# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_30482.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAD36480.1  [L=716]
Description: tmar0 AAD36480.1 GIB00025CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   7.9e-188  627.8   0.6   9.9e-188  627.5   0.4    1.0  1  PF09960  Uncharacterized protein conserved in bacteria (DUF2
  ------ inclusion threshold ------
        0.6   12.1   0.0        1.9   10.5   0.0    1.9  1  PF10096  Uncharacterized protein conserved in bacteria (DUF2
       0.75   12.0   0.0        1.8   10.8   0.0    1.6  1  PF06115  Domain of unknown function (DUF956)
        6.9    9.5   0.0         17    8.2   0.0    1.6  1  PF07157  DNA circulation protein N-terminus
         12    7.8   1.0         29    6.5   0.7    1.6  1  PF12359  Protein of unknown function (DUF3645)
         16    8.3   0.1         40    7.0   0.1    1.7  1  PF03457  Helicase associated domain
         47    5.5   0.0    1.1e+02    4.2   0.0    1.5  1  PF07942  N2227-like protein
         48    7.1   0.0    1.1e+02    6.0   0.0    1.6  1  PF08242  Methyltransferase domain
         59    5.0   0.0         99    4.2   0.0    1.3  1  PF09825  Biotin-protein ligase, N terminal
         77    4.9   0.0    1.3e+02    4.1   0.0    1.2  1  PF05496  Holliday junction DNA helicase ruvB N-terminus
    1.7e+02    4.7   0.0    3.2e+02    3.9   0.0    1.4  1  PF03474  DMRTA motif
    2.2e+02    4.4   0.0    5.5e+02    3.1   0.0    1.6  1  PF01381  Helix-turn-helix
    2.3e+02    3.3   0.0    4.3e+02    2.4   0.0    1.4  1  PF04371  Porphyromonas-type peptidyl-arginine deiminase
    2.7e+02    4.0   0.1      9e+02    2.3   0.0    1.8  1  PF06677  Sjogren's syndrome/scleroderma autoantigen 1 (Autoa
    2.8e+02    4.6   0.0    6.8e+02    3.4   0.0    1.6  1  PF00428  60s Acidic ribosomal protein
    2.9e+02    2.3   0.0    1.2e+03    0.2   0.0    1.6  1  PF03961  Protein of unknown function (DUF342)
    2.9e+02    3.6   0.0      5e+02    2.8   0.0    1.2  1  PF08223  PaaX-like protein C-terminal domain
    6.9e+02    2.4   0.5    1.4e+03    1.5   0.3    1.4  1  PF08085  Entericidin EcnA/B family
    7.2e+02    2.6   0.0      2e+03    1.2   0.0    1.6  1  PF00936  BMC domain
    9.3e+02    2.5   0.0    2.8e+03    1.0   0.0    1.7  1  PF11757  Suppressor of RNA silencing P21-like
    1.3e+03    2.4   3.8    2.7e+03    1.4   2.1    2.0  1  PF08139  Prokaryotic membrane lipoprotein lipid attachment s
    2.1e+03    0.3   0.0    4.5e+03   -0.8   0.0    1.3  1  PF08495  FIST N domain


Domain and alignment annotation for each model:
>> PF09960  Uncharacterized protein conserved in bacteria (DUF2194)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  627.5   0.4  2.2e-191  9.9e-188       1     585 []       8     698 ..       8     698 .. 0.99

  Alignments for each domain:
  == domain 1    score: 627.5 bits;  conditional E-value: 2.2e-191
     PF09960   1 illilflqils..lLlYk................................................................................. 16 
                 il++l+++++s  lLlYk                                                                                 
  AAD36480.1   8 ILVLLAFPFFSktLLLYKgseggygynilswlapepevlgedyefvdvekslpdfedydfvitcyysssmpgakkylkklvdfllnggklfiinnlgaf 106
                 7899*********************************************************************************************** PP

     PF09960  17 ............inlllnklgvsytvgnkkekvfek........tlksakvaknldkyklv................................slfden 63 
                             in+lln+lgvs+++g+++e+vf++        +l+s++v+k++d ++++                                ++f+en
  AAD36480.1 107 edssgdnpslsdINTLLNLLGVSFRYGWRQETVFSYeiedgyliKLPSFPVKKAFDGFEVFssnvkivsyavtkkgkhpvifygpfggmalfdHAFNEN 205
                 *************************************************************************************************** PP

     PF09960  64 nevslei.....................kkqiekileyaklevktvdianevkeeipslldyraviilledlksledeeiknyvenGGnvllieklekk 141
                 +e+++++                     +++i+k++eya++ev+        ++++ +l++yra++i  +d+++le++eik+y+enGG v+l+ +++++
  AAD36480.1 206 GEPVVDLrkivmdivggyrenkvlmldeNHHIRKMFEYALFEVD--------SSRSGVLQKYRAIVI--PDVSFLEEKEIKSYLENGGVVILVGSGTHY 294
                 *******999********99999999999*************99........899********9999..****************************** PP

     PF09960 142 skldkilGiksskekkevkklkidkdlliggkdlyeleeefesslkvildeeskveaitssdktpviWekkegkGkvvvinedllekklrGlllqsise 240
                 ++ +++          e+++l+i++d+++g           e+++ +i+++e+++++it+s+ tpv+W++k++kG++v+++edllek++rG+l+++++e
  AAD36480.1 295 IQGEVV---------LEKENLYIPQDITVG-----------ERKVGYIPAPENAKAFITISG-TPVSWMEKREKGAFVFFPEDLLEKWSRGILFNEFLE 372
                 ******.........9**************...........9********************.************************************ PP

     PF09960 241 lldatiypvinaeivYlDDFPlPvysgeaksikreygisdeeFYykvWWkdlkklaeeynikytgvvienYeaktkppfsfveqkntdefilflkeLl. 338
                 ++d++i+p++na++v+lDDFPlP+y +e++++    g++de FYyk+WW+d+k+l+e+++ik++++++++Ye+kt+++  f+e++++d+++++lk+L+ 
  AAD36480.1 373 ASDFVISPMVNAFSVFLDDFPLPAYGIEYDIL----GTTDEIFYYKIWWRDMKELCEDFSIKPITALVTSYEQKTDYN-GFFEFLEKDSSLKVLKNLIe 466
                 ******************************99....*****************************************9.*******************9 PP

     PF09960 339 kskgeigiHGYNHlpllkendyvdeaeyktWkdkeelekalkelkkflkslfekaelkvYvaPsNiidkeGveallkalPeiktigstYtssdskseyv 437
                 ++++++giHGYNH+p+++en          W d eel ka+k+l++fl++l++++e++++vaP+N id++G+e+l++++P+ik+ig++Y+ +ds++e  
  AAD36480.1 467 DERVDTGIHGYNHVPPKSEN----------W-DLEELGKAYKSLRIFLSQLSSSYEPVAFVAPNNEIDQAGIEVLKSVFPTIKVIGTAYSLKDSTGE-- 552
                 99******************..........*.**************************************************************887.. PP

     PF09960 438 qeFevledgiielPRitsGyypldelllttvselnnlgvfqhFlHPDDvldedRn.anksWeellkalrkflkkikkkyPylrnqtssEaaeavkeylt 535
                   F++l+d++i lPR+tsG+ypl++ll++tvs+l nlg+++hF+HPDDv++ dRn +++sW+e++++lr+f++++k++yP+lrn++s+E+++++k+y++
  AAD36480.1 553 --FTLLDDALI-LPRTTSGCYPLQRLLMETVSTLLNLGTYHHFSHPDDVISLDRNpERYSWNEMFDQLRSFFRIMKENYPWLRNMDSKELYNTFKDYFE 648
                 ..********9.*************************************************************************************** PP

     PF09960 536 lkveikykdnkleidlenfeekaklllrrnkgevkvkgGkiikldsdlyl 585
                 +k++i y+d+k+ i+l++++e+++++++++kg+v+v+gG+i+++d+dl++
  AAD36480.1 649 NKPRILYHDKKIVIVLPRTAELPRYFFLKAKGDVNVHGGVILFRDKDLCV 698
                 ************************************************97 PP

>> PF10096  Uncharacterized protein conserved in bacteria (DUF2334)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.0   0.00043       1.9      70     148 ..     471     537 ..     417     553 .. 0.66

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.00043
     PF10096  70 kIilhGythqyrnevsGegfefwdakadqedsekyakeklekglqiltengiypvafeaPhyaiseesykilekyfsti 148
                   ++hGy h         + e wd ++       +a + l+  l +l ++ ++pvaf aP+ +i++++ ++l++ f+ti
  AAD36480.1 471 DTGIHGYNHVP------PKSENWDLEEL-----GKAYKSLRIFLSQL-SSSYEPVAFVAPNNEIDQAGIEVLKSVFPTI 537
                 45678888888......34466776652.....23334444444444.4579************************998 PP

>> PF06115  Domain of unknown function (DUF956)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.8   0.0   0.00039       1.8      45     103 ..     412     470 ..     401     474 .. 0.83

  Alignments for each domain:
  == domain 1    score: 10.8 bits;  conditional E-value: 0.00039
     PF06115  45 yiqipWeeiksvvadvslk..gkkisrfeiktkkngkflFaskdskkvLkaireyvgadkv 103
                 y +i W ++k++  d s+k     ++ +e kt+ ng f+F  kds   Lk++++ +++++v
  AAD36480.1 412 YYKIWWRDMKELCEDFSIKpiTALVTSYEQKTDYNGFFEFLEKDSS--LKVLKNLIEDERV 470
                 8899*************9933458899****************986..6666666666665 PP

>> PF07157  DNA circulation protein N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0037        17       6      53 ..     454     501 ..     450     511 .. 0.89

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0037
     PF07157   6 qkasfrgVpFlveeeqeevGrrlvkheyPlrdeglvedlGkklrevti 53 
                 +++s +  + l+e+e +++G +  +h  P+ ++ ++e+lGk+ ++ +i
  AAD36480.1 454 KDSSLKVLKNLIEDERVDTGIHGYNHVPPKSENWDLEELGKAYKSLRI 501
                 67888889999******************************9998876 PP

>> PF12359  Protein of unknown function (DUF3645)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.7    0.0065        29      24      33 ..     592     601 ..     590     601 .. 0.93

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0065
     PF12359  24 FsHpDvvIvL 33 
                 FsHpD vI L
  AAD36480.1 592 FSHPDDVISL 601
                 ********87 PP

>> PF03457  Helicase associated domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.1    0.0088        40       2      21 ..     604     623 ..     603     633 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.0088
     PF03457   2 spaddaWeeglaaLrafaae 21 
                 +p++++W+e++++Lr+f + 
  AAD36480.1 604 NPERYSWNEMFDQLRSFFRI 623
                 7999*************875 PP

>> PF07942  N2227-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.024   1.1e+02     153     203 ..      51     104 ..      47     154 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.024
     PF07942 153 dflevykeeeaaesydvvvtcfFiDtaeNvleYletiekvlkpgg...lwiNlG 203
                 +f++v k+  + e+yd v+tc++        +Yl+ +   l +gg   +  NlG
  AAD36480.1  51 EFVDVEKSLPDFEDYDFVITCYYSSSMPGAKKYLKKLVDFLLNGGklfIINNLG 104
                 6888888888899************999999***99999888888653334566 PP

>> PF08242  Methyltransferase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.024   1.1e+02      61      99 .]      58      97 ..      38      97 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.024
     PF08242 61 ldgg.ssfDvvvasnvlhhlkdirevldnirklLkpgGrl 99
                + +  + +D v+ +   + ++  +++l+++ + L +gG+l
  AAD36480.1 58 SLPDfEDYDFVITCYYSSSMPGAKKYLKKLVDFLLNGGKL 97
                2222579*******************************87 PP

>> PF09825  Biotin-protein ligase, N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.022        99      72     128 ..     272     331 ..     264     335 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.022
     PF09825  72 nrkireyvkkGGaylGlCAGgYfgssrveFevgd...pkleVvGkReLkffPgiarGpaf 128
                  ++i++y+++GG  + +  G  +   +v  e+++   p+   vG+R++++ P   +  af
  AAD36480.1 272 EKEIKSYLENGGVVILVGSGTHYIQGEVVLEKENlyiPQDITVGERKVGYIPAPENAKAF 331
                 479*****************************994444455689***9999988777777 PP

>> PF05496  Holliday junction DNA helicase ruvB N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.029   1.3e+02      80     122 ..     204     246 ..     195     250 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.029
                 EE----------HHHHHHC-----EEEETTGGG--HHHHHHHH CS
     PF05496  80 vtsgPvlekagdlaalltnleekdvlfideihrlsraveevly 122
                     Pv++  + +  ++   +e++vl++de h ++++ e  l+
  AAD36480.1 204 ENGEPVVDLRKIVMDIVGGYRENKVLMLDENHHIRKMFEYALF 246
                 55678999999999999999*****************998887 PP

>> PF03474  DMRTA motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.071   3.2e+02       2      14 ..     524     536 ..     523     538 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.071
     PF03474   2 rsPidvLakiFPn 14 
                 +  i+vL+ +FP 
  AAD36480.1 524 QAGIEVLKSVFPT 536
                 677*********6 PP

>> PF01381  Helix-turn-helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.12   5.5e+02      34      54 ..     112     132 ..     109     132 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.12
                 SGSCHHHHHHHHHHCTS-HHH CS
     PF01381  34 rnPsletlkklakaLgvslde 54 
                  nPsl+ +  l++ Lgvs+++
  AAD36480.1 112 DNPSLSDINTLLNLLGVSFRY 132
                 68****************976 PP

>> PF04371  Porphyromonas-type peptidyl-arginine deiminase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0     0.095   4.3e+02     286     309 ..     519     542 ..     511     551 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.095
                 SSTCHHHHHHHHHHHSTTSEEE-E CS
     PF04371 286 gdenDakalevlkklfPerevvgv 309
                 ++e D++ +evlk++fP+ +v+g 
  AAD36480.1 519 NNEIDQAGIEVLKSVFPTIKVIGT 542
                 56789*****************85 PP

>> PF06677  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0       0.2     9e+02      24      33 ..     687     696 ..     685     699 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.2
     PF06677  24 gtpLfrlkdg 33 
                 g++Lfr+kd 
  AAD36480.1 687 GVILFRDKDL 696
                 89*****996 PP

>> PF00428  60s Acidic ribosomal protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.15   6.8e+02      26      44 ..     266     284 ..     237     295 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.15
                 ------------------- CS
     PF00428  26 lvkalegkdikeliangsa 44 
                 +v++le+k+ik++++ng++
  AAD36480.1 266 DVSFLEEKEIKSYLENGGV 284
                 699*************985 PP

>> PF03961  Protein of unknown function (DUF342)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.0      0.27   1.2e+03     229     242 ..     676     689 ..     674     702 .. 0.86

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 0.27
     PF03961 229 ieAggnItikgGii 242
                 ++A+g+++++gG+i
  AAD36480.1 676 LKAKGDVNVHGGVI 689
                 68999999999998 PP

>> PF08223  PaaX-like protein C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.11     5e+02      89     110 ..     485     506 ..     483     523 .. 0.79

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.11
     PF08223  89 elWdldelaeaYrefleefrpl 110
                 e Wdl+el +aY+++   +++l
  AAD36480.1 485 ENWDLEELGKAYKSLRIFLSQL 506
                 78**********9986655555 PP

>> PF08085  Entericidin EcnA/B family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.3       0.3   1.4e+03       1      13 [.       1      13 [.       1      17 [. 0.77

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.3
     PF08085  1 Mkkliililalaa 13
                M+k ++lil+l+a
  AAD36480.1  1 MRKFLLLILVLLA 13
                9**8888888876 PP

>> PF00936  BMC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0      0.43     2e+03      25      46 ..     169     190 ..     168     193 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.43
     PF00936  25 AdVelvglesvsggkvtiiitG 46 
                 ++V++v++ ++++gk  +i+ G
  AAD36480.1 169 SNVKIVSYAVTKKGKHPVIFYG 190
                 89************99999988 PP

>> PF11757  Suppressor of RNA silencing P21-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.61   2.8e+03     105     136 ..     368     399 ..     360     400 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.61
     PF11757 105 tklklvakavieelsrehkLdlseraFpgyGi 136
                  ++  ++  vi+ +++++ + l +   p+yGi
  AAD36480.1 368 NEFLEASDFVISPMVNAFSVFLDDFPLPAYGI 399
                 566789999**********************9 PP

>> PF08139  Prokaryotic membrane lipoprotein lipid attachment site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   2.1      0.59   2.7e+03       1      20 [.       1      13 [.       1      18 [. 0.90

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.59
     PF08139  1 MsespnmmKkilflllallm 20
                M       +k+l+l l+ll+
  AAD36480.1  1 M-------RKFLLLILVLLA 13
                5.......*********985 PP

>> PF08495  FIST N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.8   0.0      0.99   4.5e+03       7      35 ..     514     542 ..     513     545 .. 0.86

  Alignments for each domain:
  == domain 1    score: -0.8 bits;  conditional E-value: 0.99
     PF08495   7 vFvssaydeeaellealrealpgvpvvGc 35 
                 +Fv ++ + + + +e l++ +p ++v+G 
  AAD36480.1 514 AFVAPNNEIDQAGIEVLKSVFPTIKVIGT 542
                 6888888888778999***********96 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (716 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       285  (0.0239255); expected 238.2 (0.02)
Passed bias filter:                      260  (0.0218267); expected 238.2 (0.02)
Passed Vit filter:                        24  (0.00201478); expected 11.9 (0.001)
Passed Fwd filter:                        24  (0.00201478); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              22  [number of targets reported over threshold]
# CPU time: 0.40u 0.06s 00:00:00.46 Elapsed: 00:00:01
# Mc/sec: 3864.43
//