# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30472.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAD35418.1  [L=187]
Description: tmar0 AAD35418.1 GIB00025CH01 "orotate phosphoribosyltransferase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-15   60.0   0.6    2.3e-15   59.0   0.4    1.5  1  PF00156  Phosphoribosyl transferase domain
  ------ inclusion threshold ------
          1   11.7   0.1        7.3    8.9   0.0    2.2  1  PF04760  Translation initiation factor IF-2, N-terminal regi
        4.2   10.1   0.2    2.3e+02    4.5   0.0    2.2  2  PF02579  Dinitrogenase iron-molybdenum cofactor
        5.7    9.8   0.2         11    8.8   0.1    1.4  1  PF00582  Universal stress protein family
        5.8    8.6   0.2         11    7.7   0.1    1.3  1  PF11382  Protein of unknown function (DUF3186)
        6.2    8.8   0.1         57    5.6   0.0    2.0  2  PF00809  Pterin binding enzyme
        7.7    8.7   0.6         11    8.2   0.4    1.5  1  PF00107  Zinc-binding dehydrogenase
        9.1    8.5   0.0    1.2e+02    4.9   0.0    2.3  2  PF03020  LEM domain
         13    8.6   0.0         28    7.5   0.0    1.7  1  PF04055  Radical SAM superfamily
         15    7.9   1.7         55    6.0   0.4    2.3  1  PF04423  Rad50 zinc hook motif
         16    6.1   0.0         21    5.7   0.0    1.1  1  PF05977  Bacterial protein of unknown function (DUF894)
         17    7.4   0.0         28    6.7   0.0    1.4  1  PF06434  Aconitate hydratase 2 N-terminus
         17    7.6   0.0         25    7.1   0.0    1.3  1  PF01746  tRNA (Guanine-1)-methyltransferase
         18    7.4   0.0         67    5.5   0.0    1.8  1  PF03572  Peptidase family S41
         19    7.4   0.0         54    6.0   0.0    1.7  1  PF01165  Ribosomal protein S21
         20    7.8   0.0         52    6.4   0.0    1.7  1  PF02780  Transketolase, C-terminal domain
         25    6.0   0.1         54    4.9   0.1    1.5  1  PF00148  Nitrogenase component 1 type Oxidoreductase
         26    6.6   0.6         38    6.1   0.4    1.3  1  PF01884  PcrB family
         29    6.8   1.3         55    5.9   0.4    1.9  1  PF10555  Phospho-N-acetylmuramoyl-pentapeptide-transferase s
         30    7.3   0.0         47    6.6   0.0    1.3  1  PF08029  HisG, C-terminal domain
         50    6.3   0.1         94    5.4   0.0    1.5  1  PF07485  Domain of Unknown Function (DUF1259)
         56    5.9   0.0    1.3e+02    4.8   0.0    1.5  1  PF00690  Cation transporter/ATPase, N-terminus
         57    6.3   0.0    3.8e+02    3.7   0.0    2.2  1  PF06014  Bacterial protein of unknown function (DUF910)
         73    5.5   0.2    1.2e+02    4.9   0.1    1.3  1  PF03854  P-11 zinc finger
         76    5.7   0.1    1.3e+02    5.0   0.1    1.4  1  PF00037  4Fe-4S binding domain
         77    5.9   0.0    1.7e+02    4.9   0.0    1.6  1  PF00023  Ankyrin repeat
         78    5.8   0.1    1.7e+02    4.8   0.1    1.5  1  PF00556  Antenna complex alpha/beta subunit
         98    4.7   0.0    1.6e+02    4.0   0.0    1.3  1  PF02457  DisA bacterial checkpoint controller nucleotide-bin
      1e+02    5.0   0.1    1.4e+02    4.6   0.0    1.2  1  PF01784  NIF3 (NGG1p interacting factor 3)
    1.1e+02    4.8   0.2      3e+02    3.4   0.1    1.7  1  PF10588  NADH-ubiquinone oxidoreductase-G iron-sulfur bindin
    1.1e+02    4.9   0.1    2.1e+02    4.0   0.0    1.4  1  PF09840  Uncharacterized protein conserved in archaea (DUF20
    1.2e+02    5.2   0.1    4.7e+02    3.4   0.0    2.0  1  PF00633  Helix-hairpin-helix motif
    1.3e+02    5.2   1.4      3e+02    4.0   0.9    1.7  1  PF05239  PRC-barrel domain
    1.4e+02    4.1   0.5    2.9e+02    3.1   0.2    1.5  1  PF02581  Thiamine monophosphate synthase/TENI
    1.5e+02    4.7   0.0    3.2e+02    3.6   0.0    1.5  1  PF03681  Uncharacterised protein family (UPF0150)
    1.6e+02    4.2   0.1    3.2e+02    3.2   0.1    1.5  1  PF09970  Conserved Archaeal protein (DUF2204)
    1.6e+02    4.8   0.0    3.2e+02    3.8   0.0    1.4  1  PF07061  Swi5
    1.7e+02    4.9   0.1    2.9e+02    4.2   0.0    1.4  1  PF04347  Flagellar biosynthesis protein, FliO
    1.7e+02    4.2   0.1    4.2e+02    3.0   0.0    1.6  1  PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP bindi
    1.8e+02    3.2   0.0    2.2e+02    2.9   0.0    1.1  1  PF05056  Protein of unknown function (DUF674)
    1.9e+02    4.4   0.9    3.7e+02    3.4   0.6    1.4  1  PF11098  Chlorosome envelope protein C
    2.1e+02    3.5   0.0    2.8e+02    3.1   0.0    1.2  1  PF09839  Uncharacterized protein conserved in bacteria (DUF2
    2.2e+02    4.1   0.3    3.8e+02    3.3   0.2    1.3  1  PF11295  Protein of unknown function (DUF3096)
    3.4e+02    4.0   0.3    6.9e+02    3.1   0.2    1.4  1  PF09463  Opy2 protein
    4.3e+02    4.1   0.1    1.1e+03    2.7   0.0    1.7  1  PF07004  Protein of unknown function (DUF1309)
    4.3e+02    3.4   0.0    6.3e+02    2.9   0.0    1.2  1  PF10467  Peptidase inhibitor clitocypin
      5e+02    3.2   0.1    8.7e+02    2.4   0.1    1.3  1  PF09654  Protein of unknown function (DUF2396)
    6.1e+02    2.8   0.6    1.5e+03    1.5   0.0    1.8  1  PF00013  KH domain
    6.4e+02    2.9   1.0    1.3e+03    1.8   0.7    1.4  1  PF11404  Potassium voltage-gated channel
    6.5e+02    1.7   0.0    9.5e+02    1.2   0.0    1.2  1  PF08584  Ribonuclease P 40kDa (Rpp40) subunit
      1e+03    0.5   0.0    1.4e+03    0.1   0.0    1.1  1  PF03345  Oligosaccharyltransferase 48 kDa subunit beta
    1.8e+03    1.7   1.6    4.1e+03    0.7   1.1    1.5  1  PF08262  Leucophaea maderae tachykinin-related peptide
      2e+03    1.1   0.0      3e+03    0.6   0.0    1.2  1  PF02706  Chain length determinant protein


Domain and alignment annotation for each model:
>> PF00156  Phosphoribosyl transferase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   59.0   0.4   1.2e-18   2.3e-15      12     122 ..      43     137 ..      32     140 .. 0.91

  Alignments for each domain:
  == domain 1    score: 59.0 bits;  conditional E-value: 1.2e-18
                 CCHHHHHHCHHHHCEE..EEEEEC----TTCHHHCCCCCCHCHH-B.TTSS.SEEEECTCCC-EEEEEES-GGGGTTSEEEEEECEE----HHHHHHHC CS
     PF00156  12 eagrllaeklreekgkkdvvvGiargGvplatelaraLglpldlvrvrkssapassetsrkreaailesrpeedlkgkrvliVDDvlatGgTlraaiel 110
                  +g++la++l+++      vvG+a gGv+l +++ar+L++   ++              ++++ +++ +r +    g++v +V+Dv++tGg+++++iel
  AAD35418.1  43 VVGEELAKLLKKYDVET--VVGPAMGGVILSYVVARYLKARSLFA--------------ERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIEL 125
                 57899*****9999988..*********************99987..............789************************************* PP

                 CCT-S..EEEEE CS
     PF00156 111 Lkeagakevgva 122
                 Lke+ga++v v 
  AAD35418.1 126 LKEYGANVVCVG 137
                 *******99885 PP

>> PF04760  Translation initiation factor IF-2, N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0039       7.3      16      40 ..     118     141 ..     115     143 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0039
     PF04760  16 kskeiikkLfkelGievkshsssLd 40 
                 ++ke+i+ L ke+G  v+ + s++d
  AAD35418.1 118 SVKEVIELL-KEYGANVVCVGSIID 141
                 79*******.88******9999999 PP

>> PF02579  Dinitrogenase iron-molybdenum cofactor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.12   2.3e+02      42      65 ..      45      68 ..      30      83 .. 0.86
   2 ?    3.4   0.1      0.28   5.3e+02      37      62 ..     114     139 ..     100     147 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.12
                S-CHHHHHHHT--SEEEES---HH CS
     PF02579 42 ggklaellaaegvdvvivggiGpr 65
                g+ la+ll++ +v++v+  ++G+ 
  AAD35418.1 45 GEELAKLLKKYDVETVVGPAMGGV 68
                7889*****************975 PP

  == domain 2    score: 3.4 bits;  conditional E-value: 0.28
                 TCCCSS-CHHHHHHHT--SEEEES-- CS
     PF02579  37 eegggggklaellaaegvdvvivggi 62 
                   gg+ + + ell++ g++vv vg+i
  AAD35418.1 114 TTGGSVKEVIELLKEYGANVVCVGSI 139
                 45566777888899999999999887 PP

>> PF00582  Universal stress protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.1     0.006        11      74     110 ..     102     138 ..      70     150 .. 0.72

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.006
                 HHTTCCEEEEEEEEESHHHHHHHHHHHTTSSEEEEE- CS
     PF00582  74 aeaggekvevvvlegdpaeaivevaeeenadliVmGs 110
                 +++++ +ve vv++g   ++ +e+ +e++a+ +++Gs
  AAD35418.1 102 PGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGS 138
                 44556666666666666666678889**********8 PP

>> PF11382  Protein of unknown function (DUF3186)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.1    0.0058        11      83     119 ..     103     139 ..     101     143 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.0058
     PF11382  83 gkkValvelpdaddddvdavkelLekAGatvvgritl 119
                 g kVa+ve   ++   v++v elL++ Ga+vv + ++
  AAD35418.1 103 GEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSI 139
                 889****************************977665 PP

>> PF00809  Pterin binding enzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.77   1.5e+03     106     122 ..      46      62 ..      40      89 .. 0.89
   2 ?    5.6   0.0      0.03        57     100     122 ..     115     136 ..     103     144 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.77
                 TTHHHHHHHCT-EEEEE CS
     PF00809 106 eemaklaaeygaavVlm 122
                 ee+akl+++y+++ V+ 
  AAD35418.1  46 EELAKLLKKYDVETVVG 62 
                 799*********98885 PP

  == domain 2    score: 5.6 bits;  conditional E-value: 0.03
                 CES-HHTTHHHHHHHCT-EEEEE CS
     PF00809 100 sglendeemaklaaeygaavVlm 122
                 +g++  +e+++l++eyga vV+ 
  AAD35418.1 115 TGGS-VKEVIELLKEYGANVVCV 136
                 4544.99*************985 PP

>> PF00107  Zinc-binding dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.4     0.006        11      56      94 ..      97     145 ..      28     156 .. 0.79

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.006
                 C......--BSEEEEET-.HHHHHHHHTTS-----EEEE----....EE CS
     PF00107  56 g......kgvdvviecvgagatfeqalkllapgGrvvvvggts....ga 94 
                 g      + v vv + v +g ++++ ++ll++ G  vv+ g      g+
  AAD35418.1  97 GffvkpgEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSIidrsGG 145
                 444445599**********************988777766654355544 PP

>> PF03020  LEM domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.064   1.2e+02       9      24 ..      46      63 ..      39      66 .. 0.82
   2 ?    0.7   0.0       1.3   2.5e+03      13      22 ..     124     133 ..     120     137 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.064
                CCCHHCCCCTT---..-- CS
     PF03020  9 aELrseLrkyGisp..GP 24
                +EL++ L+ky +    GP
  AAD35418.1 46 EELAKLLKKYDVETvvGP 63
                89********99744577 PP

  == domain 2    score: 0.7 bits;  conditional E-value: 1.3
                 HCCCCTT--- CS
     PF03020  13 seLrkyGisp 22 
                 + L+ yG+++
  AAD35418.1 124 ELLKEYGANV 133
                 789*****97 PP

>> PF04055  Radical SAM superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0     0.015        28      73     106 ..      90     136 ..       2     138 .. 0.68

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.015
                 C...............EEEEEEEEEEHCCSHGHHHHHHHHHTTSSEEEE CS
                 x...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF04055  73 a...............lpgirialetngtlpdeeileelaelgvdrvsl 106
                                 ++ ++ +++t g    +e++e+l+e+g ++v +
  AAD35418.1  90 GvmklrrgffvkpgekVAVVEDVVTTGGSV--KEVIELLKEYGANVVCV 136
                 155555556665555445555555555555..9**********998866 PP

>> PF04423  Rad50 zinc hook motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.4     0.029        55      23      34 ..     169     180 ..     165     183 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.029
                 -S-------HHH CS
     PF04423  23 CPvCgrpLdeeh 34 
                 CP+C++ ++ e+
  AAD35418.1 169 CPLCKQGIPAEK 180
                 *******99997 PP

>> PF05977  Bacterial protein of unknown function (DUF894)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.011        21     150     168 ..      57      75 ..      50      84 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.011
     PF05977 150 iaRsvGPAlgGvlvaavga 168
                 +   vGPA+gGv++++v a
  AAD35418.1  57 VETVVGPAMGGVILSYVVA 75 
                 56679**********9866 PP

>> PF06434  Aconitate hydratase 2 N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.015        28      29      73 ..      78     123 ..      74     143 .. 0.75

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.015
     PF06434  29 lHakamlkkraegsletike.lkkkgrevvyvgdvvGtGssRksai 73 
                 l a++++ +r++g ++  +  + k g++v+ v+dvv tG s k  i
  AAD35418.1  78 LKARSLFAERENGVMKLRRGfFVKPGEKVAVVEDVVTTGGSVKEVI 123
                 5666777776666544433324578999************988765 PP

>> PF01746  tRNA (Guanine-1)-methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.013        25      80     116 ..     110     146 ..      78     149 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.013
                 SEEEEE---B----GGGGGG-SEE------------H CS
     PF01746  80 erlvlltgdyegvlervdddkadeyiIGgiVdkggek 116
                 e +v + g   +v+e +++  a+++++G i+d++g k
  AAD35418.1 110 EDVVTTGGSVKEVIELLKEYGANVVCVGSIIDRSGGK 146
                 788999999999*********************9866 PP

>> PF03572  Peptidase family S41
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.035        67     103     126 ..      45      68 ..      44      93 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.035
                 HHHHHHHHHHTT-EEEE------- CS
     PF03572 103 seifagalkdngratlvGertfGk 126
                 +e +a +lk+++  t+vG + +G 
  AAD35418.1  45 GEELAKLLKKYDVETVVGPAMGGV 68 
                 799***************999886 PP

>> PF01165  Ribosomal protein S21
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.029        54      31      43 ..      92     105 ..      87     106 .. 0.75

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.029
                 SSS--.-TTTTTTH CS
     PF01165  31 lrrrr.fyekpsek 43 
                 ++ rr f++kp+ek
  AAD35418.1  92 MKLRRgFFVKPGEK 105
                 455555******98 PP

>> PF02780  Transketolase, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.027        52      60      90 ..     102     132 ..      99     159 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.027
                 HHSEEEEEESSCTEEEEHCHHHHHHHHHSGC CS
     PF02780  60 ktgrlvvveeavkrgGigaevaaalaeegfd 90 
                   +++ vve+ v++gG   ev+++l e g++
  AAD35418.1 102 PGEKVAVVEDVVTTGGSVKEVIELLKEYGAN 132
                 5578889999999**********99995554 PP

>> PF00148  Nitrogenase component 1 type Oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.029        54     271     302 ..     103     138 ..      74     146 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.029
     PF00148 271 gkrvavygg....gdlavalarllkelGmevvaagt 302
                 g +vav+ +    g  +  +++llke+G++vv++g+
  AAD35418.1 103 GEKVAVVEDvvttGGSVKEVIELLKEYGANVVCVGS 138
                 566665554443377888899999999999999986 PP

>> PF01884  PcrB family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.4      0.02        38     147     218 ..      73     144 ..      58     150 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.02
                 .HHCCTT-SEEEEE-.------H.HHHHHHHCC-SSSEEEE-----SHHHHHHHCCC.SSEEEE--HHHH-H CS
     PF01884 147 laakllglrlvYlEaGSGaledvpeevikvkkvledarlivGGGiksaEkAkelvkaGADvivvGnvveekk 218
                 ++a++l+ r ++ E   G+++      +k   ++  ++ +v  G   +E  + l ++GA+v+ vG +++ + 
  AAD35418.1  73 VVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSIIDRSG 144
                 578888888888888888888877777776666666555555555566888888899**********99875 PP

>> PF10555  Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.4     0.029        55       5      12 ..      63      70 ..      63      70 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.029
     PF10555  5 PTMGGvli 12
                P MGGv++
  AAD35418.1 63 PAMGGVIL 70
                89****95 PP

>> PF08029  HisG, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0     0.025        47      44      71 ..     111     138 ..      81     141 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.025
                 EEEE-CCCHHHHHHHHHC---EEEEEEE CS
     PF08029  44 savvpekevaevmdeLkalGAsgIlvlp 71 
                  +v +  +v ev++ Lk+ GA+ + v +
  AAD35418.1 111 DVVTTGGSVKEVIELLKEYGANVVCVGS 138
                 36778899*************9887755 PP

>> PF07485  Domain of Unknown Function (DUF1259)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0      0.05        94      52      86 ..     101     135 ..      65     138 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.05
     PF07485  52 tdggkalvlGdlvlleeEvnpvlsalrkngievta 86 
                 + g+k++v+ d+v +   v++v++ l++ g +v+ 
  AAD35418.1 101 KPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVC 135
                 3466899***********************99986 PP

>> PF00690  Cation transporter/ATPase, N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.068   1.3e+02      24      38 ..     120     134 ..     113     136 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.068
     PF00690  24 deaaerlkkyGpNel 38 
                 +e+ e+lk+yG N++
  AAD35418.1 120 KEVIELLKEYGANVV 134
                 7999*********86 PP

>> PF06014  Bacterial protein of unknown function (DUF910)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0       0.2   3.8e+02       6      18 ..     121     133 ..     118     141 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.2
                 HHHHHHHT----- CS
     PF06014   6 DVqqLLKkfGiiv 18 
                 +V +LLK++G+ v
  AAD35418.1 121 EVIELLKEYGANV 133
                 6899******865 PP

>> PF03854  P-11 zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.063   1.2e+02      36      47 ..     167     178 ..     157     180 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.063
     PF03854  36 erCpiCkkPLPt 47 
                 e Cp+Ck+ +P 
  AAD35418.1 167 EDCPLCKQGIPA 178
                 78*****99996 PP

>> PF00037  4Fe-4S binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.071   1.3e+02       1      12 [.     162     173 ..     162     174 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.071
                 EEEETTTS---T CS
     PF00037   1 vvideekCigCG 12 
                 +v+d+e+C  C+
  AAD35418.1 162 PVYDPEDCPLCK 173
                 689*******97 PP

>> PF00023  Ankyrin repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.089   1.7e+02      15      28 ..     120     133 ..      97     136 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.089
                 HHHHHHHHHTTSST CS
     PF00023  15 levvklLlsqGAdl 28 
                 +ev++lL ++GA++
  AAD35418.1 120 KEVIELLKEYGANV 133
                 589*********98 PP

>> PF00556  Antenna complex alpha/beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1     0.089   1.7e+02       5      22 ..      58      75 ..      57      75 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.089
                HHCCHCCT--TTT-HHHH CS
     PF00556  5 wevhdprvglvllfvffa 22
                ++v+ p +g+v+l +++a
  AAD35418.1 58 ETVVGPAMGGVILSYVVA 75
                68*********9999876 PP

>> PF02457  DisA bacterial checkpoint controller nucleotide-binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.087   1.6e+02      43      68 ..       1      26 [.       1      34 [. 0.85

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.087
                HHHHHT----TT----EEEETTEEEE CS
     PF02457 43 llkelfvkntplhDGAviiregriva 68
                ++ke++ k+ +l+ G +i+++g+  +
  AAD35418.1  1 MIKEILEKTGALMEGHFILSSGKHSS 26
                589*****************987654 PP

>> PF01784  NIF3 (NGG1p interacting factor 3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.073   1.4e+02     164     200 ..     103     139 ..      68     144 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.073
     PF01784 164 gdkdkkvkkvaicaGsGgslieeakkagaDllitgei 200
                 g+k   v+ v  ++Gs +++ie +k++ga ++ +g i
  AAD35418.1 103 GEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSI 139
                 47778899999******************99888865 PP

>> PF10588  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.16     3e+02      13      21 ..     166     174 ..     163     175 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.16
                 ---TTT--- CS
     PF10588  13 pldCltCdk 21 
                 p dC+ C +
  AAD35418.1 166 PEDCPLCKQ 174
                 88*****87 PP

>> PF09840  Uncharacterized protein conserved in archaea (DUF2067)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.11   2.1e+02      99     124 ..     103     128 ..     100     132 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.11
     PF09840  99 gykvevredviktsapleevvevaee 124
                 g+kv v edv++t  +++ev e+++e
  AAD35418.1 103 GEKVAVVEDVVTTGGSVKEVIELLKE 128
                 899*******************9987 PP

>> PF00633  Helix-hairpin-helix motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.25   4.7e+02      19      30 .]      61      72 ..      61      72 .. 0.96

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.25
                ---HHHHHHHHH CS
     PF00633 19 VGpktAeaIlsy 30
                VGp++ ++Ilsy
  AAD35418.1 61 VGPAMGGVILSY 72
                9*********98 PP

>> PF05239  PRC-barrel domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.9      0.16     3e+02      19      41 ..     103     123 ..      99     154 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.16
                 SSB---EEEEEEETTTTEEEEEE CS
     PF05239  19 GeklGkVkDvvidegegdvralv 41 
                 Gek+ +V+Dv + + +g v +++
  AAD35418.1 103 GEKVAVVEDV-VTT-GGSVKEVI 123
                 9*********.888.66665554 PP

>> PF02581  Thiamine monophosphate synthase/TENI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.2      0.16   2.9e+02     152     179 ..     112     139 ..     103     140 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.16
     PF02581 152 vvaiGGitlenvaevleagadgvAvvsa 179
                 vv  GG  +e ++ + e+ga+ v+v s 
  AAD35418.1 112 VVTTGGSVKEVIELLKEYGANVVCVGSI 139
                 7899********************9875 PP

>> PF03681  Uncharacterised protein family (UPF0150)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0      0.17   3.2e+02      21      40 ..     109     128 ..     105     129 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.17
     PF03681  21 lpgcvtqGeTleEAlanakE 40 
                 ++++vt G ++ E+++ +kE
  AAD35418.1 109 VEDVVTTGGSVKEVIELLKE 128
                 6789***********99988 PP

>> PF09970  Conserved Archaeal protein (DUF2204)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1      0.17   3.2e+02       5      27 ..     118     140 ..     114     148 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.17
     PF09970   5 klaevlkklkergvefviiGstv 27 
                  ++ev++ lke+g ++v +Gs +
  AAD35418.1 118 SVKEVIELLKEYGANVVCVGSII 140
                 6899****************976 PP

>> PF07061  Swi5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.17   3.2e+02      37      48 ..     118     129 ..     106     131 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.17
     PF07061  37 tvkrhIklLheY 48 
                  vk+ I+lL+eY
  AAD35418.1 118 SVKEVIELLKEY 129
                 69********** PP

>> PF04347  Flagellar biosynthesis protein, FliO
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0      0.15   2.9e+02      10      36 ..      84     110 ..      71     112 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.15
     PF04347  10 qrarsggalkvvasvalgpkervvlVe 36 
                    r +g +k      + p e+v++Ve
  AAD35418.1  84 FAERENGVMKLRRGFFVKPGEKVAVVE 110
                 4568999*******************8 PP

>> PF02776  Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.22   4.2e+02       3      21 ..      44      62 ..      42      90 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.22
                --HHHHHHHHHTT--EEB- CS
     PF02776  3 gaealvraLkalgvehvfg 21
                ++e l+++Lk+++ve+v+g
  AAD35418.1 44 VGEELAKLLKKYDVETVVG 62
                68889************98 PP

>> PF05056  Protein of unknown function (DUF674)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.12   2.2e+02     418     449 ..      98     129 ..      70     136 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.12
     PF05056 418 GfvkretkflvtDDLiitpknssstisllkkl 449
                  fvk + k+ v +D++ t    +  i llk+ 
  AAD35418.1  98 FFVKPGEKVAVVEDVVTTGGSVKEVIELLKEY 129
                 489*************9999999999999986 PP

>> PF11098  Chlorosome envelope protein C
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.6       0.2   3.7e+02      45      81 ..     107     143 ..     100     148 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.2
     PF11098  45 svvetvagtvgslvdatgigkllgktggvvgetidrv 81 
                 +vve v  t gs+ +   + k +g     vg  idr 
  AAD35418.1 107 AVVEDVVTTGGSVKEVIELLKEYGANVVCVGSIIDRS 143
                 68999999*******99999999*99999******96 PP

>> PF09839  Uncharacterized protein conserved in bacteria (DUF2066)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.15   2.8e+02     160     194 ..     115     149 ..     104     164 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.15
     PF09839 160 wggfvepiaeaSqRYgadavlvvrvsesssgqwrl 194
                 +gg v+++ e+ + Yga+ v v+ + ++s g++++
  AAD35418.1 115 TGGSVKEVIELLKEYGANVVCVGSIIDRSGGKVDF 149
                 6899999********************99898876 PP

>> PF11295  Protein of unknown function (DUF3096)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.2       0.2   3.8e+02      18      26 ..      70      78 ..      68      80 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.2
     PF11295 18 LnyiVAiYL 26
                L y+VA YL
  AAD35418.1 70 LSYVVARYL 78
                99******9 PP

>> PF09463  Opy2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.2      0.36   6.9e+02       8      17 ..     166     175 ..     164     176 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.36
     PF09463   8 apsCPsCasg 17 
                 +  CP C++g
  AAD35418.1 166 PEDCPLCKQG 175
                 568****987 PP

>> PF07004  Protein of unknown function (DUF1309)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0       0.6   1.1e+03       6      20 ..     164     178 ..     164     178 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.6
     PF07004   6 YnpekvtvyksraPa 20 
                 Y+pe+++++k   Pa
  AAD35418.1 164 YDPEDCPLCKQGIPA 178
                 *******98877765 PP

>> PF10467  Peptidase inhibitor clitocypin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.33   6.3e+02      87     133 ..     116     162 ..     102     170 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.33
     PF10467  87 agdpkeyilqlvpstadvyiirapiqrigvdvevgvqqntlvykffp 133
                  g  ke i  l    a+v  + + i+r g  v+ gv  ++l    +p
  AAD35418.1 116 GGSVKEVIELLKEYGANVVCVGSIIDRSGGKVDFGVPFESLLKLDLP 162
                 57789999999999********************9988877665555 PP

>> PF09654  Protein of unknown function (DUF2396)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.46   8.7e+02       1      18 [.     162     178 ..     162     181 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.46
     PF09654   1 pifgpeiqcphcrqtipa 18 
                 p++ pe  cp c+q ipa
  AAD35418.1 162 PVYDPE-DCPLCKQGIPA 178
                 778887.8********98 PP

>> PF00013  KH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0       0.8   1.5e+03      21      31 ..       1      11 [.       1      12 [. 0.94

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.8
                HHHHHHHHHT- CS
     PF00013 21 nIkeIeeetga 31
                +IkeI e+tga
  AAD35418.1  1 MIKEILEKTGA 11
                7*********8 PP

>> PF11404  Potassium voltage-gated channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.7       0.7   1.3e+03       5      17 ..     134     145 ..     132     146 .. 0.77

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.7
     PF11404   5 VCVSSiskGRKsG 17 
                 VCV Si   R +G
  AAD35418.1 134 VCVGSI-IDRSGG 145
                 9****9.666665 PP

>> PF08584  Ribonuclease P 40kDa (Rpp40) subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0       0.5   9.5e+02      47      71 ..       3      29 ..       1      35 [. 0.89

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.5
     PF08584 47 ketYerlG..LqGkpsrfggkkharyv 71
                ke+ e++G  ++G+ + ++gk+ +ryv
  AAD35418.1  3 KEILEKTGalMEGHFILSSGKHSSRYV 29
                89999999889*********9989**9 PP

>> PF03345  Oligosaccharyltransferase 48 kDa subunit beta
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0      0.73   1.4e+03     191     234 ..      96     139 ..      86     141 .. 0.88

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.73
     PF03345 191 taysynpkekeeevedswavGsqlllvsalQarnnARvvfvGss 234
                 +++ ++p ek + ved +++G ++  v  l    +A vv vGs+
  AAD35418.1  96 RGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSI 139
                 56678899999999999999999999999999999999999995 PP

>> PF08262  Leucophaea maderae tachykinin-related peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   1.1       2.2   4.1e+03       1       5 [.      62      66 ..      62      67 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.7 bits;  conditional E-value: 2.2
     PF08262  1 APSMG 5 
                +P+MG
  AAD35418.1 62 GPAMG 66
                7***9 PP

>> PF02706  Chain length determinant protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0       1.6     3e+03      82     123 ..      18      59 ..       5      75 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.6
                 HHHSSSS--EEEEE..........................S- CS
     PF02706  82 ilkSrdvlekvidelnldifpeigaglarlakelqkkltvek 123
                 il S +  +++++   l +fpe g+ + ++ ++l kk+ ve 
  AAD35418.1  18 ILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVET 59 
                 788889999999999999999999999999999999999965 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (187 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       452  (0.0379449); expected 238.2 (0.02)
Passed bias filter:                      439  (0.0368536); expected 238.2 (0.02)
Passed Vit filter:                        53  (0.00444929); expected 11.9 (0.001)
Passed Fwd filter:                        53  (0.00444929); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              53  [number of targets reported over threshold]
# CPU time: 0.19u 0.05s 00:00:00.24 Elapsed: 00:00:00
# Mc/sec: 2124.81
//