 (13%)

Query: 19  RAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEV--GEDSITVGGT-TMK 75
           R +   G   ++      L                        V   +      GT  + 
Sbjct: 69  RKLLGEGTQVLKTFPGKALEGL-PYTPPYPQAL-----EKGYFVVLADYVSQEDGTGIVH 122

Query: 76  ALAQRDPAQLPWG---DLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTV 132
                    L       L +   V+  G          +     + ++     +G     
Sbjct: 123 QAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFREANRAILRDLRGRG----- 177

Query: 133 VMGVNDDKY 141
            +   ++ Y
Sbjct: 178 -LLFKEESY 185


>1nvmB1 [c.2.1.3] ACETALDEHYDE DEHYDROGENASE (ACYLATING) B:1 -- 131
           B:287 -- 312
          Length = 157

 Score = 80.6 bits (198), Expect = 2e-18
 Identities = 21/170 (12%), Positives = 46/170 (27%), Gaps = 31/170 (18%)

Query: 2   TIRVGVNGFGRIGRNFWRAVQAAGGS--DVEIVAVNDLTDKATLAHLLKYDTVLGTLPGE 59
            ++V + G G IG +    V           +V ++  +D    A  +   T    +   
Sbjct: 4   KLKVAIIGSGNIGTDLMIKVLRNAKYLEMGAMVGIDAASDGLARAQRMGVTTTYAGV--- 60

Query: 60  VEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKV 119
                                +          +D V ++T      ++      A     
Sbjct: 61  ---------------------EGLIKLPEFADIDFVFDATSASAHVQNEALLRQAKPGIR 99

Query: 120 IISAPAKGEDLTVVMGVN-DDKYDPANHHILSNASCTT----NCVAPMAK 164
           +I           V  VN ++     N ++++ A          +A   +
Sbjct: 100 LIDLTPAAIGPYCVPVVNLEEHLGKLNVNMVTYAGNLDIMTSAALATAER 149


>2gyyA1 [c.2.1.3] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE A:2 --
           127 A:330 -- 357
          Length = 150

 Score = 79.6 bits (196), Expect = 5e-18
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 16/116 (13%)

Query: 59  EVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKK 118
            ++  +  IT+  TT  A              GVDI + S G  T A+ A   + AG   
Sbjct: 39  SLKFKDQDITIEETTETAFE------------GVDIALFSAGSSTSAKYAPYAVKAGVVV 86

Query: 119 VIISAPAKGED--LTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGI 172
           V  ++  +       VV  VN    D  ++ I++  +   N V  +A+TL E   +
Sbjct: 87  VDNTSYFRQNPDVPLVVPEVNAHALDA-HNGIIACPNAAWNSV-QIAETLHERGLV 140


>1e5lA1 [c.2.1.3] SACCHAROPINE REDUCTASE A:2 -- 124 A:392 -- 450
          Length = 182

 Score = 78.5 bits (191), Expect = 1e-17
 Identities = 24/177 (13%), Positives = 41/177 (23%), Gaps = 2/177 (1%)

Query: 4   RVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVG 63
            V + G G + R     +  +G          +   K +          L          
Sbjct: 4   SVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDA 63

Query: 64  EDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISA 123
           E +      ++                   +V  S       E  +   DAG   +    
Sbjct: 64  EVAKHDLVISLIPYTFHATVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG 123

Query: 124 PAKGEDLTVVMGVNDDKYDPANH--HILSNASCTTNCVAPMAKTLMENFGIVKGLMT 178
            +    L  V      K+            A   +    P+ K L E +GI      
Sbjct: 124 YSAMAKLVGVPCAVAVKFVLDGTISDRGVLAPMNSKINDPLMKELKEKYGIECKEKV 180


>2nvwA1 [c.2.1.3] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
           A:2 -- 154 A:374 -- 457
          Length = 219

 Score = 76.2 bits (186), Expect = 5e-17
 Identities = 28/223 (12%), Positives = 54/223 (24%), Gaps = 30/223 (13%)

Query: 2   TIRVGVNGFGRIGRNFWRAVQAAG---GSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPG 58
            IRVG  G         +    A     S  +IVA+ + T K++L  + +          
Sbjct: 16  PIRVGFVGLTSGKSWVAKTHFLAIQQLSSQFQIVALYNPTLKSSLQTIEQLQL------- 68

Query: 59  EVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKK 118
                           K     D  +       +D++V S       E  K  L+  ++ 
Sbjct: 69  ----------------KHATGFDSLESFAQYKDIDMIVVSVKVPEHYEVVKNILEHSSQN 112

Query: 119 VIISAPAKGEDLTV-VMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENF-GIVKGL 176
           + +        L   V    +          L    C       +   ++  +  I    
Sbjct: 113 LNLRYLYVEWALAASVQQAEELYSISQQRANLQTIICLQGRYNSVVGNILRIYESIADYH 172

Query: 177 MTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPTTTGAAKATA 219
                               +   R    + +  +    K   
Sbjct: 173 FLKFDKQGFRFEGFPTFKDAIILHRLI--DAVFRSDKEEKTLD 213


>1bw9A1 [c.2.1.7] PHENYLALANINE DEHYDROGENASE A:149 -- 350
          Length = 202

 Score = 73.5 bits (180), Expect = 3e-16
 Identities = 12/140 (8%), Positives = 29/140 (20%), Gaps = 24/140 (17%)

Query: 47  LKYDTVLGTLPGEVEVGEDSITVGGTTM-KALAQRDPAQLPWGDLGVDIVVESTGFFTKA 105
            +       L       ED ++                      L   +V  +       
Sbjct: 60  TERVAHAVALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIAD 119

Query: 106 EDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKT 165
           E A   L     + I+ AP    +    + +   +    +  ++                
Sbjct: 120 EAASDIL---HARGILYAPDFVANAGGAIHLVGREVLGWSESVVHE-------------- 162

Query: 166 LMENFGIVKGLMTTVHAYTN 185
                     +  T++    
Sbjct: 163 ------RAVAIGDTLNQVFE 176


>1brmA1 [c.2.1.3] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE A:1 -- 133
           A:355 -- 367
          Length = 146

 Score = 66.4 bits (160), Expect = 5e-14
 Identities = 13/142 (9%), Positives = 36/142 (25%), Gaps = 3/142 (2%)

Query: 29  VEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWG 88
           V  +    +     +  +++       +               +          A     
Sbjct: 4   VGFIGWRGMVGSVLMQRMVEERDF-DAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEA 62

Query: 89  DLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGV--NDDKYDPANH 146
              +DI+V   G     E   K  ++G +   I A +        + +    ++    + 
Sbjct: 63  LKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDG 122

Query: 147 HILSNASCTTNCVAPMAKTLME 168
                 +       P+ + L +
Sbjct: 123 LNNGIRTFVGGAAEPLRRMLRQ 144


>1dapA1 [c.2.1.3] DIAMINOPIMELIC ACID DEHYDROGENASE A:1 -- 118 A:269
           -- 320
          Length = 170

 Score = 64.9 bits (157), Expect = 1e-13
 Identities = 16/165 (9%), Positives = 40/165 (24%), Gaps = 21/165 (12%)

Query: 1   MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLT-------------------DKA 41
             IRV + G+G +GR+  + +      D+++V +                       D  
Sbjct: 2   TNIRVAIVGYGNLGRSVEKLIAKQP--DMDLVGIFSRRATLDTKTPVFDVADVDKHADDV 59

Query: 42  TLAHLLKYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGF 101
            +  L                            + + +             ++ + STG 
Sbjct: 60  DVLFLCMGSATDIPEQAPKFAQFACTVDTYDNHRDIPRHRQVMNEAATAAGNVALVSTGR 119

Query: 102 FTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDKYDPANH 146
                 + +     A   +      G    + +       +  + 
Sbjct: 120 NPDFTASSQIAFGRAAHRMKQQGQSGAFTVLEVAPYLLSPENLDD 164


>1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122
           A:267 -- 312
          Length = 167

 Score = 64.2 bits (155), Expect = 2e-13
 Identities = 15/122 (12%), Positives = 31/122 (25%), Gaps = 4/122 (3%)

Query: 2   TIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVE 61
           ++++   G G I +  +  V A    D+E+V                  +   T   +V 
Sbjct: 1   SLKIAXIGLGDIAQKAYLPVLAQWP-DIELVLCTRNPKVLGTLATRYRVSATCTDYRDVL 59

Query: 62  VGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVII 121
                                    +  LG+   V+     +  E    +  A      +
Sbjct: 60  QYGVDAVXIHAAT---DVHSTLAAFFLHLGIPTFVDKPLAASAQECENLYELAEKHHQPL 116

Query: 122 SA 123
             
Sbjct: 117 YV 118


>1gpjA2 [c.2.1.7] GLUTAMYL-TRNA REDUCTASE A:144 -- 302
          Length = 159

 Score = 61.9 bits (149), Expect = 1e-12
 Identities = 19/140 (13%), Positives = 38/140 (27%), Gaps = 10/140 (7%)

Query: 4   RVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV--E 61
            V V G G +G+   +++   G   V +VA         LA  L  + V      +    
Sbjct: 26  TVLVVGAGEMGKTVAKSLVDRGVRAV-LVANRTYERAVELARDLGGEAVRFDELVDHLAR 84

Query: 62  VGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVII 121
                                  L   D    I++         E+  ++++    + I 
Sbjct: 85  SDVVVSATAAPHPVIHVDDVREALRKRDRRSPILIIDIANPRDVEEGVENIEDVEVRTID 144

Query: 122 SAPAKGEDLTVVMGVNDDKY 141
                      +   N ++ 
Sbjct: 145 DLRV-------IARENLERR 157


>1ydwA1 [c.2.1.3] AX110P-LIKE PROTEIN A:6 -- 133 A:305 -- 360
          Length = 172

 Score = 51.0 bits (121), Expect = 2e-09
 Identities = 22/123 (17%), Positives = 33/123 (26%), Gaps = 8/123 (6%)

Query: 3   IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEV 62
           IR+GV G   I R   RA       +  I  V   + +   A     +            
Sbjct: 2   IRIGVXGCADIARKVSRA--IHLAPNATISGVASRSLEKAKAFATANN--YPESTKIHGS 57

Query: 63  GEDSITVGGTTMKALAQRDPAQLPWG----DLGVDIVVESTGFFTKAEDAKKHLDAGAKK 118
            E  +         +       + W     + G  I++E        E  K      A  
Sbjct: 58  YESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAXNVTEFDKIVDACEANG 117

Query: 119 VII 121
           V I
Sbjct: 118 VQI 120


>1arzA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:4 -- 130 A:241 --
           273
          Length = 160

 Score = 50.1 bits (118), Expect = 4e-09
 Identities = 30/176 (17%), Positives = 56/176 (31%), Gaps = 26/176 (14%)

Query: 2   TIRVGVNGF-GRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV 60
            IRV + G  GR+GR   +A  A     V++ A  +    + L          G     V
Sbjct: 2   NIRVAIAGAGGRMGRQLIQAALALE--GVQLGAALEREGSSLLGSDAGELAGAGKTGVTV 59

Query: 61  EVGEDSITVGGTTMKALAQRDPAQL---PWGDLGVDIVVESTGFFTKAEDAKKHLDAGAK 117
           +   D++           + +            G  +V+ +TGF    + A +  DA A 
Sbjct: 60  QSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIR--DAAA- 116

Query: 118 KVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIV 173
                      D+ +V   N            + A  +   ++     L +   ++
Sbjct: 117 -----------DIAIVFAANFSMTFA------NGAVRSALWLSGKESGLFDMRDVL 155


>1o2dA [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING
          Length = 359

 Score = 41.2 bits (96), Expect = 2e-06
 Identities = 22/153 (14%), Positives = 42/153 (27%), Gaps = 19/153 (12%)

Query: 106 EDAKKHLD-AGAKKVIISAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAK 164
           +D KK LD       I     +      V    +   + +   ++     +    A    
Sbjct: 47  DDLKKLLDETEISYEIFDEVEENPSFDNVXKAVERYRNDSFDFVVGLGGGSPXDFAKAVA 106

Query: 165 TLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPTT--TGAAKATALVL 222
            L                     + ++  +   +         IPTT  TG+      +L
Sbjct: 107 VL----------------LKEKDLSVEDLYDREKVKHWLPVVEIPTTAGTGSEVTPYSIL 150

Query: 223 PELKGKLDGLAMRVPVPDGSVTDLVVTLEREVT 255
            + +G   G  +  PV          +   E+T
Sbjct: 151 TDPEGNKRGCTLXFPVYAFLDPRYTYSXSDELT 183


>2a2pA1 [c.47.1.23] SELENOPROTEIN M A:25 -- 144
          Length = 120

 Score = 36.8 bits (85), Expect = 4e-05
 Identities = 9/81 (11%), Positives = 20/81 (24%), Gaps = 7/81 (8%)

Query: 45  HLLKYDTVLGTLPGEVEVGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTK 104
            L     +      + E+   S          L+Q            ++ +V+  GF+ K
Sbjct: 41  QLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQ-------MTRDEINALVQELGFYRK 93

Query: 105 AEDAKKHLDAGAKKVIISAPA 125
           +    +               
Sbjct: 94  SAPEAQVPPEYLWAPAKPPEE 114


>1gcuA1 [c.2.1.3] BILIVERDIN REDUCTASE A A:1 -- 128 A:247 -- 292
          Length = 174

 Score = 35.5 bits (81), Expect = 1e-04
 Identities = 12/101 (11%), Positives = 31/101 (30%), Gaps = 10/101 (9%)

Query: 5   VGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGE 64
           VGV   G +     +  ++A    + ++      +    +        L       E+  
Sbjct: 14  VGVGRAGSVRLRDLKDPRSAA--FLNLIGFVSRRELG--SLDEVRQISLEDALRSQEIDV 69

Query: 65  DSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKA 105
             I    ++ +   ++      +   G  ++VE     + A
Sbjct: 70  AYICSESSSHEDYIRQ------FLQAGKHVLVEYPMTLSFA 104


>1xcbA2 [c.2.1.12] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
          A:78 -- 203
          Length = 126

 Score = 34.3 bits (78), Expect = 2e-04
 Identities = 6/49 (12%), Positives = 13/49 (26%), Gaps = 2/49 (4%)

Query: 2  TIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYD 50
             + + G GR+G               E+    D+  +     +    
Sbjct: 3  KWGLCIVGXGRLGSALADYPGFGE--SFELRGFFDVDPEKVGRPVRGGV 49


>1jcjA [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
          Length = 252

 Score = 34.1 bits (77), Expect = 2e-04
 Identities = 17/132 (12%), Positives = 35/132 (26%), Gaps = 13/132 (9%)

Query: 3   IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEV-- 60
           I  G +    +                 + A  +    A +   +  +T        +  
Sbjct: 95  IAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRK 154

Query: 61  ------EVGEDSITVGGTTMKALAQRDPAQLPWGDL-----GVDIVVESTGFFTKAEDAK 109
                 + G D I      +   A  + A++    +        +     G    AEDA+
Sbjct: 155 ASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQ 214

Query: 110 KHLDAGAKKVII 121
           K+L    +    
Sbjct: 215 KYLAIADELFGA 226


>2pv7A2 [c.2.1.6] T-PROTEIN [INCLUDES: CHORISMATE MUTASE (EC A:92 --
           243
          Length = 152

 Score = 33.8 bits (76), Expect = 3e-04
 Identities = 20/122 (16%), Positives = 39/122 (31%), Gaps = 4/122 (3%)

Query: 4   RVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVG 63
            V V G+G++G  F R +  A G  + I+   D     ++        V   +   +E  
Sbjct: 12  IVIVGGYGKLGGLFARYL-RASGYPISILDREDWAVAESILANADVVIVSVPINLTLETI 70

Query: 64  EDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISA 123
           E          +     D   +    L   + V +             + + AK+V++  
Sbjct: 71  ERLKPYLT---ENXLLADLTSVKREPLAKXLEVHTGAVLGLHPXFGADIASXAKQVVVRC 127

Query: 124 PA 125
             
Sbjct: 128 DG 129


>1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
           -- 745
          Length = 136

 Score = 33.7 bits (76), Expect = 3e-04
 Identities = 29/180 (16%), Positives = 47/180 (26%), Gaps = 45/180 (25%)

Query: 3   IRVGVNGF-GRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVE 61
           +RVGV G  G++G    RAV AA   D+ + A  D  D  +L      +           
Sbjct: 1   MRVGVLGAKGKVGTTMVRAVAAAD--DLTLSAELDAGDPLSLLTDGNTE----------- 47

Query: 62  VGEDSITVGGTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVII 121
                                      D G+  VV +TGF  +     +          +
Sbjct: 48  --------VVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSV 99

Query: 122 SAPAKGEDLTVVMGVNDDKYDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVH 181
                                    +  S        V  +A+      G+    +  +H
Sbjct: 100 L---------------------IAPNFTSFVPGVLLAVRRIAERPGLTVGLEP--LLDLH 136


>1zh8A1 [c.2.1.3] OXIDOREDUCTASE A:4 -- 131 A:276 -- 328
          Length = 181

 Score = 32.1 bits (73), Expect = 0.001
 Identities = 11/39 (28%), Positives = 13/39 (33%)

Query: 3  IRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKA 41
          IR+G+ G G   R              EI AV   T   
Sbjct: 4  IRLGIVGCGIAARELHLPALKNLSHLFEITAVTSRTRSH 42


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.329    0.141    0.368 

Gapped
Lambda     K      H
   0.267   0.0466    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 14,505,711
Number of extensions: 1034440
Number of successful extensions: 5346
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 5184
Number of HSP's successfully gapped: 191
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)