hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_30486.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAD36879.1
Accession:      [none]
Description:    tmar0 AAD36879.1 GIB00025CH01 "conserved hypothetical protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0049530  Nitrogenase accessory factor-like              137.8    6.4e-42   1
0037104  Nitrogenase accessory factor-like              106.2    1.6e-32   1
0049148  Nitrogenase accessory factor-like              110.8    2.7e-32   1
0048713  Nitrogenase accessory factor-like               77.2    3.9e-22   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0037104    1/1       1   123 [.     1   124 []   106.2  1.6e-32
0048713    1/1       1   119 [.     1   123 []    77.2  3.9e-22
0049148    1/1       1   118 [.     1   116 []   110.8  2.7e-32
0049530    1/1       1   124 [.     1   124 []   137.8  6.4e-42

Alignments of top-scoring domains:
0037104: domain 1 of 1, from 1 to 123: score 106.2, E = 1.6e-32
                   *->mkiAvaskdg.gldslvdqhFGrApyFliydveggeiklvevrenpa
                      m iA++++++ g ds++++hFGrApyF+++ v+++ i  ++v enp 
  AAD36879.1     1    MIIAIPVSENrGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENP- 46   

                   leagggagklaaellalegvdavlvggiGpgalekLleagikvyvaaegt
                   l +++ +g   + +++++g+++v+v+giG +a+++++++g+kv+++a+gt
  AAD36879.1    47 LAQDHVHG-AVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGT 95   

                   veealeallaglleeltaalagaghglgeleleglmkiAvaskdgvl....vdqhFGhAerFliyevddggvklv
                             m iA+++++++ ++  +++hFG+A++F+ ++v ++ +  +
  AAD36879.1     1    -------MIIAIPVSENRGkdspISEHFGRAPYFAFVKVKNNAIADI 40   

                   evrelp.kygggedklaarlealsdvdvvlvggiGggaaarLvaagievi
                   +v e+p   ++ ++++++++  ++++++v+v+giG +a+a ++a+g++vi
  AAD36879.1    41 SVEENPlAQDHVHGAVPNFV-KEKGAELVIVRGIGRRAIAAFEAMGVKVI 89   

                   kvaegetieealeallegllgspppwlrkallmkiAvpskgg.gldslvsehFgrApyFliydvedgevklvenrenp
                       m+iA+p+ ++ g ds +sehFgrApyF+++ v+++ +  + + enp
  AAD36879.1     1    -MIIAIPVSENrGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENP 46   

                   ..ggggggalaelllelgvdvvivggiGpgaleaLeaagikvyvgaegtv
                    ++ + +ga++++++e+g+++viv+giG++a++a+ea+g+kv++ga+gtv
  AAD36879.1    47 laQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTV 96   

                   eealeallageleeltallaegMkiAipssdgkgldslvsghFgrApyFliydvedgeielvenlenpl
                      M+iAip+s+++g ds +s+hFgrApyF+++ v+++ i  +++ enpl
  AAD36879.1     1    MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPL 47   

                   aggggggalaelllelgvdvvivggiGegalaaLlaagikvyvgaegtve
                   a  + +ga++++++e+g+++viv+giG++a+aa++a+g+kv++ga+gtve
  AAD36879.1    48 AQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVE 97   

                   ealeallagelteltagcasgghgggg