RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAZ56646.1 tfus0 AAZ56646.1 GIB00263CH01 "SSU ribosomal protein
S9P"
         (169 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1fjgI [d.14.1.1] 30S RIBOSOMAL PROTEIN S9                             109   6e-27
1rr9A [d.14.1.10] ATP-DEPENDENT PROTEASE LA                            49   6e-09

>1fjgI [d.14.1.1] 30S RIBOSOMAL PROTEIN S9
          Length = 127

 Score =  109 bits (273), Expect = 6e-27
 Identities = 43/124 (34%), Positives = 52/124 (41%), Gaps = 1/124 (0%)

Query: 46  GTGXXXXXXXXXXXXPGTGEWKINGKSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARL 105
           GTG            PG G+  +NG+   EYF   V      EPL  +   G +D +  +
Sbjct: 5   GTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITV 64

Query: 106 NGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKAGFLTRDARKVEXXXXXXXXXXXXPQ 165
            GGG SGQ               +P+  R  LK  GFLTRDAR VE            PQ
Sbjct: 65  RGGGKSGQIDAIKLGIARALVQYNPD-YRAKLKPLGFLTRDARVVERKKYGKHKARRAPQ 123

Query: 166 YSKR 169
           YSKR
Sbjct: 124 YSKR 127


>1rr9A [d.14.1.10] ATP-DEPENDENT PROTEASE LA
          Length = 182

 Score = 49.2 bits (117), Expect = 6e-09
 Identities = 14/113 (12%), Positives = 25/113 (22%), Gaps = 6/113 (5%)

Query: 40  AVGPSLGTGXXXXXXXXXXXXPGTGEWKINGKSLEEYFPN-----KVHQQLIKEPLATLG 94
             G +                PG G+    G   E    +      V +   ++      
Sbjct: 5   VTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPD 64

Query: 95  FEGAYDVFARLNGGGTSGQ-XXXXXXXXXXXXXXMDPEHNRPPLKKAGFLTRD 146
           F    D+   +  G T                  +     R  +   G +T  
Sbjct: 65  FYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLR 117


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0560    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 16,289,267
Number of extensions: 1144383
Number of successful extensions: 5449
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5316
Number of HSP's successfully gapped: 149
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)