RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAD35750.1 tmar0 AAD35750.1 GIB00025CH01 "pleiotropic
regulatory protein"
         (377 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3bn1A [x.x.x] PEROSAMINE SYNTHETASE                                   190   4e-51
3dr4C [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE                          187   6e-50
2ctzA [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE                     140   7e-36
3bn1C [x.x.x] PEROSAMINE SYNTHETASE                                   139   2e-35
1b9iA [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)       137   6e-35
3bcxB [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-             136   9e-35
1b9hA [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)       134   4e-34
3bb8A [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE                129   1e-32
3bcxA [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-             126   1e-31
3b8xB [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE            125   3e-31
2cb1A [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE                       123   6e-31
3b8xA [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE            117   5e-29
1dy2A [d.169.1] COLLAGEN ALPHA1(XV) CHAIN                             111   4e-27
2c81A [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE                        110   5e-27
3dr4B [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE                          108   2e-26
2c7tA [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE                        108   3e-26
3bn1D [x.x.x] PEROSAMINE SYNTHETASE                                   108   3e-26
3dr7B [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE                          107   8e-26
1cl1A [c.67.1] CYSTATHIONINE BETA-LYASE                               103   1e-24
2btwB [x.x.x] ALR0975 PROTEIN                                         100   8e-24
1cl1B [c.67.1] CYSTATHIONINE BETA-LYASE                                97   8e-23
3dr4A [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE                           96   1e-22
3dr4D [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE                           93   1e-21
1e5eB [c.67.1] METHIONINE GAMMA-LYASE                                  92   2e-21
1cj0B [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)               91   4e-21
2btwA [x.x.x] ALR0975 PROTEIN                                          91   4e-21
1cs1A [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)                  89   2e-20
2a7vA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE                          87   1e-19
3ecdC [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2                        86   1e-19
2aeuA [x.x.x] HYPOTHETICAL PROTEIN MJ0158                              85   3e-19
1c4kA [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)    84   6e-19
3bh1C [x.x.x] UPF0371 PROTEIN DIP2346                                  83   1e-18
1dfoA [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE                         83   1e-18
3bcaA [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE            83   1e-18
3e77B [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE                           83   2e-18
3d19E [x.x.x] CONSERVED METALLOPROTEIN                                 83   2e-18
1cj0A [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)               82   2e-18
1e5eA [c.67.1] METHIONINE GAMMA-LYASE                                  82   3e-18
3ecdD [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2                        81   6e-18
1dfoB [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE                         79   2e-17
3d19A [x.x.x] CONSERVED METALLOPROTEIN                                 79   2e-17
2dkjA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE                          77   8e-17
1c8nA [b.121.4] COAT PROTEIN                                           77   1e-16
3ecdB [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2                        77   1e-16
2dgmE [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA                    76   2e-16
2dgmC [x.x.x] GLUTAMATE DECARBOXYLASE BETA                             76   2e-16
3e6gB [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN                   75   4e-16
3ei9A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      75   4e-16
1bw9A [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE                     75   4e-16
3dzzB [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S            74   5e-16
3e6gD [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN                   73   1e-15
3dzzA [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S            73   2e-15
3ecdA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2                        72   2e-15
2douB [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE                       72   2e-15
1c8eA [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID                      71   4e-15
2e7jA [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE                               70   8e-15
2bwoD [x.x.x] 5-AMINOLEVULINATE SYNTHASE                               70   8e-15
3eiaA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      70   1e-14
1djeA [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE                           69   2e-14
2c44B [x.x.x] TRYPTOPHANASE                                            69   2e-14
3dydB [x.x.x] TYROSINE AMINOTRANSFERASE                                69   2e-14
2c44A [x.x.x] TRYPTOPHANASE                                            68   4e-14
1ay4B [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE                    68   4e-14
2bwpB [x.x.x] 5-AMINOLEVULINATE SYNTHASE                               68   4e-14
1bs0A [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)                 68   5e-14
1bj4A [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)               67   6e-14
2dgkA [x.x.x] GLUTAMATE DECARBOXYLASE BETA                             67   8e-14
1ax4A [c.67.1] TRYPTOPHANASE                                           67   8e-14
2bwpA [x.x.x] 5-AMINOLEVULINATE SYNTHASE                               67   9e-14
2ch2A [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE                         67   9e-14
2cstA [c.67.1] ASPARTATE AMINOTRANSFERASE                              66   2e-13
1ay4A [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE                    66   2e-13
3bh1A [x.x.x] UPF0371 PROTEIN DIP2346                                  66   2e-13
2dgmA [x.x.x] GLUTAMATE DECARBOXYLASE BETA                             65   3e-13
1bjwA [c.67.1] ASPARTATE AMINOTRANSFERASE                              65   3e-13
1eghA [c.24.1] METHYLGLYOXAL SYNTHASE                                  65   4e-13
3bs8A [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                 65   4e-13
2ch1A [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE                         65   4e-13
3e9kA [x.x.x] KYNURENINASE                                             64   7e-13
1bqaA [c.67.1] ASPARTATE AMINOTRANSFERASE                              63   1e-12
1eg5B [c.67.1] AMINOTRANSFERASE                                        63   1e-12
3caiA [x.x.x] POSSIBLE AMINOTRANSFERASE                                63   1e-12
1djuA [c.67.1] AROMATIC AMINOTRANSFERASE                               63   2e-12
1ecxB [c.67.1] AMINOTRANSFERASE                                        63   2e-12
2cfbA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                 62   2e-12
3bh1D [x.x.x] UPF0371 PROTEIN DIP2346                                  62   2e-12
1ay5B [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE                    62   4e-12
3d6kD [x.x.x] PUTATIVE AMINOTRANSFERASE                                61   5e-12
1c8fA [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID                      61   5e-12
2dr1B [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE          61   6e-12
1ejiA [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE                         60   8e-12
3ei7B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      60   8e-12
1bkgA [c.67.1] ASPARTATE AMINOTRANSFERASE                              60   8e-12
3bc8A [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE            60   1e-11
2aatA [x.x.x] ASPARTATE AMINOTRANSFERASE                               60   1e-11
2bwnB [x.x.x] 5-AMINOLEVULINATE SYNTHASE                               60   1e-11
2aevA [x.x.x] HYPOTHETICAL PROTEIN MJ0158                              60   1e-11
2eh6A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE                         60   1e-11
2d61A [x.x.x] ASPARTATE AMINOTRANSFERASE                               60   1e-11
3bcbA [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE            60   1e-11
3ei6B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      60   1e-11
2c44C [x.x.x] TRYPTOPHANASE                                            59   2e-11
1aiaA [c.67.1] ASPARTATE AMINOTRANSFERASE                              59   2e-11
1ariA [c.67.1] ASPARTATE AMINOTRANSFERASE                              59   3e-11
1c1dB [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE                   59   3e-11
3cogD [x.x.x] CYSTATHIONINE GAMMA-LYASE                                58   3e-11
1b5pA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                    58   4e-11
1b4xA [c.67.1] ASPARTATE AMINOTRANSFERASE                              58   5e-11
3eiaB [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE                      58   5e-11
3e6gA [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN                   58   6e-11
1eg5A [c.67.1] AMINOTRANSFERASE                                        57   7e-11
1c7nA [c.67.1] CYSTALYSIN                                              57   8e-11
5bj4A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                    56   1e-10
2bwoB [x.x.x] 5-AMINOLEVULINATE SYNTHASE                               56   1e-10
1c1dA [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE                   56   2e-10
7aatA [c.67.1] ASPARTATE AMINOTRANSFERASE                              56   2e-10
3e2yA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3                   55   3e-10
1djuB [c.67.1] AROMATIC AMINOTRANSFERASE                               55   3e-10
1bw0B [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)                     55   3e-10
2dr1A [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE          55   3e-10
1c1xA [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE                   55   4e-10
3cq4A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    55   5e-10
3b46A [x.x.x] AMINOTRANSFERASE BNA3                                    54   6e-10
3a2bA [x.x.x] SERINE PALMITOYLTRANSFERASE                              54   7e-10
3bwnC [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            54   8e-10
1arhA [c.67.1] ASPARTATE AMINOTRANSFERASE                              54   9e-10
2d5yA [x.x.x] ASPARTATE AMINOTRANSFERASE                               54   1e-09
3d6kA [x.x.x] PUTATIVE AMINOTRANSFERASE                                54   1e-09
1b8gA [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE              53   2e-09
1agxA [x.x.x] GLUTAMINASE-ASPARAGINASE                                 52   2e-09
3cogB [x.x.x] CYSTATHIONINE GAMMA-LYASE                                52   2e-09
2egyC [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE                       52   4e-09
2douA [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE                       51   4e-09
3bwnB [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            51   5e-09
3cq5A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE                    51   5e-09
1bw0A [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)                     51   6e-09
3c01F [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS            51   7e-09
3bwnE [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            50   8e-09
3c01E [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS            49   2e-08
3caeA [x.x.x] ENDODEOXYRIBONUCLEASE 1                                  49   2e-08
3d6kC [x.x.x] PUTATIVE AMINOTRANSFERASE                                49   2e-08
2bhxB [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE                           49   3e-08
3d6kB [x.x.x] PUTATIVE AMINOTRANSFERASE                                48   5e-08
5bj3A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)                    47   1e-07
2d3jA [x.x.x] WNT INHIBITORY FACTOR-1                                  47   1e-07
2b34A [x.x.x] MAR1 RIBONUCLEASE                                        46   1e-07
1bxgA [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE                     46   2e-07
1asbA [x.x.x] ASPARTATE AMINOTRANSFERASE                               44   6e-07
1b93B [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)                        44   7e-07
3d19C [x.x.x] CONSERVED METALLOPROTEIN                                 42   3e-06
1ei7A [a.24.5] COAT PROTEIN                                            42   4e-06
2eaaA [x.x.x] 7S GLOBULIN-3                                            41   7e-06
2e7uA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE                 40   9e-06
3d19B [x.x.x] CONSERVED METALLOPROTEIN                                 39   2e-05
3d19D [x.x.x] CONSERVED METALLOPROTEIN                                 38   3e-05
2bylA [x.x.x] ORNITHINE AMINOTRANSFERASE                               38   4e-05
3bwoC [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            38   4e-05
3bwnD [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            38   5e-05
1asfA [x.x.x] ASPARTATE AMINOTRANSFERASE                               37   9e-05
3bwnA [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            36   2e-04
3bwnF [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE                            34   6e-04
3bk2A [x.x.x] METAL DEPENDENT HYDROLASE                                34   8e-04

>3bn1A [x.x.x] PEROSAMINE SYNTHETASE
          Length = 367

 Score =  190 bits (484), Expect = 4e-51
 Identities = 103/364 (28%), Positives = 178/364 (48%), Gaps = 14/364 (3%)

Query: 17  EILNAIDKLISSGNV-ILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKG 75
              + + + + +  +  +G  +   E+  A + GVKH +   +G+ AL +AL AMG+  G
Sbjct: 14  NERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPG 73

Query: 76  DTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFG 135
           D V+    T+ A+A++    GA  + VD D  TFN+D  +LE ++   + KAI+PVHL+G
Sbjct: 74  DEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALI-TPRTKAIMPVHLYG 132

Query: 136 RTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGT 195
           +  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSF    N+ T
Sbjct: 133 QICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FGNIIT 185

Query: 196 YGDGGMIVTNSDEIAEESRILRVHGARK--KYFHEKVGYNSRLDEIHAAILRVKLRYLER 253
            G+GGMI TN D++A + R+LR  G     +Y+   VG+N R+  I AAI   +L  ++ 
Sbjct: 186 TGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDE 245

Query: 254 WTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXX 313
               R RV   Y++        V  P V   G      +                     
Sbjct: 246 HLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDA 305

Query: 314 XGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTI 373
            GI++   +  P+H+   +  L     D  +AE+     L LP    L + +I  V+  +
Sbjct: 306 LGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGVDGLNLPTHAGLTEADIDRVIAAL 362

Query: 374 ALFL 377
              L
Sbjct: 363 DQVL 366


>3dr4C [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
          Length = 368

 Score =  187 bits (474), Expect = 6e-50
 Identities = 107/381 (28%), Positives = 180/381 (47%), Gaps = 18/381 (4%)

Query: 1   MIPLFDLTRQY--ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVAS 58
           +  +  +         R  +L  +D    S     G  +   E+  A + GVKH +   +
Sbjct: 1   LPRI-SVAAPRLDGNERDYVLECMDTTWISSV---GRFIVEFEKAFADYCGVKHAIACNN 56

Query: 59  GSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEH 118
           G+ AL +AL AMG+  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE 
Sbjct: 57  GTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA 116

Query: 119 VLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGS 178
           ++   + KAI+PVHL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS
Sbjct: 117 LI-TPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYR-----GKKSGS 170

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARK--KYFHEKVGYNSRL 236
           +GD A FSFF    + T G+GGMI TN D++A + R+LR  G     +Y+   VG+N R+
Sbjct: 171 LGDCATFSFFGNA-IITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRM 229

Query: 237 DEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXX 296
             I AAI   +L  ++     R RV   Y++        V  P V   G      +    
Sbjct: 230 TNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRL 289

Query: 297 XXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALP 356
                             GI++   +  P+H+   +  L     D  +AE+     L LP
Sbjct: 290 GEGLSTTRDQVIKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGVDGLNLP 346

Query: 357 MFPELRDDEIKEVVDTIALFL 377
               L + +I  V+  +   L
Sbjct: 347 THAGLTEADIDRVIAALDQVL 367


>2ctzA [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
          Length = 421

 Score =  140 bits (353), Expect = 7e-36
 Identities = 55/373 (14%), Positives = 98/373 (26%), Gaps = 42/373 (11%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
             V  LE+ +A+  G K  +  ASG  A  +AL  +  + GD +V+TP  +  T +    
Sbjct: 58  PTVDVLEKRLAALEGGKAALATASGHAAQFLALTTLA-QAGDNIVSTPNLYGGTFNQFKV 116

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLF---GRTVDLEALSFLREKYG 151
              R+    V  ++      +   +   EK +A     +        DLEAL+    + G
Sbjct: 117 TLKRLGIE-VRFTSREERPEEFLALTD-EKTRAWWVESIGNPALNIPDLEALAQAAREKG 174

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPT---------------KNLGTY 196
           V ++ D    MG         +R           S                    N    
Sbjct: 175 VALIVDNTFGMGG------YLLRPLAWGAALVTHSLTKWVGGHGAVIAGAIVDGGNFPWE 228

Query: 197 GDGGMIVTNSDEIAEESRILRVHG----ARKKYFHEKVGYNSRLDEIHAAILRVKLRYLE 252
           G    ++T         R+    G      K            L    A ++ + +  L 
Sbjct: 229 GGRYPLLTEPQPGYHGLRLTEAFGELAFIVKARVDGLRDQGQALGPFEAWVVLLGMETLS 288

Query: 253 RWTEERTRVARTYQKLF--EEKKLPVVYPRVEEKGFRYHVFHQ---------YXXXXXXX 301
              E               + +   V YP +                             
Sbjct: 289 LRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHHPHHDRAQKYFKGKPGAVLTFGLKGGY 348

Query: 302 XXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPEL 361
                             +     L +            +      +S   + L +  E 
Sbjct: 349 EAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEH 408

Query: 362 RDDEIKEVVDTIA 374
            +D   E+ + +A
Sbjct: 409 VEDLKAELKEALA 421


>3bn1C [x.x.x] PEROSAMINE SYNTHETASE
          Length = 364

 Score =  139 bits (349), Expect = 2e-35
 Identities = 102/365 (27%), Positives = 177/365 (48%), Gaps = 14/365 (3%)

Query: 13  RIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
           R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL +AL AMG
Sbjct: 7   RLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMG 66

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPV 131
           +  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE ++   + KAI+PV
Sbjct: 67  IGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALI-TPRTKAIMPV 125

Query: 132 HLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTK 191
           HL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSF    
Sbjct: 126 HLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--FG 178

Query: 192 NLGTYGDGGMIVTNSDEIAEESRILRVHGARK--KYFHEKVGYNSRLDEIHAAILRVKLR 249
           N+ T G+GGMI TN D++A + R+LR  G     +Y+   VG+N R+  I AAI   +L 
Sbjct: 179 NIITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLE 238

Query: 250 YLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXX 309
            ++     R RV   Y++        V  P V   G      +                 
Sbjct: 239 RVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQVIK 298

Query: 310 XXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEV 369
                GI++   +  P+H+   +        D  +AE+     L LP    L + +I  V
Sbjct: 299 DLDALGIESRPVFH-PMHIMPPYA--HLATDDLKIAEACGVDGLNLPTHAGLTEADIDRV 355

Query: 370 VDTIA 374
           +  + 
Sbjct: 356 IAALD 360


>1b9iA [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
          Length = 384

 Score =  137 bits (345), Expect = 6e-35
 Identities = 81/380 (21%), Positives = 146/380 (38%), Gaps = 21/380 (5%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHGVGVASGSDALLIALRA 69
            +      N + + +  G         V   E E A+  G  H + V +G+ AL +AL+ 
Sbjct: 9   PQYDDAERNGLVRALEQGQWWRMGGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQV 68

Query: 70  MGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII 129
           MGV  G  V+   +TF +++ A  RLGA  + VDVD +T+N+D   +   +   + K I+
Sbjct: 69  MGVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAV-TPRTKVIM 127

Query: 130 PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFP 189
           PVH+ G   D++AL+ +    GV +L+D A + G+ W+      ++ G +   A FSF  
Sbjct: 128 PVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQG-----KRVGELDSIATFSFQN 182

Query: 190 TKNLGTYGDGGMIVTNSDEIAEESRILRVHG-----ARKKYFHEKVGYNSRLDEIHAAIL 244
            K +     G ++  +  E  +       H        ++YFH+  G N RL+E  A++L
Sbjct: 183 GKLMTAGEGGAVVFPD-GETEKYETAFLRHSCGRPRDDRRYFHKIAGSNMRLNEFSASVL 241

Query: 245 RVKLRYLERWTEERTRVARTYQKLFEE-KKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXX 303
           R +L  L+     R        +L      +      V      +++             
Sbjct: 242 RAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERR 301

Query: 304 XXXXXXXXXXXGIQTAIYYPLPLHLQKCFR-----DLGYQEGDFPVAESLSKRSLALPMF 358
                          A +  +               +       P  +++S   + L   
Sbjct: 302 NALVDRLVEAGLPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHR 361

Query: 359 PELRDDE-IKEVVDTIALFL 377
             L  +  +    + IA  +
Sbjct: 362 VLLAGEPELHATAEIIADAV 381


>3bcxB [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
          Length = 419

 Score =  136 bits (343), Expect = 9e-35
 Identities = 83/387 (21%), Positives = 152/387 (39%), Gaps = 26/387 (6%)

Query: 10  QYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRA 69
             + I  + L  + +    G +  G      E+++  + GV + +   SGS A L+AL A
Sbjct: 36  SGKVIGTKELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTA 95

Query: 70  M--------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLK 121
           +         ++ GD V+T    F  T +   + G   +FVDVD  T+N++ + +E  + 
Sbjct: 96  LTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVS 155

Query: 122 KEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGD 181
             K KAI+  H  G   DL  +  + +KY + ++EDC  ++GS +       + +G+ GD
Sbjct: 156 D-KTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGD 209

Query: 182 AAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG----------ARKKYFHEKVG 231
               SF+P  ++     GG + T S E+       R  G             KY +  +G
Sbjct: 210 IGTVSFYPAHHITMGE-GGAVFTQSAELKSIIESFRDWGRDCLGSLPFGYDHKYTYSHLG 268

Query: 232 YNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
           YN ++ ++ AA    +L  +E + E+R    +  +   +     +  P   E        
Sbjct: 269 YNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFG 328

Query: 292 HQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRD-LGYQEGDFPVAESLSK 350
                                   + T + +   L  Q  F D      G+    + +  
Sbjct: 329 FPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMN 388

Query: 351 RSLALPMFPELRDDEIKEVVDTIALFL 377
           ++  + ++P L  D +  VV     F 
Sbjct: 389 QTFWIGIYPGLTHDHLDYVVSKFEEFF 415


>1b9hA [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
          Length = 384

 Score =  134 bits (338), Expect = 4e-34
 Identities = 84/380 (22%), Positives = 144/380 (37%), Gaps = 21/380 (5%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHGVGVASGSDALLIALRA 69
            +      N + + +  G         V   E E A+  G  H + V +G+ AL +AL+ 
Sbjct: 9   PQYDDAERNGLVRALEQGQWWRMGGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQV 68

Query: 70  MGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII 129
           MGV  G  V+   +TF +++ A  RLGA  + VDVD +T+N+D   +   +   + K I+
Sbjct: 69  MGVGPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAV-TPRTKVIM 127

Query: 130 PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFP 189
           PVH+ G   D++AL+ +    GV +L+D A + G+ W+      ++ G +   A FSF  
Sbjct: 128 PVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQ-----GKRVGELDSIATFSFQN 182

Query: 190 TKNLGTYGDGGMIVTNSDEIAEESRILRVHG-----ARKKYFHEKVGYNSRLDEIHAAIL 244
            K +     G  +V    E  +       H        ++YFH+  G N RL+E  A++L
Sbjct: 183 GKLMTAGEGGA-VVFPDGETEKYETAFLRHSCGRPRDDRRYFHKIAGSNMRLNEFSASVL 241

Query: 245 RVKLRYLERWTEERTRVARTYQKLFE--EKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXX 302
           R +L  L+     R        +L    +  +P       ++   Y    +         
Sbjct: 242 RAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERR 301

Query: 303 XXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQ----EGDFPVAESLSKRSLALPMF 358
                           A                           P  +++S   + L   
Sbjct: 302 NALVDRLVEAGLPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSDCVWLHHR 361

Query: 359 PELRD-DEIKEVVDTIALFL 377
             L    E+    + IA  +
Sbjct: 362 VLLAGEPELHATAEIIADAV 381


>3bb8A [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
          Length = 420

 Score =  129 bits (325), Expect = 1e-32
 Identities = 81/383 (21%), Positives = 151/383 (39%), Gaps = 31/383 (8%)

Query: 11  YERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM 70
             +    ++ A      +            E+++  + GV + +   SGS A L+AL A+
Sbjct: 41  GTKELQLMVEASLDGWLTTG----RFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTAL 96

Query: 71  --------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKK 122
                    ++ GD V+T    F  T +   + G   +FVDVD  T+N++ + +E     
Sbjct: 97  TSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAA-VS 155

Query: 123 EKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDA 182
           +K KAI+  H  G   DL  +  + +KY + ++EDC  ++GS +       + +G+ GD 
Sbjct: 156 DKTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGDI 210

Query: 183 AIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVH-----------GARKKYFHEKVG 231
              SF+P K++   G+GG + T S E+       R             G   KY +  +G
Sbjct: 211 GTVSFYPAKHIT-MGEGGAVFTQSAELKSIIESFRDWGRDCQLGSLPFGYDHKYTYSHLG 269

Query: 232 YNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
           YN ++ ++ AA    +L  +E + E+R    +  +   +     +  P   E        
Sbjct: 270 YNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFG 329

Query: 292 HQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLG-YQEGDFPVAESLSK 350
                                   + T + +   L  Q  F D+     G+    + +  
Sbjct: 330 FPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMN 389

Query: 351 RSLALPMFPELRDDEIKEVVDTI 373
           ++  + ++P L  D +  VV   
Sbjct: 390 QTFWIGIYPGLTHDHLDYVVSKF 412


>3bcxA [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
          Length = 421

 Score =  126 bits (316), Expect = 1e-31
 Identities = 82/378 (21%), Positives = 152/378 (40%), Gaps = 28/378 (7%)

Query: 17  EILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM------ 70
           + L  + +    G +  G      E+++  + GV + +   SGS A L+AL A+      
Sbjct: 43  KELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTALTSPKLG 102

Query: 71  --GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAI 128
              ++ GD V+T    F  T +   + G   +FVDVD  T+N++ + +E     +K KAI
Sbjct: 103 VRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEA-AVSDKTKAI 161

Query: 129 IPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFF 188
           +  H  G   DL  +  + +KY + ++EDC  ++GS +       + +G+ GD    SF+
Sbjct: 162 MIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALGSTYDG-----KMAGTFGDIGTVSFY 216

Query: 189 PTKNLGTYGDGGMIVTNSDEIAEESRILRVHG------------ARKKYFHEKVGYNSRL 236
           P  ++   G+GG + T S E+       R  G               KY +  +GYN ++
Sbjct: 217 PAHHITM-GEGGAVFTQSAELKSIIESFRDWGRDCYCLGSLPFGYDHKYTYSHLGYNLKI 275

Query: 237 DEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXX 296
            ++ AA    +L  +E + E+R    +  +   +     +  P   E             
Sbjct: 276 TDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFGFPITL 335

Query: 297 XXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLG-YQEGDFPVAESLSKRSLAL 355
                              + T + +   L  Q  F D+     G+    + +  ++  +
Sbjct: 336 KEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMNQTFWI 395

Query: 356 PMFPELRDDEIKEVVDTI 373
            ++P L  D +  VV   
Sbjct: 396 GIYPGLTHDHLDYVVSKF 413


>3b8xB [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
          Length = 388

 Score =  125 bits (313), Expect = 3e-31
 Identities = 86/384 (22%), Positives = 150/384 (39%), Gaps = 37/384 (9%)

Query: 17  EILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM------ 70
               AI  ++ S    +GE V++ E + A   G K+ V V+SGS A L+ + A+      
Sbjct: 14  LEYKAIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFFTKKP 73

Query: 71  GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIP 130
            ++KGD ++    ++  T     + G RV FVD+D +T N+D+  L+  +  +  KAI+ 
Sbjct: 74  RLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAV-TDSTKAILT 132

Query: 131 VHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPT 190
           V+L G   + + ++ +     +++LED  +SMG+ +       + +G+ G    FS F +
Sbjct: 133 VNLLGNPNNFDEINKIIGGRDIILLEDNCESMGATFNN-----KCAGTFGLMGTFSSFYS 187

Query: 191 KNLGTYGDGGMIVTNSDEIAEESRILRVHG-------------------ARKKYFHEKVG 231
            ++ T   GG IVT+ +EI      +R HG                     + +     G
Sbjct: 188 NHIATME-GGCIVTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKFVLPG 246

Query: 232 YNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
           YN R  E+  AI   +L+ L R+   R + A  +   F++     V       G      
Sbjct: 247 YNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDVQQE---TGESSWFG 303

Query: 292 HQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGY--QEGDFPVAESLS 349
             +                    GI+                         +   AE L 
Sbjct: 304 FSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNVDNAEYLD 363

Query: 350 KRSLALPMFPELRDDEIKEVVDTI 373
           K  L +        DEI  + + +
Sbjct: 364 KNGLFVGNHQIELFDEIDYLREVL 387


>2cb1A [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
          Length = 403

 Score =  123 bits (310), Expect = 6e-31
 Identities = 46/373 (12%), Positives = 90/373 (24%), Gaps = 30/373 (8%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSD 61
           I             G+   A  +             + LEE + +  G    V +ASG  
Sbjct: 24  IYAVAAYGFKTLEEGQERFATGEGYVYARQK-DPTAKALEERLKALEGALEAVVLASGQA 82

Query: 62  ALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLK 121
           A   AL A+ +  GD VV     F  T     ++ + +    V     + +   +   L 
Sbjct: 83  ATFAALLAL-LRPGDEVVAAKGLFGQTIGLFGQVLSLM---GVTVRYVDPEPEAVREALS 138

Query: 122 KEKVKAII--PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSV 179
            +     +    +      DLEAL+ L E+ GV ++ D                R     
Sbjct: 139 AKTRAVFVETVANPALLVPDLEALATLAEEAGVALVVDNTFGAAGA------LCRPLAWG 192

Query: 180 GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG--------ARKKYFHEKVG 231
               + S            GG +++   E+                     +        
Sbjct: 193 AHVVVESLTWASG-HGSVLGGAVLSRETELWRNYPQFLQPWEALRARCFPERVRTLGLSL 251

Query: 232 YNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
               L   +A +L   L  +       +  AR   +  +                  H  
Sbjct: 252 CGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRYPGLPEDPAHRN 311

Query: 292 HQ--------YXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFP 343
            +                                  +     L +          + +  
Sbjct: 312 ARKYLASGGPILTLDLGDLERASRFLGAIRLLKAANLGDARTLLVHPWTTTHSRLKEEAR 371

Query: 344 VAESLSKRSLALP 356
           +   ++   + + 
Sbjct: 372 LQAGVTPGLVRVS 384


>3b8xA [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
          Length = 386

 Score =  117 bits (293), Expect = 5e-29
 Identities = 87/388 (22%), Positives = 151/388 (38%), Gaps = 37/388 (9%)

Query: 13  RIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM-- 70
                   AI  ++ S    +GE V++ E + A   G K+ V V+SGS A L+ + A+  
Sbjct: 8   TWDDLEYKAIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFF 67

Query: 71  ----GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVK 126
                ++KGD ++    ++  T     + G RV FVD+D +T N+D+  L+  +     K
Sbjct: 68  TKKPRLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAVTDS-TK 126

Query: 127 AIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFS 186
           AI+ V+L G   + + ++ +     +++LED  +SMG     ++   + +G+ G    FS
Sbjct: 127 AILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMG-----ATFNNKCAGTFGLMGTFS 181

Query: 187 FFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG-------------------ARKKYFH 227
            F + ++ T   GG IVT+ +EI      +R HG                     + +  
Sbjct: 182 SFYSNHIATME-GGCIVTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKF 240

Query: 228 EKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFR 287
              GYN R  E+  AI   +L+ L R+   R + A  +   F++     V    +E G  
Sbjct: 241 VLPGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDV---QQETGES 297

Query: 288 YHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGY--QEGDFPVA 345
                 +                    GI+                         +   A
Sbjct: 298 SWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNVDNA 357

Query: 346 ESLSKRSLALPMFPELRDDEIKEVVDTI 373
           E L K  L +        DEI  + + +
Sbjct: 358 EYLDKNGLFVGNHQIELFDEIDYLREVL 385


>1dy2A [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
          Length = 168

 Score =  111 bits (278), Expect = 4e-27
 Identities = 21/143 (14%), Positives = 45/143 (31%), Gaps = 9/143 (6%)

Query: 96  GARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMIL 155
               +  D+          +   +      +A +  HL     DL  +    E++G+ I+
Sbjct: 9   LNTPVAGDIRADFQCFQQARAAGL--LSTFRAFLSSHLQ----DLSTVVRKAERFGLPIV 62

Query: 156 EDCAQSMGSEWK-FSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESR 214
               Q + + W    SG+  +  +     I+SF     +        +V +         
Sbjct: 63  NLKGQVLFNNWDSIFSGDGGQFNT--HIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRL 120

Query: 215 ILRVHGARKKYFHEKVGYNSRLD 237
           + +   A +       G+ S L 
Sbjct: 121 VDKYCEAWRTTDMAVTGFASPLS 143


>2c81A [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
          Length = 408

 Score =  110 bits (276), Expect = 5e-27
 Identities = 91/403 (22%), Positives = 162/403 (40%), Gaps = 44/403 (10%)

Query: 12  ERIRGEILNAIDKLISSGNV---ILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALR 68
           +R R +I         + +          R+  +  A F GV + V   SGS AL++AL 
Sbjct: 9   DRTRRKIEEVFQSNRWAISGYWTGEESMERKFAKAFADFNGVPYCVPTTSGSTALMLALE 68

Query: 69  AMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAI 128
           A+G+ +GD V+    T+ ATA+A   + A  +FVDV+  T+ +D   ++  +  +  KAI
Sbjct: 69  ALGIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDK-TKAI 127

Query: 129 IPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFF 188
           IPVHLFG   +++ ++ + +++ + ++EDCAQS GS W       +++G++GD   FS  
Sbjct: 128 IPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHGSVWNN-----QRAGTIGDIGAFSCQ 182

Query: 189 PTKNLGTYGDGGMIVTNSDEIAEESRILRVHG--------------ARKKYFHEKVGYNS 234
             K L     G ++  N   + E  + LR                  +     +  G N 
Sbjct: 183 QGKVLTAGEGGIIVTKN-PRLFELIQQLRADSRVYCDDSSELMHGDMQLVKKGDIQGSNY 241

Query: 235 RLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKK--LPVVYPRVEEKGFRYHVFH 292
            L E  +AIL  +L+ L+     R + A        +      +  P    +   Y    
Sbjct: 242 CLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSRQTYYGYVF 301

Query: 293 Q-YXXXXXXXXXXXXXXXXXXXXGIQTAIYYPL--PLHLQKCF--------------RDL 335
           +                       + T   +P   P+H    F               + 
Sbjct: 302 RFDPVKFGGLNADQFCEILREKLNMGTFYLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEA 361

Query: 336 GYQEGDFPVAESLSKRSLALPMFPELRDDE-IKEVVDTIALFL 377
            ++   +PV+E  S +S+ +     L +   +  +VD +A   
Sbjct: 362 YWRGLHYPVSERASGQSIVIHHAILLAEPSHLSLLVDAVAELA 404


>3dr4B [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
          Length = 366

 Score =  108 bits (271), Expect = 2e-26
 Identities = 100/367 (27%), Positives = 180/367 (49%), Gaps = 17/367 (4%)

Query: 13  RIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
           R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL +AL AMG
Sbjct: 8   RLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMG 67

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPV 131
           +  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE  L   + KAI+PV
Sbjct: 68  IGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPRTKAIMPV 126

Query: 132 HLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTK 191
           HL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSFF   
Sbjct: 127 HLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYR-----GKKSGSLGDCATFSFFGNA 181

Query: 192 NLGTYGDGGMIVTNSDEIAEESRILRVHG--ARKKYFHEKVGYNSRLDEIHAAILRVKLR 249
            + T G+GGMI TN D++A + R+LR  G    ++Y+   VG+N R+  I AAI   +L 
Sbjct: 182 -IITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLE 240

Query: 250 YLERWTEERTRVARTYQKLFE--EKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXX 307
            ++     R RV   Y++       ++   +  +  +   +    +              
Sbjct: 241 RVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVR--LGEGLSTTRDQV 298

Query: 308 XXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIK 367
                  GI++   +  P+H+   +  L     D  +AE+     L LP    L + +I 
Sbjct: 299 IKDLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGVDGLNLPTHAGLTEADID 355

Query: 368 EVVDTIA 374
            V+  + 
Sbjct: 356 RVIAALD 362


>2c7tA [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
          Length = 411

 Score =  108 bits (270), Expect = 3e-26
 Identities = 93/403 (23%), Positives = 163/403 (40%), Gaps = 44/403 (10%)

Query: 12  ERIRGEILNAIDKLISSGNVI---LGENVRRLEEEIASFTGVKHGVGVASGSDALLIALR 68
           +R R +I         + +          R+  +  A F GV + V   SGS AL++AL 
Sbjct: 11  DRTRRKIEEVFQSNRWAISGYWTGEESMERKFAKAFADFNGVPYCVPTTSGSTALMLALE 70

Query: 69  AMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAI 128
           A+G+ +GD V+    T+ ATA+A   + A  +FVDV+  T+ +D   ++  +  +  KAI
Sbjct: 71  ALGIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDK-TKAI 129

Query: 129 IPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFF 188
           IPVHLFG   +++ ++ + +++ + ++EDCAQS GS W       +++G++GD   FS  
Sbjct: 130 IPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHGSVWNN-----QRAGTIGDIGAFSCQ 184

Query: 189 PTKNLGTYGDGGMIVTNSDEIAEESRILRVHG--------------ARKKYFHEKVGYNS 234
             K L     GG+IVT +  + E  + LR                  +     +  G N 
Sbjct: 185 QGKVLTAGE-GGIIVTKNPRLFELIQQLRADSRVYCDDSSELMHGDMQLVKKGDIQGSNY 243

Query: 235 RLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE--EKKLPVVYPRVEEKGFRYHVFH 292
            L E  +AIL  +L+ L+     R + A          +    +  P    +   Y    
Sbjct: 244 CLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSRQTYYGYVF 303

Query: 293 QYXXXXXXXXXXXXXXXXXXXXGIQTAI---YYPLPLHLQKCF--------------RDL 335
           ++                                LP+H    F               + 
Sbjct: 304 RFDPVKFGGLNADQFCEILREKLNMGTFYLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEA 363

Query: 336 GYQEGDFPVAESLSKRSLALPMFPELRDDE-IKEVVDTIALFL 377
            ++   +PV+E  S +S+ +     L +   +  +VD +A   
Sbjct: 364 YWRGLHYPVSERASGQSIVIHHAILLAEPSHLSLLVDAVAELA 406


>3bn1D [x.x.x] PEROSAMINE SYNTHETASE
          Length = 363

 Score =  108 bits (269), Expect = 3e-26
 Identities = 88/368 (23%), Positives = 163/368 (44%), Gaps = 18/368 (4%)

Query: 12  ERIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM 70
            R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL +AL AM
Sbjct: 5   PRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM 64

Query: 71  GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIP 130
           G+  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE  L   + KAI+P
Sbjct: 65  GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPRTKAIMP 123

Query: 131 VHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPT 190
           VHL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSF   
Sbjct: 124 VHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSF--F 176

Query: 191 KNLGTYGDGGMIVT--NSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKL 248
            N+ T G+GGMI T  +           +     ++Y+   VG+N R+  I AAI   +L
Sbjct: 177 GNIITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQL 236

Query: 249 RYLERWTEERTRVARTYQKLFEE--KKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXX 306
             ++     R RV   Y++       ++   +  +  +   +    +             
Sbjct: 237 ERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQVI 296

Query: 307 XXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEI 366
                     +   +    +              D  +AE+     L LP    L + +I
Sbjct: 297 KDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGVDGLNLPTHAGLTEADI 351

Query: 367 KEVVDTIA 374
             V+  + 
Sbjct: 352 DRVIAALD 359


>3dr7B [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
          Length = 366

 Score =  107 bits (266), Expect = 8e-26
 Identities = 93/374 (24%), Positives = 173/374 (46%), Gaps = 18/374 (4%)

Query: 6   DLTRQYERIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALL 64
            ++    R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL 
Sbjct: 2   RISVAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALH 61

Query: 65  IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEK 124
           +AL AMG+  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE  L   +
Sbjct: 62  LALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEA-LITPR 120

Query: 125 VKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAI 184
            KAI+PVHL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A 
Sbjct: 121 TKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCAT 175

Query: 185 FSFFPTKNLGTYGDGGMIVTNSDEIAEESRIL--RVHGARKKYFHEKVGYNSRLDEIHAA 242
           FSF    N+ T G+GGMI TN D++A + R+L  +     ++Y+   VG+N R+  I AA
Sbjct: 176 FSF--FGNIITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAA 233

Query: 243 ILRVKLRYLERWTEERTRVARTYQKLFEE--KKLPVVYPRVEEKGFRYHVFHQYXXXXXX 300
           I   +L  ++     R RV   Y++       ++   +  +  +   +    +       
Sbjct: 234 IGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLST 293

Query: 301 XXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPE 360
                           +   +    +              D  +AE+     L LP    
Sbjct: 294 TRDQVIKDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGVDGLNLPTHAG 348

Query: 361 LRDDEIKEVVDTIA 374
           L + +I  V+  + 
Sbjct: 349 LTEADIDRVIAALD 362


>1cl1A [c.67.1] CYSTATHIONINE BETA-LYASE
          Length = 390

 Score =  103 bits (256), Expect = 1e-24
 Identities = 39/341 (11%), Positives = 83/341 (24%), Gaps = 16/341 (4%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLG 96
              L++ +    G    V    G+ A+  ++ A  +E+GD V+ T   +  +     ++ 
Sbjct: 60  HFSLQQAMCELEGGAGCVLFPCGAAAVANSILAF-IEQGDHVLMTNTAYEPSQDFCSKIL 118

Query: 97  ARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIP--VHLFGRTVDLEALSFLREKYGVMI 154
           +++           +    +   L+       +     +     D+ A+           
Sbjct: 119 SKLGVTTSWF--DPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDA 176

Query: 155 LEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESR 214
           +     +  +   F + +        D +I +             G  V N+    +   
Sbjct: 177 IIMIDNTWAAGVLFKALD-----FGIDVSIQAATYLVGHSD-AMIGTAVCNARCWEQLRE 230

Query: 215 ILRVHGAR-KKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKK 273
              + G               R   +           +  W  E  +VAR         K
Sbjct: 231 NAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSK 290

Query: 274 LPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFR 333
               + R          F                        +  +      L L     
Sbjct: 291 GHEFWKRDFTGSSGLFSF--VLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPE 348

Query: 334 DLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                          S   + L +  E  DD I ++    A
Sbjct: 349 H--IAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFA 387


>2btwB [x.x.x] ALR0975 PROTEIN
          Length = 205

 Score =  100 bits (249), Expect = 8e-24
 Identities = 29/210 (13%), Positives = 61/210 (29%), Gaps = 22/210 (10%)

Query: 51  KHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFV------DV 104
            + +G  S     L+                P + F T       G   I V      + 
Sbjct: 3   PNLIGFNSNEGEKLLL------TSRSREDFFPLSQFVTQVNQAYCGVASIIVLNSLGINA 56

Query: 105 DESTFNMDLNQLEHVLK--KEKVKAIIPVHLFGRTVDLEALSFLREKYGV-MILEDCAQS 161
            E+                 EK KA+I   +  +   L+ L  L   YGV + +   + +
Sbjct: 57  PETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVAKQGTLDELGRLIASYGVKVKVNHASDT 116

Query: 162 MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG- 220
              +++    ++ ++       +   +  K +G    GG I   +    +  R L     
Sbjct: 117 NIEDFR---KQVAENLKQDGNFVIVNYLRKEIGQER-GGHISPLAAYNEQTDRFLIDVSR 172

Query: 221 --ARKKYFHEKVGYNSRLDEIHAAILRVKL 248
                 +      + +   +  +   R  +
Sbjct: 173 YKYPPVWVKTTDLWKANTVDSVSQKTRGFV 202


>1cl1B [c.67.1] CYSTATHIONINE BETA-LYASE
          Length = 391

 Score = 97.1 bits (240), Expect = 8e-23
 Identities = 34/340 (10%), Positives = 75/340 (22%), Gaps = 14/340 (4%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLG 96
              L++ +    G    V +     A +       +E+GD V+ T   +  +     ++ 
Sbjct: 61  HFSLQQAMCELEGGAGCV-LFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKIL 119

Query: 97  ARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVH--LFGRTVDLEALSFLREKYGVMI 154
           +++           +    +   L+       +     +     D+ A+           
Sbjct: 120 SKLGVTTSWF--DPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDA 177

Query: 155 LEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESR 214
           +     +  +   F + +        D +I +            G  +            
Sbjct: 178 IIMIDNTWAAGVLFKALDFG-----IDVSIQAATYLVGHSDAMIGTAVCNARCWEQLREN 232

Query: 215 ILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKL 274
              +                R   +           +  W  E  +VAR         K 
Sbjct: 233 AYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKG 292

Query: 275 PVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRD 334
              + R          F                        +  +      L L      
Sbjct: 293 HEFWKRDFTGSSGLFSF--VLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEH 350

Query: 335 LGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                         S   + L +  E  DD I ++    A
Sbjct: 351 --IAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFA 388


>3dr4A [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
          Length = 364

 Score = 96.3 bits (238), Expect = 1e-22
 Identities = 94/368 (25%), Positives = 173/368 (47%), Gaps = 17/368 (4%)

Query: 12  ERIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM 70
            R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL +AL AM
Sbjct: 5   PRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAM 64

Query: 71  GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIP 130
           G+  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE ++   + KAI+P
Sbjct: 65  GIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITP-RTKAIMP 123

Query: 131 VHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPT 190
           VHL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSFF  
Sbjct: 124 VHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGN 178

Query: 191 KNLGTYGDGGMIVTNSDEIAEESRILRVHG--ARKKYFHEKVGYNSRLDEIHAAILRVKL 248
             + T G+GGMI TN D++A + R+LR  G    ++Y+   VG+N R+  I AAI   +L
Sbjct: 179 A-IITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQL 237

Query: 249 RYLERWTEERTRVARTYQKLFEE--KKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXX 306
             ++     R RV   Y++       ++   +  +  +   +    +             
Sbjct: 238 ERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQVI 297

Query: 307 XXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEI 366
                     +   +    +              D  +AE+     L LP    L + +I
Sbjct: 298 KDLDALGIESRPVFHPMHIMPPYAHLA-----TDDLKIAEACGVDGLNLPTHAGLTEADI 352

Query: 367 KEVVDTIA 374
             V+  + 
Sbjct: 353 DRVIAALD 360


>3dr4D [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
          Length = 367

 Score = 92.8 bits (229), Expect = 1e-21
 Identities = 103/365 (28%), Positives = 178/365 (48%), Gaps = 13/365 (3%)

Query: 13  RIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
           R+ G   + + + + +  +      +   E+  A + GVKH +   +G+ AL +AL AMG
Sbjct: 9   RLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMG 68

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPV 131
           +  GD V+    T+ A+A++    GA  + VD D  TFN+D  +LE ++     KAI+PV
Sbjct: 69  IGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPR-TKAIMPV 127

Query: 132 HLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTK 191
           HL+G+  D++ +  +  ++ ++++ED A+++G+ ++      +KSGS+GD A FSFF   
Sbjct: 128 HLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRG-----KKSGSLGDCATFSFFGNA 182

Query: 192 NLGTYGDGGMIVTNSDEIAEESRILRVHG--ARKKYFHEKVGYNSRLDEIHAAILRVKLR 249
            + T G+GGMI TN D++A + R+LR  G    ++Y+   VG+N R+  I AAI   +L 
Sbjct: 183 IITT-GEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLE 241

Query: 250 YLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXX 309
            ++     R RV   Y++        V  P V   G      +                 
Sbjct: 242 RVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQVIK 301

Query: 310 XXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEV 369
                GI++   +  P+H+   +  L     D  +AE+     L LP    L + +I  V
Sbjct: 302 DLDALGIESRPVFH-PMHIMPPYAHLAT--DDLKIAEACGVDGLNLPTHAGLTEADIDRV 358

Query: 370 VDTIA 374
           +  + 
Sbjct: 359 IAALD 363


>1e5eB [c.67.1] METHIONINE GAMMA-LYASE
          Length = 393

 Score = 92.5 bits (228), Expect = 2e-21
 Identities = 35/347 (10%), Positives = 90/347 (25%), Gaps = 22/347 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
             V  LE +IA     +  V  +SG  A+   +  +  + GD +++    +  T +    
Sbjct: 59  PTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTIL-KAGDHLISDECLYGCTHALFEH 117

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHL---FGRTVDLEALSFLREKYG 151
              +                +++  +K    K +          + +D+E +        
Sbjct: 118 ALTKFGIQVDFI--NTAIPGEVKKHMK-PNTKIVYFETPANPTLKIIDMERVCKDAHSQE 174

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
            +++                         D  + S     N  T    G+I     ++ +
Sbjct: 175 GVLVIADNTFCSPMI------TNPVDFGVDVVVHSATKYINGHTDVVAGLICGK-ADLLQ 227

Query: 212 ESRILRVHGARK----KYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
           + R++ +          +    +        I           +  + +    V + Y  
Sbjct: 228 QIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYP 287

Query: 268 LFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLH 327
            FE+ +   +  +          F                        +  ++     L 
Sbjct: 288 GFEDHEGHDIAKKQMRMYGSMITFILKSGFEGAKKLLDNLKLI----TLAVSLGGCESLI 343

Query: 328 LQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                        +   A  ++   + L +  E  D+ I +    + 
Sbjct: 344 QHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLD 390


>1cj0B [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
          Length = 466

 Score = 91.3 bits (225), Expect = 4e-21
 Identities = 44/358 (12%), Positives = 84/358 (23%), Gaps = 25/358 (6%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
           R L+            V   SGS A      A+  E    ++          +  +    
Sbjct: 85  RALQAYGLDPQCWGVNVQPYSGSPANFAVYTALV-EPHGRIMGLDLPDGGHLTHGFMTDK 143

Query: 98  RVI----------FVDVDESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDLEALSFL 146
           + I             V+  T  +D ++LE   +    K II     + R +D   L  +
Sbjct: 144 KKISATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKI 203

Query: 147 REKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNS 206
            ++ G  ++ D A   G                    + +    K L      GMI    
Sbjct: 204 ADENGAYLMADMAHISGLVV-----AGVVPSPFEHCHVVTTTTHKTLRG-CRAGMIFYRR 257

Query: 207 DEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQ 266
              + +  IL    +               +   A +     + +    +E  R      
Sbjct: 258 GVRSVDKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANC 317

Query: 267 KLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPL 326
           +      + + Y  V      + +                          +         
Sbjct: 318 RALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSA 377

Query: 327 HLQKCFR-------DLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
                 R         G  E DF        R + L +  +        + +      
Sbjct: 378 LRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDTGPRATLKEFKEKLA 435


>2btwA [x.x.x] ALR0975 PROTEIN
          Length = 205

 Score = 91.2 bits (225), Expect = 4e-21
 Identities = 27/208 (12%), Positives = 56/208 (26%), Gaps = 23/208 (11%)

Query: 54  VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFV------DVDES 107
           +   + ++   + L +            P + F T       G   I V      +  E+
Sbjct: 5   LIGFNSNEGEKLLLTS-----RSREDFFPLSQFVTQVNQAYCGVASIIVLNSLGINAPET 59

Query: 108 TFNMDLNQLEHVLKKEK--VKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSE 165
                               KA+I   +  R   L+ L  L   YGV +  + A      
Sbjct: 60  AQYSPYRVFTQDNFFSNEKTKAVIAPEVVARQGTLDELGRLIASYGVKVKVNHASDTN-- 117

Query: 166 WKFSSGEIRKSGSVGD--AAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG--- 220
                   + + ++      +   +  K +G    GG I   +    +  R L       
Sbjct: 118 --IEDFRKQVAENLKQDGNFVIVNYLRKEIGQER-GGHISPLAAYNEQTDRFLIDVSRYK 174

Query: 221 ARKKYFHEKVGYNSRLDEIHAAILRVKL 248
               +      + +   +  +   R  +
Sbjct: 175 YPPVWVKTTDLWKANTVDSVSQKTRGFV 202


>1cs1A [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
          Length = 383

 Score = 89.3 bits (220), Expect = 2e-20
 Identities = 37/344 (10%), Positives = 93/344 (27%), Gaps = 17/344 (4%)

Query: 34  GENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPY 93
                 ++  +A   G    V   +G  A+ +      ++ GD +V     +  +     
Sbjct: 49  NPTRDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVF-LKPGDLLVAPHDCYGGSYRLFD 107

Query: 94  RLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVM 153
            L  R  +  +     +    +     K + V    P +   R VD+  +  L  + G +
Sbjct: 108 SLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAV 167

Query: 154 ILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDG-GMIVTNSDEIAEE 212
            + D      +                 A +     T   G      G+++    ++  E
Sbjct: 168 SVVDNTFLSPALQN---------PLALGADLVLHSCTYLNGHSDVVAGVVIAKDPDVVTE 218

Query: 213 SRILRVHGARKK--YFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE 270
                 +       +    +    R       + +   + + ++ + +  V + Y     
Sbjct: 219 LAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLP 278

Query: 271 EKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQK 330
           E +   +  R ++       F                        +  ++     L    
Sbjct: 279 ENQGHEIAARQQKGFGAMLSF----ELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHA 334

Query: 331 CFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                     +   A  +S+  L +    E  +D I ++ +   
Sbjct: 335 ATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFR 378


>2a7vA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
          Length = 420

 Score = 86.6 bits (213), Expect = 1e-19
 Identities = 44/390 (11%), Positives = 97/390 (24%), Gaps = 30/390 (7%)

Query: 7   LTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGV-----GVASGSD 61
           L+     +   +    D+      +I  EN            G                 
Sbjct: 8   LSDSDPEMWELLQREKDRQCRGLELIASEN--FCSRAALEALGSCLNNKYSEGVDEIELL 65

Query: 62  ALLIALRAMGVEKGDTVVT-----TPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQL 116
               AL A  ++     V            A  +A  +   R++   ++  T  +D NQL
Sbjct: 66  CQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGYKLNPKTGLIDYNQL 125

Query: 117 EHVL-KKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRK 175
                       I     + R +D   +  + ++    +L D A   G            
Sbjct: 126 ALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAK-----VI 180

Query: 176 SGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG--------ARKKYFH 227
                 A I +    K L     G +I       A + +  R                  
Sbjct: 181 PSPFKHADIVTTTTHKTLRGARSG-LIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSL 239

Query: 228 EKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFR 287
           +   +N  +  +  A+ +        ++ +  + AR       E+   +V    +     
Sbjct: 240 QGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVL 299

Query: 288 YHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFR---DLGYQEGDFPV 344
             +  +                               P  L+          ++E DF  
Sbjct: 300 VDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRR 359

Query: 345 AESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                   + + +  + +  ++++    + 
Sbjct: 360 VVDFIDEGVNIGLEVKSKTAKLQDFKSFLL 389


>3ecdC [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
          Length = 386

 Score = 86.3 bits (212), Expect = 1e-19
 Identities = 46/378 (12%), Positives = 89/378 (23%), Gaps = 44/378 (11%)

Query: 7   LTRQYERIRGEILNAIDKLISSGNVILG-ENVRRLEEEIASFTGVKHGVGVASGSDALLI 65
           L      +   +L+A   ++++       E      E +       H             
Sbjct: 34  LIASENIVSRAVLDAQGSVLTNKYAEGYDEVEALAIERVKRLFNAGHANVQPHSGAQANG 93

Query: 66  ALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKV 125
           A+     + GDTV+                        V   T  +D +Q+E + ++ K 
Sbjct: 94  AVMLALAKPGDTVLGMSLFNAL-------------QYGVSRDTMLIDYDQVEALAQQHKP 140

Query: 126 KAII-PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAI 184
             II     + R +D      + +  G  ++ D A   G          R +  V  A +
Sbjct: 141 SLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAA-----GRHANPVEHAHV 195

Query: 185 FSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAIL 244
            +    K L     G ++  + +                K           +     A  
Sbjct: 196 VTSTTHKTLRGPRGGFVLTNDEEIAK-------------KINSAVGPLMHVIAGKAVAFG 242

Query: 245 RVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXX 304
                  + + +     A+    + +     V             +              
Sbjct: 243 EALTDDFKTYIDRVLANAQALGDVLKA--GGVDLVTGGTDNH-LLLVDLRPKGLKGAQVE 299

Query: 305 XXXXXXXXXXGIQTAIYYPLPLHLQKCFR---DLGYQEGDFP-----VAESLSKRSLALP 356
                           + P    +    R     G   G        V   + +   AL 
Sbjct: 300 QALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALR 359

Query: 357 MFPELRDDEIKEVVDTIA 374
             PE      + V   I 
Sbjct: 360 TNPEGDHATEQRVRREIF 377


>2aeuA [x.x.x] HYPOTHETICAL PROTEIN MJ0158
          Length = 366

 Score = 85.1 bits (209), Expect = 3e-19
 Identities = 23/295 (7%), Positives = 69/295 (23%), Gaps = 23/295 (7%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSD 61
           +           I  +    ++  I S         +  E  +    G ++   V     
Sbjct: 22  LYDLSGLSGGFLIDEKDKALLNTYIGSSYFA----EKVNEYGLKHLGGDENDKCVGFNRT 77

Query: 62  ALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLK 121
           +  I    + ++    +   P      +           + + D       + ++ + + 
Sbjct: 78  SSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKYFESD------KVGEILNKID 131

Query: 122 KEKVKAIIPVHLFGRT---VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGS 178
           K+ +  I    +  +     + + +    +    ++  D A              +    
Sbjct: 132 KDTLVIITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGAR----VRLLFNQPPAL 187

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDE 238
              A +      K +     GG++    + + +        G   +              
Sbjct: 188 KLGADLVVTSTDKLMEGPR-GGLLAGKKELVDKIYIEGTKFGLEAQPPLLAGI----YRA 242

Query: 239 IHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQ 293
           +    L    +  ER             K  +      +    E     + +   
Sbjct: 243 LKNFNLERIRKAFERAKNFDLSKIEKLNKELKAID-DNINIVYERTPTGFVIKRV 296


>1c4kA [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
          Length = 728

 Score = 84.0 bits (206), Expect = 6e-19
 Identities = 25/286 (8%), Positives = 50/286 (17%), Gaps = 31/286 (10%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                 E+  A          V  GS      + +  V  GD V+       +  ++   
Sbjct: 171 GPAVAAEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALA 230

Query: 95  LGARVIFVDVDESTFNM----------------DLNQLEHVLK--KEKVKAIIPVHLF-- 134
           +                                +L       +   ++   +  + L   
Sbjct: 231 MAGGRPVYLQTNRNPYGFIGGIYDSDFDEKKIRELAAKVDPERAKWKRPFRLAVIQLGTY 290

Query: 135 -GRTVDLEALSFLREKYGVMILEDCAQSMGS-----EWKFSSGEIRKSGSVGDAAIFSFF 188
            G   +   +          I  D A              S   I   G      I    
Sbjct: 291 DGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRNSSPLLIDDLGPEDPGIIVVQS 350

Query: 189 PTKNLGTYGDGGMIVTNSDEIAEESRILR--VHGARKKYFHEKVGYNSRLDEIHAAILRV 246
             K    +     I      I  + R             F     +      +       
Sbjct: 351 VHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFNNSFNLFMSTSPFYPMYAALDVNAAMQ 410

Query: 247 KLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFH 292
           +     +   +        +K   +                     
Sbjct: 411 EGEAGRKLWHDLLITTIEARKKLIKAGSMFR---PFVPPVVNGKKW 453


>3bh1C [x.x.x] UPF0371 PROTEIN DIP2346
          Length = 483

 Score = 83.4 bits (204), Expect = 1e-18
 Identities = 20/182 (10%), Positives = 49/182 (26%), Gaps = 19/182 (10%)

Query: 33  LGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVT-TPYTFFATASA 91
              +   +    A     +  V   +       +L    +E  D  +     +     S+
Sbjct: 317 TQSDRAAVVMAKAGIKASQRVVVEPARQVEERTSLPGCAIELVDGSIITGATSDLLGCSS 376

Query: 92  PYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII--PVHLFGRTVDLEALSFLREK 149
              L A      +D++   +    +E +   + V      P       +   ++S   + 
Sbjct: 377 SMLLNALKHLAGIDDAIHLLSPESIEPIQTLKTVHLGSSNPRLHTDEVLIALSVSAATDS 436

Query: 150 YGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
                L+      G +                  I         G + + G++VT+  + 
Sbjct: 437 NAQKALDQLKNLRGCDV-------------HTTTILGS--VD-EGIFRNLGVLVTSDPKF 480

Query: 210 AE 211
            +
Sbjct: 481 QK 482


>1dfoA [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
          Length = 416

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 38/279 (13%), Positives = 77/279 (27%), Gaps = 17/279 (6%)

Query: 7   LTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIA 66
              Q      E           G   +    +   +      G  +             A
Sbjct: 46  QGSQLTNKYAEGYPGKRYY--GGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFA 103

Query: 67  LRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDE----STFNMDLNQLEHVLKK 122
           +    +E GDTV+          +    +       ++      +T ++D   LE   K+
Sbjct: 104 VYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKE 163

Query: 123 EKVKAIIP-VHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGD 181
            K K II     +   VD   +  + +  G  +  D A   G               V  
Sbjct: 164 HKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPH 218

Query: 182 AAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHA 241
           A + +    K L     GG+I+           + +   +      +       +     
Sbjct: 219 AHVVTTTTHKTLAGPR-GGLILAKGGSE----ELYKKLNSAVFPGGQGGPLMHVIAGKAV 273

Query: 242 AILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR 280
           A+        + + ++  + A+   ++F E+   VV   
Sbjct: 274 ALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGG 312


>3bcaA [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
          Length = 435

 Score = 82.8 bits (203), Expect = 1e-18
 Identities = 30/357 (8%), Positives = 76/357 (21%), Gaps = 33/357 (9%)

Query: 37  VRRLEEEIASFTGVKH---GVGVASGSDALLIALRA---MGVEKGDTVVTTPYTFFATAS 90
              L   +    GV        V   +   L            K   ++       +   
Sbjct: 88  TNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFK 147

Query: 91  APYRLGARVIFVDVDEST--FNMDLNQLEHVLKKEK---VKAIIPVHLFGRT---VDLEA 142
           +    G   + ++          DL  +E  +++     +  +              LE 
Sbjct: 148 SMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEE 207

Query: 143 LSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMI 202
           L+ +   Y +  + + A  + S       +      VG    F       +   G   + 
Sbjct: 208 LAVICANYDIPHVVNNAYGLQSSKCMHLIQQG--ARVGRIDAFVQSLDNFMVPVGGAIIA 265

Query: 203 VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVA 262
             N   I                 +      S   ++   +L +      +  +ER  + 
Sbjct: 266 GFNEPFI-----------QDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMF 314

Query: 263 RTYQKLFEE--KKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAI 320
                  ++  +       +         +  +                           
Sbjct: 315 VYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARA 374

Query: 321 YYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
                              G    A++     L       ++  ++   +  +   L
Sbjct: 375 VPL----GNVQTVSGHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL 427


>3e77B [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
          Length = 362

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 26/251 (10%), Positives = 62/251 (24%), Gaps = 21/251 (8%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG-VEKGDTVVTTPYTFF-ATASAPYR 94
              + E +A     K       G          +  ++ G          + A A+   +
Sbjct: 49  ENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAK 108

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMI 154
               +  V     ++                  +        TV      F+ +  G ++
Sbjct: 109 KFGTINIVHPKLGSYTKIP-DPSTWNLNPDASYVYYCA--NETVHGVEFDFIPDVKGAVL 165

Query: 155 LEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESR 214
           + D + +  S+             V    +      KN+G+ G   +++   D +    R
Sbjct: 166 VCDMSSNFLSKP----------VDVSKFGVIFAGAQKNVGSAG-VTVVIVRDDLLGFALR 214

Query: 215 ILRVHG-----ARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLF 269
                      A     +      S                     +  +  ++T  ++ 
Sbjct: 215 ECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEII 274

Query: 270 EEKKLPVVYPR 280
           +  +   V P 
Sbjct: 275 DNSQGFYVCPV 285


>3d19E [x.x.x] CONSERVED METALLOPROTEIN
          Length = 257

 Score = 82.6 bits (203), Expect = 2e-18
 Identities = 18/228 (7%), Positives = 57/228 (25%), Gaps = 18/228 (7%)

Query: 57  ASGSDALLIALRAMGVEKGDTVVTTPYTFFAT-ASAPYRLGARVIFVDVDESTFNMDLNQ 115
                +  + L      +   ++     F+           +     D +       + +
Sbjct: 16  IMKEHSFFLRLGFRC--EDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKR 67

Query: 116 LEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRK 175
               ++ +    I       + + L     L  +    +L D        ++    ++ +
Sbjct: 68  FNAEVQ-QAATNIWGFK--RKILGLILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNE 124

Query: 176 SGSVGDAAIFSFFPTKNLGTYGDGG-----MIVTNSDEIAEESRILRVHGARKKYFHEKV 230
                            L    D       ++  +  ++ + +R        +  +    
Sbjct: 125 GKLDALPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSND-FDELMYQAID 183

Query: 231 GYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVY 278
             + +     A +L   L              +T + L E+ K+  + 
Sbjct: 184 LESMKPQSQTAPLLDQFLDQNRVSVASLRDFKKTARDLIEQCKIKSII 231


>1cj0A [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
          Length = 464

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 38/348 (10%), Positives = 79/348 (22%), Gaps = 37/348 (10%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
           R L+            V   SGS A      A+ VE    ++          +  +    
Sbjct: 85  RALQAYGLDPQCWGVNVQPYSGSPANFAVYTAL-VEPHGRIMGLDLPDGGHLTHGFMTDK 143

Query: 98  R----------VIFVDVDESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDLEALSFL 146
           +           +   V+  T  +D ++LE   +    K II     + R +D   L  +
Sbjct: 144 KKISATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKI 203

Query: 147 REKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNS 206
            ++ G  ++ D A   G                    + +    K L     G +     
Sbjct: 204 ADENGAYLMADMAHISGLV-----VAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFY--R 256

Query: 207 DEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQ 266
             +     +  +           +        I    + +K      + E + +V    +
Sbjct: 257 RGVRSVDILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCR 316

Query: 267 KLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPL 326
            L                     +                        G        +  
Sbjct: 317 ALSAALVELGYKIVTGGSDNHLILV------------------DLRSKGTDGGRAEKVLE 358

Query: 327 HLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                            +  S  +          L + + ++V   I 
Sbjct: 359 ACSIACNKNTCPGDKSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIH 406


>1e5eA [c.67.1] METHIONINE GAMMA-LYASE
          Length = 394

 Score = 81.7 bits (200), Expect = 3e-18
 Identities = 32/347 (9%), Positives = 90/347 (25%), Gaps = 22/347 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
             V  LE +IA     +  V  +SG  A+   +  +  + GD +++    +  T +    
Sbjct: 59  PTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTIL-KAGDHLISDECLYGCTHALFEH 117

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE---KYG 151
              +       +        +++  +K    K +        T+ +  +  + +      
Sbjct: 118 ALTKF--GIQVDFINTAIPGEVKKHMK-PNTKIVYFETPANPTLKIIDMERVCKDAHSQE 174

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
            +++                         D  + S     N G       ++    ++ +
Sbjct: 175 GVLVIADNTFCSPMI------TNPVDFGVDVVVHSATKYIN-GHTDVVAGLICGKADLLQ 227

Query: 212 ESRILRVHGARK----KYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
           + R++ +          +    +        I           +  + +    V + Y  
Sbjct: 228 QIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYP 287

Query: 268 LFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLH 327
            FE+ +   +  +          F                        +  ++     L 
Sbjct: 288 GFEDHEGHDIAKKQMRMYGSMITFI----LKSGFEGAKKLLDNLKLITLAVSLGGCESLI 343

Query: 328 LQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                        +   A  ++   + L +  E  D+ I +    + 
Sbjct: 344 QHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLD 390


>3ecdD [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
          Length = 382

 Score = 80.8 bits (198), Expect = 6e-18
 Identities = 46/375 (12%), Positives = 89/375 (23%), Gaps = 45/375 (12%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
             +   +L+A   ++++      E      E +       H             A+    
Sbjct: 38  NIVSRAVLDAQGSVLTNKYA--DEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLAL 95

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII-P 130
            + GDTV+                    +   V   T  +D +Q+E + ++ K   II  
Sbjct: 96  AKPGDTVLGMSLFNA-------------LQYGVSRDTMLIDYDQVEALAQQHKPSLIIAG 142

Query: 131 VHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPT 190
              + R +D      + +  G  ++ D A   G          R +  V  A + +    
Sbjct: 143 FSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAA-----GRHANPVEHAHVVTSTTH 197

Query: 191 KNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRY 250
           K L     G ++  +                 KK           +     A        
Sbjct: 198 KTLRGPRGGFVLTND-------------EEIAKKINSAVGPLMHVIAGKAVAFGEALTDD 244

Query: 251 LERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXX 310
            + + +     A+    + +     V             +                    
Sbjct: 245 FKTYIDRVLANAQALGDVLKA--GGVDLV-TGGTDNHLLLVDLRPKGLKGAQVEQALERA 301

Query: 311 XXXXGIQTAIYYPLPLHLQKCFR---DLGYQEGDFP-----VAESLSKRSLALPMFPELR 362
                     + P    +    R     G   G        V   + +   AL   PE  
Sbjct: 302 GITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEGD 361

Query: 363 DDEIKEVVDTIALFL 377
               + V   I    
Sbjct: 362 HATEQRVRREIFALC 376


>1dfoB [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
          Length = 417

 Score = 79.3 bits (194), Expect = 2e-17
 Identities = 35/259 (13%), Positives = 76/259 (29%), Gaps = 15/259 (5%)

Query: 27  SSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFF 86
             G   +    +   +      G  +             A+    +E GDTV+       
Sbjct: 65  YGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHG 124

Query: 87  ATASAPYRLGARVIFVDV----DESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDLE 141
              +    +       ++     ++T ++D   LE   K+ K K II     +   VD  
Sbjct: 125 GHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWA 184

Query: 142 ALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGM 201
            +  + +  G  +  D A   G               V  A + +   T +    G  G 
Sbjct: 185 KMREIADSIGAYLFVDMAHVAGLVAA-----GVYPNPVPHAHVVT--TTTHKTLAGPRGG 237

Query: 202 IVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRV 261
           ++       E   + +   +      +       +     A+        + + ++  + 
Sbjct: 238 LILAKGGSEE---LYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKN 294

Query: 262 ARTYQKLFEEKKLPVVYPR 280
           A+   ++F E+   VV   
Sbjct: 295 AKAMVEVFLERGYKVVSGG 313


>3d19A [x.x.x] CONSERVED METALLOPROTEIN
          Length = 264

 Score = 78.9 bits (193), Expect = 2e-17
 Identities = 22/250 (8%), Positives = 61/250 (24%), Gaps = 27/250 (10%)

Query: 32  ILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFAT-AS 90
           ++       E    S               +  + L      +   ++     F+     
Sbjct: 7   VMFVERSLNEIRFWSR---------IMKEHSFFLRLGFRC--EDTQLIEEANQFYRLFEH 55

Query: 91  APYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKY 150
                 +     D +         Q++    + +  A        + + L     L  + 
Sbjct: 56  IEQIAHSYTNETDPE---------QIKRFNAEVQQAATNIWGFKRKILGLILTCKLPGQN 106

Query: 151 GVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD-----GGMIVTN 205
              +L D        ++    ++ +                 L    D     G ++  +
Sbjct: 107 NFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADHAKFIGHLLDPS 166

Query: 206 SDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTY 265
             ++ + +R        +  +      + +     A +L   L              +T 
Sbjct: 167 ERKLVDTARNFSNDFD-ELMYQAIDLESMKPQSQTAPLLDQFLDQNRVSVASLRDFKKTA 225

Query: 266 QKLFEEKKLP 275
           + L E+ K+ 
Sbjct: 226 RDLIEQCKIK 235


>2dkjA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
          Length = 402

 Score = 77.0 bits (188), Expect = 8e-17
 Identities = 35/360 (9%), Positives = 83/360 (23%), Gaps = 28/360 (7%)

Query: 27  SSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFF 86
             G  ++        E   +  G               +A+    +E GDT++       
Sbjct: 56  YGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAG 115

Query: 87  ATASAPYRLGARVIFVDV-----DESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDL 140
              +   R+        V        T  +DL ++  +  + + K I+     + R  D 
Sbjct: 116 GHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDF 175

Query: 141 EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
           +A   + ++ G  ++ D A   G               +  A + +    K L     G 
Sbjct: 176 KAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLRGPRGGL 230

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
           ++  + +       + +          +       +     A         + +      
Sbjct: 231 ILSNDPE-------LGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEY---SRL 280

Query: 261 VARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAI 320
           V    ++L EE                  +                        GI    
Sbjct: 281 VVENAKRLAEELARRGYRIVTGGTDNHLFLVD----LRPKGLTGKEAEERLDAVGITVNK 336

Query: 321 YYPLPLHLQKCFRDLGYQEGDFPVAESLSK---RSLALPMFPELRDDEIKEVVDTIALFL 377
                                       +      +A  +   L +   + + + +    
Sbjct: 337 NAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLA 396


>1c8nA [b.121.4] COAT PROTEIN
          Length = 189

 Score = 76.8 bits (188), Expect = 1e-16
 Identities = 17/164 (10%), Positives = 36/164 (21%), Gaps = 8/164 (4%)

Query: 54  VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDL 113
             +A       + L A        + T    +        R+            T  M L
Sbjct: 15  TPIALAYTVQSLPLIATQ---PAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTVAMCL 71

Query: 114 NQLEHVLKKEKVKAII-----PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKF 168
           +   + +       +               D  A+          I  D   +   +  +
Sbjct: 72  SYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWY 131

Query: 169 SSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEE 212
           S+       ++       F P         G  +     +I  +
Sbjct: 132 STIGTAAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIFFK 175


>3ecdB [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
          Length = 389

 Score = 76.7 bits (187), Expect = 1e-16
 Identities = 48/393 (12%), Positives = 102/393 (25%), Gaps = 41/393 (10%)

Query: 7   LTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIA 66
           L  +   +RG IL  +++  S   +I  EN+       A  + + +        +   +A
Sbjct: 10  LAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYADEVEALA 69

Query: 67  LRAM-----GVEKGDTVVTTPYTFFATASAPYRLGARVI--------FVDVDESTFNMDL 113
           +  +              +      A   A  + G  V+           V   T  +D 
Sbjct: 70  IERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVSRDTMLIDY 129

Query: 114 NQLEHVLKKEK-VKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGE 172
           +Q+E + ++ K    I     + R +D      + +  G  ++ D A   G         
Sbjct: 130 DQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG---- 185

Query: 173 IRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGY 232
            R +  V  A + +    K L     G ++  + +   + +  +                
Sbjct: 186 -RHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPG-----------PL 233

Query: 233 NSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFH 292
              +     A         + + +     A+    + +   + +V            +  
Sbjct: 234 MHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTG---GTDNHLLLVD 290

Query: 293 QYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFR---DLGYQEGDFP-----V 344
                                       + P    +    R     G   G        V
Sbjct: 291 LRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREV 350

Query: 345 AESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
              + +   AL   PE      + V   I    
Sbjct: 351 GRLILEVFEALRTNPEGDHATEQRVRREIFALC 383


>2dgmE [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
          Length = 450

 Score = 76.0 bits (185), Expect = 2e-16
 Identities = 22/266 (8%), Positives = 52/266 (19%), Gaps = 18/266 (6%)

Query: 41  EEEIASFTGVKHGVGVASGSDALLIALRAMGV--EKGDTVVTTPYTFFATASAPYRLGAR 98
           +    +  G      +   +       R            +                   
Sbjct: 115 QAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVE 174

Query: 99  VIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRT---------VDLEALSFLREK 149
           +  + +      MD  ++      E    ++P      T          D          
Sbjct: 175 LREIPMRPGQLFMDPKRMIEAC-DENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTG 233

Query: 150 YGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
             + +  D A         +   +     +      S    K        G ++   +E 
Sbjct: 234 IDIDMHIDAASGGFLAPFVAPDIVWDFR-LPRVKSISASGHKFGLAPLGCGWVIWRDEEA 292

Query: 210 AEESRILRVH---GARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQ 266
             +  +  V    G    +         ++   +   LR+      +      +VA    
Sbjct: 293 LPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLA 352

Query: 267 KLFEEKKLPVVYPRVEEKGFRYHVFH 292
                 KL         +        
Sbjct: 353 DEI--AKLGPYEFICTGRPDEGIPAV 376


>2dgmC [x.x.x] GLUTAMATE DECARBOXYLASE BETA
          Length = 454

 Score = 75.6 bits (184), Expect = 2e-16
 Identities = 29/310 (9%), Positives = 68/310 (21%), Gaps = 32/310 (10%)

Query: 13  RIRGEILNAIDKLISSGNVI--LGENVRRLEEEIASFTGVKHGVGVAS-------GSDAL 63
            +   +  +I+K                R    +A            +        S+A 
Sbjct: 69  NVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEAC 128

Query: 64  LIALRA-----------MGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMD 112
           ++   A            G       +                   +  + +      MD
Sbjct: 129 MLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMD 188

Query: 113 LNQLEHVLKKEKVKAII--PVHLFGRTVDLEALSFLRE------KYGVMILEDCAQSMGS 164
             ++     +  +  +    V   G     + L    +         + +  D A   G 
Sbjct: 189 PKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAAS-GGF 247

Query: 165 EWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD-GGMIVTNSDEIAEESRILR--VHGA 221
              F + +I     +      S    K        G +I  + + + +E       + G 
Sbjct: 248 LAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQ 307

Query: 222 RKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRV 281
              +         ++   +   LR+      +      +VA        +          
Sbjct: 308 IGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTG 367

Query: 282 EEKGFRYHVF 291
                   V 
Sbjct: 368 RPDEGIPAVC 377


>3e6gB [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
          Length = 336

 Score = 74.9 bits (183), Expect = 4e-16
 Identities = 34/188 (18%), Positives = 66/188 (35%), Gaps = 19/188 (10%)

Query: 36  NVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRL 95
                E  +A+  G       ASG  A    +  +    G  VV     +  T     R+
Sbjct: 17  TRFAYERCVAALEGGTRAFAFASGMAATSTVMELLD--AGSHVVAMDDLYGGTFRLFERV 74

Query: 96  GARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII---PVHLFGRTVDLEALSFLREKYGV 152
             R   +D        D    +  + +   K +    P +   + VD+ A++ +  K+G+
Sbjct: 75  RRRTAGLDFSF-VDLTDPAAFKAAI-RADTKMVWIETPTNPMLKLVDIAAIAVIARKHGL 132

Query: 153 MILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD---GGMIVTNSDEI 209
           + + D   +           + +      A +     TK L  + D   G  +V ++ E+
Sbjct: 133 LTVVDNTFASP---------MLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAEL 183

Query: 210 AEESRILR 217
           AE+   L+
Sbjct: 184 AEQMAFLQ 191


>3ei9A [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 412

 Score = 74.7 bits (182), Expect = 4e-16
 Identities = 29/259 (11%), Positives = 58/259 (22%), Gaps = 15/259 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                + +      G+       S      I+   +      T+     ++ A   +   
Sbjct: 84  PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVI 143

Query: 95  LGARVIFVDVDESTFNM-----DLNQLEHVLKKEK-----VKAIIPVHLFGRTVDLEALS 144
           +G    F    +   N+                       +    P +  G     E L+
Sbjct: 144 MGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLT 203

Query: 145 FLRE---KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGM 201
            L E   K G +I+ D A         +   I +     + A+ +   +   G  G    
Sbjct: 204 QLVEFAKKNGSIIVYDSAY-AMYMSDDNPRSIFEIPGAEEVAMETASFSNYAGFTGVRLG 262

Query: 202 IVTNSDEIAEE-SRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
                 ++       +     R          N       A +    L  + +       
Sbjct: 263 WTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKE 322

Query: 261 VARTYQKLFEEKKLPVVYP 279
                   F      V   
Sbjct: 323 NTNIIIDTFTSLGYDVYGG 341


>1bw9A [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
          Length = 350

 Score = 74.7 bits (183), Expect = 4e-16
 Identities = 23/174 (13%), Positives = 40/174 (22%), Gaps = 10/174 (5%)

Query: 45  ASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDV 104
              T +  G+G   GS A L A  A          T                  V+    
Sbjct: 174 DGLTVLVQGLGAVGGSLASLAA-EAGAQLLVADTDTERVAHAVALGHTAVALEDVLSTPC 232

Query: 105 DESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGS 164
           D          +   + +  +   +        +  EA S +    G++   D   + G 
Sbjct: 233 DVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIADEAASDILHARGILYAPDFVANAG- 290

Query: 165 EWKFSSGE------IRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEE 212
                 G                A   +      +    DG      +  +A  
Sbjct: 291 GAIHLVGREVLGWSESVVHERAVAIGDTLNQVFEISD-NDGVTPDEAARTLAGR 343


>3dzzB [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
          Length = 374

 Score = 74.3 bits (181), Expect = 5e-16
 Identities = 33/264 (12%), Positives = 66/264 (25%), Gaps = 18/264 (6%)

Query: 27  SSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFF 86
            S      + V   EE        +     ASG    + A+R         +V  P   F
Sbjct: 53  ESVPAEYYKAVADWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNF 112

Query: 87  ATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDLEALSF 145
            +             +  + S ++++   LE  L    V+    P +  G     E +  
Sbjct: 113 YSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLATPSVRVFCNPHNPIGYAWSEEEVKR 172

Query: 146 LRE---KYGVMILEDCAQSMGSEW--KFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
           + E   K+ V+++ D             +        +           T N        
Sbjct: 173 IAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSTFN-LAALHAA 231

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAI--LRVKLRYLERWTEER 258
             +  + ++   +                      L  I AAI        +L    +  
Sbjct: 232 CAIIPNPDLRARAEESFFLA---------GIGEPNLLAIPAAIAAYEEGHDWLRELKQVL 282

Query: 259 TRVARTYQKLFEEKKLPVVYPRVE 282
                  ++   ++   V      
Sbjct: 283 RDNFAYAREFLAKEVPEVKVLDSN 306


>3e6gD [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
          Length = 335

 Score = 73.0 bits (178), Expect = 1e-15
 Identities = 34/188 (18%), Positives = 66/188 (35%), Gaps = 19/188 (10%)

Query: 36  NVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRL 95
                E  +A+  G       ASG  A    +  +    G  VV     +  T     R+
Sbjct: 16  TRFAYERCVAALEGGTRAFAFASGMAATSTVMELLD--AGSHVVAMDDLYGGTFRLFERV 73

Query: 96  GARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII---PVHLFGRTVDLEALSFLREKYGV 152
             R   +D        D    +  + +   K +    P +   + VD+ A++ +  K+G+
Sbjct: 74  RRRTAGLDFSF-VDLTDPAAFKAAI-RADTKMVWIETPTNPMLKLVDIAAIAVIARKHGL 131

Query: 153 MILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD---GGMIVTNSDEI 209
           + + D   +           + +      A +     TK L  + D   G  +V ++ E+
Sbjct: 132 LTVVDNTFASP---------MLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAEL 182

Query: 210 AEESRILR 217
           AE+   L+
Sbjct: 183 AEQMAFLQ 190


>3dzzA [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
          Length = 375

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 30/271 (11%), Positives = 62/271 (22%), Gaps = 16/271 (5%)

Query: 28  SGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFA 87
           S      + V   EE        +     ASG    + A+R         +V  P   F 
Sbjct: 54  SVPAEYYKAVADWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFY 113

Query: 88  TASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV-----DLEA 142
           +             +  + S ++++   LE  L       +               +++ 
Sbjct: 114 SVIEGNGRRVISSDLIYENSKYSVNWADLEEKL-ATPSVRVFCNPHNPIGYAWSEEEVKR 172

Query: 143 LSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMI 202
           ++ L  K+ V+++ D                          + S                
Sbjct: 173 IAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSTFNLAALHAAC 232

Query: 203 VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVA 262
               +               ++ F         L  I AAI        +   E +  + 
Sbjct: 233 AIIPNPDLRA--------RAEESFFLAGIGEPNLLAIPAAI-AAYEEGHDWLRELKQVLR 283

Query: 263 RTYQKLFEE-KKLPVVYPRVEEKGFRYHVFH 292
             +    E   K       ++          
Sbjct: 284 DNFAYAREFLAKEVPEVKVLDSNASYLAWVD 314


>3ecdA [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
          Length = 387

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 40/341 (11%), Positives = 75/341 (21%), Gaps = 36/341 (10%)

Query: 40  LEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARV 99
             E +       H             A+     + GDTV+                    
Sbjct: 68  AIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFN-------------A 114

Query: 100 IFVDVDESTFNMDLNQL-EHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDC 158
           +   V   T  +D +Q+     + +    I     + R +D      + +  G  ++ D 
Sbjct: 115 LQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDM 174

Query: 159 AQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRV 218
           A   G          R +  V  A + +    K L     G  ++TN +EIA++      
Sbjct: 175 AHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLRGPRGGF-VLTNDEEIAKKINSAVF 228

Query: 219 HGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK-LFEEKKLPVV 277
                            +     A         + + +     A+     L       V 
Sbjct: 229 GP-----------LMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVT 277

Query: 278 YPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFR---- 333
                                                         +   ++        
Sbjct: 278 GGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTT 337

Query: 334 DLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                     V   + +   AL   PE      + V   I 
Sbjct: 338 RGFGAAEFREVGRLILEVFEALRTNPEGDHATEQRVRREIF 378


>2douB [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
          Length = 368

 Score = 72.1 bits (176), Expect = 2e-15
 Identities = 29/248 (11%), Positives = 66/248 (26%), Gaps = 18/248 (7%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
           R  E         +       GS   L  L     E  D ++     + +   A      
Sbjct: 67  RWYEGRYGVGLDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASL 126

Query: 98  RVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRT------VDLEALSFLREKYG 151
           R   + + E     DL  +   +   + K ++  +    T         E    L  K+G
Sbjct: 127 RTFLIPLRE-DGLADLKAVPEGV-WREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHG 184

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
           + ++ D        ++  +          +  +  F  +K+    G        S+E   
Sbjct: 185 LWLIHDNPYVDQV-YEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEA-- 241

Query: 212 ESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                 +    +          + +  +    L+     +  +       A    +  + 
Sbjct: 242 ------LARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKG 295

Query: 272 KKLPVVYP 279
             L ++ P
Sbjct: 296 -VLSLLPP 302


>1c8eA [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
          Length = 534

 Score = 71.4 bits (173), Expect = 4e-15
 Identities = 8/124 (6%), Positives = 32/124 (25%), Gaps = 11/124 (8%)

Query: 53  GVGVASGSDALLIALRAM---------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVD 103
           GVG+++G+       + +            +   +       +            V    
Sbjct: 1   GVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVNNMDKTAVKGNM 60

Query: 104 VDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVD-LEALSFLREKYGVMILEDCAQSM 162
             +   ++++     ++             +   V+ +  L  +  +  +  +     S 
Sbjct: 61  ALD-DIHVEIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSE 119

Query: 163 GSEW 166
            +  
Sbjct: 120 SATQ 123


>2e7jA [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
          Length = 344

 Score = 70.5 bits (171), Expect = 8e-15
 Identities = 27/268 (10%), Positives = 77/268 (28%), Gaps = 21/268 (7%)

Query: 17  EILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGD 76
           ++     + +             +  ++  F G           +A    + ++  +   
Sbjct: 13  KLTEEARQALLEWP----PIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAW 68

Query: 77  TVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPV----- 131
            V+     + +  +A        +    D   + +        +++ K +  + +     
Sbjct: 69  VVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITY 128

Query: 132 --HLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFP 189
               +G   D++ ++ +  +Y V +L + A ++G         +  S     A       
Sbjct: 129 PDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGR--------MPVSLKEIGADFIVGSG 180

Query: 190 TKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLR 249
            K++   G  G++    +      R       + K              I        +R
Sbjct: 181 HKSMAASGPIGVMGMKEEWAEIVLRRS--EKYKNKEVELLGCTARGATIITLMASFPHVR 238

Query: 250 YLERWTEERTRVARTYQKLFEEKKLPVV 277
              +  +E    AR +    E+  +  +
Sbjct: 239 ERIKRWDEEVEKARRFAAEMEKLGIKQL 266


>2bwoD [x.x.x] 5-AMINOLEVULINATE SYNTHASE
          Length = 397

 Score = 70.4 bits (171), Expect = 8e-15
 Identities = 30/249 (12%), Positives = 72/249 (28%), Gaps = 13/249 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
              RRLE EIA     +  +  +S  +A    L  +       ++    +    +     
Sbjct: 91  AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLR-VLFPGLIIYSDSLNHASMIEGI 149

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLF---GRTVDLEALSFLREKYG 151
                       +        +         K I    ++   G    ++ +  + E++G
Sbjct: 150 KRNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAFESVYSMDGDFGPIKEICDIAEEFG 208

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
            +   D   ++G      +G   + G +    IF+    K  G +G          +   
Sbjct: 209 ALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVD--- 265

Query: 212 ESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                 V      +        +      A+I  +K    ++  + +   A+  +   + 
Sbjct: 266 -----AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKA 320

Query: 272 KKLPVVYPR 280
             +P++   
Sbjct: 321 LGMPIIDHG 329


>3eiaA [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 412

 Score = 69.7 bits (169), Expect = 1e-14
 Identities = 26/259 (10%), Positives = 55/259 (21%), Gaps = 15/259 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                + +      G+       S      I+   +      T+     ++ A   +   
Sbjct: 84  PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVI 143

Query: 95  LGARVIFVDVDESTFNM-----DLNQLEHVLKK--EKVKAIIPVHL------FGRTVDLE 141
           +G    F    +   N+                   +   I                 L 
Sbjct: 144 MGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLT 203

Query: 142 ALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGM 201
            L    +K G +I+ D A +M          I +     + A+ +   ++  G  G    
Sbjct: 204 QLVEFAKKNGSIIVYDSAYAMYMSDDNPRS-IFEIPGAEEVAMETASFSQYAGFTGVRLG 262

Query: 202 IVTNSDEIAEESRILRVHGARKKY-FHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
                 ++             +          N       A +    L  + +       
Sbjct: 263 WTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKE 322

Query: 261 VARTYQKLFEEKKLPVVYP 279
                   F      V   
Sbjct: 323 NTNIIIDTFTSLGYDVYGG 341


>1djeA [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
          Length = 383

 Score = 69.4 bits (169), Expect = 2e-14
 Identities = 42/274 (15%), Positives = 89/274 (32%), Gaps = 34/274 (12%)

Query: 10  QYERIRGEILNAIDKL-ISSGNV--ILGENV--RRLEEEIASFTGVKHGVGVASGSDALL 64
            + +I        ++  I SG    + G +V  + LEEE+A + G    +   SG  A  
Sbjct: 53  HHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQ 112

Query: 65  IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLK--K 122
             + AM + K D +     +  +   A     +++          + D+  L  +L    
Sbjct: 113 AVIAAM-MAKEDRIAADRLSHASLLEAASLSPSQLRRFA------HNDVTHLARLLASPC 165

Query: 123 EKVKAIIPVHLFGRT---VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSV 179
              + ++   +F        L  +  + +++   ++ D A   G   +   G        
Sbjct: 166 PGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVK 225

Query: 180 GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEI 239
            +  + +F        +G  G  V  S  +A+                    Y++ +   
Sbjct: 226 PELLVVTF-----GKGFGVSGAAVLCSSTVADYLLQ-FARHLI---------YSTSMPPA 270

Query: 240 HAAILRVKLRYL--ERWTEERTRVARTYQKLFEE 271
            A  LR  L  +  +     R ++A    +    
Sbjct: 271 QAQALRASLAVIRSDEGDARREKLAALITRFRAG 304


>2c44B [x.x.x] TRYPTOPHANASE
          Length = 467

 Score = 69.4 bits (168), Expect = 2e-14
 Identities = 34/281 (12%), Positives = 77/281 (27%), Gaps = 39/281 (13%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVAS--------GSDALLIALRAMGVEKGDTVVTTPYTFF 86
            +   L E + +  G ++ +                +    +  G+++   V  + Y F 
Sbjct: 74  RSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFD 133

Query: 87  ATASAPYRLGARVIFVDVDEST---------FNMDLNQLEHVLKK---EKVKAIIPVHLF 134
            T       G  V  V + E+           N DL  LE  +++     V  I+     
Sbjct: 134 TTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLEGLERGIEEVGPNNVPYIVATITS 193

Query: 135 G-------RTVDLEALSFLREKYGVMILEDCAQSM----GSEWKFSSGEIRKSGSV---- 179
                      +L+A+  + +KY + ++ D A+        + + +  +      +    
Sbjct: 194 NSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIEQITRET 253

Query: 180 -GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDE 238
              A + +    K+      GG++    D   +                           
Sbjct: 254 YKYADMLAMSAKKDAM-VPMGGLLCMKDDSFFD--VYTECRTLCVVQEGFPTYGGLEGGA 310

Query: 239 IHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYP 279
           +    + +       W   R    +      EE  +     
Sbjct: 311 MERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA 351


>3dydB [x.x.x] TYROSINE AMINOTRANSFERASE
          Length = 387

 Score = 69.3 bits (168), Expect = 2e-14
 Identities = 24/249 (9%), Positives = 55/249 (22%), Gaps = 9/249 (3%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
           E +        +    K  +  +  S A+ + L  +    G  ++     F    +    
Sbjct: 63  EEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLA-VLANPGQNILVPRPGFSLYKTLAES 121

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLRE 148
           +G  V   ++          +    L  EK   +I  +             L+ +  +  
Sbjct: 122 MGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAA 181

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
           +  V IL D               +    +            + L      G I+ +   
Sbjct: 182 RQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRR 241

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
               + I        +              + + + R    +           A      
Sbjct: 242 DIFGNEIRDGLVKLSQRIL--GPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGA 299

Query: 269 FEEKKLPVV 277
                    
Sbjct: 300 LAAIPGLRP 308


>2c44A [x.x.x] TRYPTOPHANASE
          Length = 466

 Score = 68.2 bits (165), Expect = 4e-14
 Identities = 46/402 (11%), Positives = 103/402 (25%), Gaps = 51/402 (12%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHG--------VGVASGSDAL 63
             +   +  A+ +   + +         L E + +  G ++                  +
Sbjct: 53  GAVTQSMQAAMMRGDEAYSGSRS--YYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLI 110

Query: 64  LIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDEST---------FNMDLN 114
               +  G+++   V  + Y F  T       G  V  V + E+           N DL 
Sbjct: 111 KKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLE 170

Query: 115 QLEHVLKK---EKVKAII--PVHLFGRTV-----DLEALSFLREKYGVMILEDCAQSMG- 163
            LE  +++     V  I+                +L+A+  + +KY + ++ D A+    
Sbjct: 171 GLERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAEN 230

Query: 164 --------SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRI 215
                   +E+K  + E     +   A + +    K+      G + + +       +  
Sbjct: 231 AYFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTEC 290

Query: 216 LRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLP 275
             +   +                +    + +       W   R    +      EE  + 
Sbjct: 291 RTLCVVQ---EGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVV 347

Query: 276 VVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDL 335
                     F                            GI       + +      RD 
Sbjct: 348 CQQAG-GHAAFVDAGKLLPHIPADQFPAQALACELYKVAGI-----RAVEIGSFLLGRDP 401

Query: 336 GYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
              +     AE L    L +P         +  +++      
Sbjct: 402 KTGKQLPCPAELL---RLTIP-RATYTQTHMDFIIEAFKHVK 439


>1ay4B [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
          Length = 389

 Score = 68.1 bits (165), Expect = 4e-14
 Identities = 31/249 (12%), Positives = 64/249 (25%), Gaps = 20/249 (8%)

Query: 41  EEEIASFTGVKHGVGVAS---------GSDALLIALRAMGVEKGDTVVTTPYTFFATASA 91
           ++ +             +         G+    + L  M        V+ P      +  
Sbjct: 70  QKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIM 129

Query: 92  PYRLGARVIFVDVDESTFNMDLNQLEHVLKK--EKVKAII------PVHLFGRTVDLEAL 143
            +       +   D  T  +D   ++  L    +    ++      P            +
Sbjct: 130 NFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEI 189

Query: 144 SFLREKYGVMILEDCAQS-MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMI 202
           + + EK G + L D A    G   +  +   R   S     + +   +KN G Y +    
Sbjct: 190 ASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGC 249

Query: 203 VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVA 262
           +      A         GA      +   +         + +         W  E   V 
Sbjct: 250 LLALCADAA--TRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVR 307

Query: 263 RTYQKLFEE 271
               +L E+
Sbjct: 308 SGMLRLREQ 316


>2bwpB [x.x.x] 5-AMINOLEVULINATE SYNTHASE
          Length = 396

 Score = 67.9 bits (165), Expect = 4e-14
 Identities = 33/212 (15%), Positives = 72/212 (33%), Gaps = 20/212 (9%)

Query: 10  QYERIRGEILNAIDKLI--SSGNVILGEN---VRRLEEEIASFTGVKHGVGVASGSDALL 64
           Q+  +   +  A++ +   S G   +       RRLE EIA     +  +  +S  +A  
Sbjct: 61  QHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNAND 120

Query: 65  IALRAMG-VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKK- 122
             L  +  +  G  + +      +      R               + D+  L  ++   
Sbjct: 121 ATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFR------HNDVAHLRELIAAD 174

Query: 123 -EKVKAIIPV----HLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSG 177
                 +I       + G    ++ +  + E++G +   D   ++G      +G   + G
Sbjct: 175 DPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDG 234

Query: 178 SVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
            +    IF+    K  G +  GG I  ++  +
Sbjct: 235 LMHRIDIFNGTLAKAYGVF--GGYIAASARMV 264


>1bs0A [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
          Length = 383

 Score = 67.9 bits (165), Expect = 5e-14
 Identities = 35/270 (12%), Positives = 83/270 (30%), Gaps = 30/270 (11%)

Query: 10  QYERIRGEILNAIDKL-ISSGNV--ILGENV--RRLEEEIASFTGVKHGVGVASGSDALL 64
            + +I        ++  I SG    + G +V  + LEEE+A + G    +   SG  A  
Sbjct: 53  HHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQ 112

Query: 65  IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLK--K 122
             + AM + K D +     +  +   A     +++          + D+  L  +L    
Sbjct: 113 AVIAAM-MAKEDRIAADRLSHASLLEAASLSPSQLRRFA------HNDVTHLARLLASPC 165

Query: 123 EKVKAIIPVHLFGRT---VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSV 179
              + ++   +F        L  +  + +++   ++ D A   G   +   G        
Sbjct: 166 PGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQK-- 223

Query: 180 GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEI 239
               +      K  G  G   +          +  +           +      ++   +
Sbjct: 224 VKPELLVVTFGKGFGVSGAAVLC----SSTVADYLLQFARH----LIYSTSMPPAQAQAL 275

Query: 240 HAAILRVKLRYLERWTEERTRVARTYQKLF 269
            A++    +   +     R ++A    +  
Sbjct: 276 RASL---AVIRSDEGDARREKLAALITRFR 302


>1bj4A [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
          Length = 470

 Score = 67.4 bits (163), Expect = 6e-14
 Identities = 31/356 (8%), Positives = 71/356 (19%), Gaps = 29/356 (8%)

Query: 41  EEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVI 100
           +            V   SGS A      A+  E    ++          +  +    + I
Sbjct: 92  QAYKLDPQCWGVNVQPYSGSPANFAVYTALV-EPHGRIMGLDLPDGGHLTHGFMTDKKKI 150

Query: 101 FVDVDES-------TFNMDLNQLEHVLKK--EKVKAIIP--VHLFGRTVDLEALSFLREK 149
                           +      + + +        +I      + R ++   L  + ++
Sbjct: 151 SATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADE 210

Query: 150 YGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
            G  ++ D A   G              S  +        T         GMI       
Sbjct: 211 NGAYLMADMAHISGLVA------AGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVK 264

Query: 210 AEESRILRVHG----ARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTY 265
           + +    +       +               +   A +     + +    +         
Sbjct: 265 SVDPATGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVAN 324

Query: 266 QKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLP 325
            +   E    + Y  V      + +                          +        
Sbjct: 325 CRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRS 384

Query: 326 LHLQKCFR-------DLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIA 374
                  R         G  E DF        R + L +  +        + +   
Sbjct: 385 ALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVAATLKEFKE 440


>2dgkA [x.x.x] GLUTAMATE DECARBOXYLASE BETA
          Length = 438

 Score = 67.1 bits (162), Expect = 8e-14
 Identities = 21/258 (8%), Positives = 51/258 (19%), Gaps = 12/258 (4%)

Query: 41  EEEIASFTGVKHGVGVASGSDALLI--ALRAMGVEKGDTVVTTPYTFFATASAPYRLGAR 98
           +    +  G      +   +        + A G       +                   
Sbjct: 89  QAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVE 148

Query: 99  VIFVDVDESTFNMDLNQLEHVLKKEK--VKAIIPVHLFGRTVDLEALSFLREKYGVMILE 156
           +  + +      MD  ++     +    V     V   G     + L    +K+      
Sbjct: 149 LREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGI 208

Query: 157 DCAQSMG---SEWKFSSGEIRKSGSVG--DAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
           D    +      +                     S    K        G ++   +E   
Sbjct: 209 DIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALP 268

Query: 212 ESRILRV---HGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
           +  +  V    G    +         ++   +   LR+      +      +VA      
Sbjct: 269 QELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADE 328

Query: 269 FEEKKLPVVYPRVEEKGF 286
             +               
Sbjct: 329 IAKLGPYEFICTGRPDEG 346


>1ax4A [c.67.1] TRYPTOPHANASE
          Length = 464

 Score = 67.1 bits (162), Expect = 8e-14
 Identities = 33/400 (8%), Positives = 105/400 (26%), Gaps = 45/400 (11%)

Query: 11  YERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHGVGVASGSDALLIALR 68
            +     + +     + +G+     +     L+++        + +    G  A  I   
Sbjct: 49  TDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFP 108

Query: 69  AMG------VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDE---------STFNMDL 113
            +        +  + V  + + F  TA+     G + I +  ++            + D+
Sbjct: 109 VLLKYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDI 168

Query: 114 NQLEHVLKKEKVKAIIPVHL----------FGRTVDLEALSFLREKYGVMILEDCAQS-M 162
            +L+  + +     I+ +                 +L+ +  + +++G+ ++ D A+   
Sbjct: 169 KKLKENIAQHGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCE 228

Query: 163 GSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRIL--RVHG 220
            + +  +     K+ ++ +     +     L       ++         ++  +      
Sbjct: 229 NAYFIKARDPKYKNATIKEVIFDMYKYADALTMSAKDPLLNIGGLVAIRDNEEIFTLARQ 288

Query: 221 ARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR 280
                            ++ A +  ++    E +   R    +       E  +P+ YP 
Sbjct: 289 RCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPT 348

Query: 281 VEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGI--QTAIYYPLPLHLQKCFRDLGYQ 338
                F                            G+       + L              
Sbjct: 349 GGHAVFVDCKKLVPQIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRD----------- 397

Query: 339 EGDFPVAESLSKRSLALPMFPE-LRDDEIKEVVDTIALFL 377
                  +      + L +      +D +  + D +    
Sbjct: 398 -PATGEQKHADMEFMRLTIARRVYTNDHMDYIADALIGLK 436


>2bwpA [x.x.x] 5-AMINOLEVULINATE SYNTHASE
          Length = 398

 Score = 67.0 bits (162), Expect = 9e-14
 Identities = 31/249 (12%), Positives = 72/249 (28%), Gaps = 13/249 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
              RRLE EIA     +  +  +S  +A    L  +       ++    +    +     
Sbjct: 91  AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLR-VLFPGLIIYSDSLNHASMIEGI 149

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHL---FGRTVDLEALSFLREKYG 151
                       +        +         K I    +    G    ++ +  + E++G
Sbjct: 150 KRNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAFESVYSMDGDFGPIKEICDIAEEFG 208

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
            +   D   ++G      +G   + G +    IF+    K  G +G            A 
Sbjct: 209 ALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYI--------AAS 260

Query: 212 ESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
              +  V      +        +      A+I  +K    ++  + +   A+  +   + 
Sbjct: 261 ARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKA 320

Query: 272 KKLPVVYPR 280
             +P++   
Sbjct: 321 LGMPIIDHG 329


>2ch2A [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
          Length = 386

 Score = 67.0 bits (162), Expect = 9e-14
 Identities = 26/287 (9%), Positives = 74/287 (25%), Gaps = 27/287 (9%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
           +R+   + N +     +      + V+     I             S    +   L  + 
Sbjct: 29  KRVLTAMTNTVLSNFHAELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLSNL- 87

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD-ESTFNMDLNQLEHVLKKEKVKAIIP 130
           +E+GD V+      +A  +             ++        L  L   ++  + K +  
Sbjct: 88  LEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFL 147

Query: 131 VHLFGRT---VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSF 187
            H    +     LE +  +  ++  +++ D   S+          +       +      
Sbjct: 148 THGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCG--------VPFYMDKWEIDAVYT 199

Query: 188 FPTKNLGTYGDGGMIVT--------------NSDEIAEESRILRVHGARKKYFHEKVGYN 233
                    G   + ++                                +   +     +
Sbjct: 200 GAQVLGAPPGITPISISPKALDVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRYHHTVAS 259

Query: 234 SRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR 280
           + +  +  A+ ++    LE   + R   A+   +   +  L +    
Sbjct: 260 NLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKD 306


>2cstA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 411

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 27/225 (12%), Positives = 56/225 (24%), Gaps = 16/225 (7%)

Query: 52  HGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNM 111
            G G        L             V  +  T+    S     G + I           
Sbjct: 106 GGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKR 165

Query: 112 --DLNQLEHVLKK--EKVKAIIPVHLFGRTVDLEALSFLRE------KYGVMILEDCAQS 161
             DL  L   ++K  E    I+       T         ++      +  +    D A  
Sbjct: 166 GLDLQGLLDDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQ 225

Query: 162 MGSEW--KFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVH 219
             +       +  +R   S G     +   +KN G Y +    ++   +  +    ++  
Sbjct: 226 GFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDN---VQRV 282

Query: 220 GARKKYFHEKVGYNSRLDEIHAAILRVKL-RYLERWTEERTRVAR 263
            ++ +        N            +   +    W +    +A 
Sbjct: 283 LSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMAD 327


>1ay4A [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
          Length = 394

 Score = 65.8 bits (159), Expect = 2e-13
 Identities = 34/277 (12%), Positives = 72/277 (25%), Gaps = 25/277 (9%)

Query: 17  EILNAIDKLISSGNVIL---GENVRRLEEEIASFTGVKHGVGVAS---------GSDALL 64
            +  A  +++ +               ++ +             +         G+    
Sbjct: 48  AVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQA 107

Query: 65  IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDV-DESTFNMDLNQLEHVLKKE 123
           + L  M       V  +  T+    S    +G  V      D  T  +D   ++  L   
Sbjct: 108 LELARMA-NPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAA 166

Query: 124 KVKAIIPVH---------LFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIR 174
           K   ++ +H                 E  S L +   + +++   Q  G   +  +   R
Sbjct: 167 KKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTR 226

Query: 175 KSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNS 234
              S     + +   +KN G Y +    +      A         GA      +   +  
Sbjct: 227 LIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAA--TRELAQGAMAFLNRQTYSFPP 284

Query: 235 RLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                  + +         W  E   V     +L E+
Sbjct: 285 FHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQ 321


>3bh1A [x.x.x] UPF0371 PROTEIN DIP2346
          Length = 486

 Score = 65.7 bits (158), Expect = 2e-13
 Identities = 19/143 (13%), Positives = 40/143 (27%), Gaps = 21/143 (14%)

Query: 70  MGVEKGDTVVTTPYTFFATAS-APYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAI 128
             +E  D  + T  T       +   L A      +D++   +    +E  ++  K   +
Sbjct: 359 CAIELVDGSIITGATSDLLGCSSSMLLNALKHLAGIDDAIHLLSPESIEP-IQTLKTVHL 417

Query: 129 I---PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIF 185
               P       +   ++S   +      L+      G +               D  IF
Sbjct: 418 GSSNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRGCDVH-----TTTILGSVDEGIF 472

Query: 186 SFFPTKNLGTYGDGGMIVTNSDE 208
                         G++VT+  +
Sbjct: 473 RN-----------LGVLVTSDPK 484


>2dgmA [x.x.x] GLUTAMATE DECARBOXYLASE BETA
          Length = 452

 Score = 65.2 bits (157), Expect = 3e-13
 Identities = 27/310 (8%), Positives = 65/310 (20%), Gaps = 38/310 (12%)

Query: 17  EILNAIDKLISSGNV------ILGENVRRLEEEIASFTGVKHG-------VGVASGSDAL 63
            +   +D  I+   +             R    +A                     S+A 
Sbjct: 69  NVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEAC 128

Query: 64  LIALRAM-----------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMD 112
           ++   AM           G       +                   +  + +      MD
Sbjct: 129 MLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMD 188

Query: 113 LNQLEHVLKKEKVKAII--PVHLFGRTVDLEALSFLRE------KYGVMILEDCAQSMGS 164
             ++     +  +  +    V   G     + L    +         + +  D A     
Sbjct: 189 PKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFL 248

Query: 165 EWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVH---GA 221
               +   +     +      S    K        G ++   +E   +  +  V    G 
Sbjct: 249 APFVAPDIVWDFR-LPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQ 307

Query: 222 RKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRV 281
              +         ++   +   LR+      +      +VA        +  L       
Sbjct: 308 IGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAK--LGPYEFIC 365

Query: 282 EEKGFRYHVF 291
             +       
Sbjct: 366 TGRPDEGIPA 375


>1bjwA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 381

 Score = 65.0 bits (157), Expect = 3e-13
 Identities = 34/239 (14%), Positives = 63/239 (26%), Gaps = 25/239 (10%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLG 96
             +   E       +  +    G  AL    +A+ ++ GD V+     + +        G
Sbjct: 78  AEKFRRENGLSVTPEETIVTVGGKQALFNLFQAI-LDPGDEVIVLSPYWVSYPEMVRFAG 136

Query: 97  ARVIFVDVD-ESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRT------VDLEALSFLREK 149
             V+ V+   E  F  D  ++   +   + KA++       T        LEAL+ L  +
Sbjct: 137 GVVVEVETLPEEGFVPDPERVRRAI-TPRTKALVVNSPNNPTGAVYPKEVLEALARLAVE 195

Query: 150 YGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
           +   ++ D             GE    G V      +          G          E+
Sbjct: 196 HDFYLVSDEIYEHL----LYEGEHFSPGRVAPEHTLTVNGAAAFAMTGWRIGYACGPKEV 251

Query: 210 AEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
            +                      +  D I        L   E            Y++ 
Sbjct: 252 IK------------AMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR 298


>1eghA [c.24.1] METHYLGLYOXAL SYNTHASE
          Length = 152

 Score = 64.8 bits (157), Expect = 4e-13
 Identities = 20/156 (12%), Positives = 43/156 (27%), Gaps = 17/156 (10%)

Query: 45  ASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTP--YTFFATASAPYRLGARVIFV 102
            + T            D     L +  VE+   ++     Y    T +   R     +  
Sbjct: 4   TTRTLPARKHIALVAHDHCKQMLMSW-VERHQPLLEQHVLYATGTTGNLISRATGMNVNA 62

Query: 103 DVDESTFNMDLNQLEHVLKKEKVKAIIPVHL----FGRTVDLEALSFLREKYGVMILEDC 158
            +       D      +  + K+  +I             D++AL  L   + + +  + 
Sbjct: 63  MLSG-PMGGDQQVGALIS-EGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNV 120

Query: 159 AQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLG 194
           A +              + +V D  I  +   + L 
Sbjct: 121 ATADFIIQ-----SPHFNDAV-DILIPDY--QRYLA 148


>3bs8A [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 430

 Score = 64.8 bits (156), Expect = 4e-13
 Identities = 28/280 (10%), Positives = 67/280 (23%), Gaps = 40/280 (14%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG------------------VEKGDTV 78
               +  I     V+    V+SG++A + ALR                      +     
Sbjct: 96  NELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIK 155

Query: 79  VTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLF---- 134
             +         +P                    +         E +  +I   +     
Sbjct: 156 AGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQF-GEDIAGVIVEPVAGNMG 214

Query: 135 GRTVDLEALSFLRE---KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTK 191
                   L  LR+   +YG +++ D   +          +   +              K
Sbjct: 215 VVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRV------DYNCAQGYFGVTPDLTCLGK 268

Query: 192 NLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYL 251
            +G     G     ++ + + +    ++           G    +      + ++     
Sbjct: 269 VIGGGLPVGAYGGKAEIMEQIAPSGPIY-----QAGTLSGNPLAMTAGLETLKQLTPDSY 323

Query: 252 ERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
           + + ++  R+     K  E   +P         G     F
Sbjct: 324 KNFIKKGDRLEEGISKAAEAHGIPHT---FNRAGSMIGFF 360


>2ch1A [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
          Length = 387

 Score = 64.7 bits (156), Expect = 4e-13
 Identities = 28/288 (9%), Positives = 83/288 (28%), Gaps = 33/288 (11%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHG--VGVASGSDALLIALRA 69
           +R+   + N +     +        +  +++ +      ++   + V+  + A + A+ +
Sbjct: 30  KRVLTAMTNTVLSNFHAELF---RTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLS 86

Query: 70  MGVEKGDTVVTTPYTFFATASAPYRLGA--RVIFVDVDESTFNMDLNQLEHVLKKEKVKA 127
             +E+GD V+      +A  +          V  ++         L  L   ++  + K 
Sbjct: 87  NLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRP-FSLETLARAIELHQPKC 145

Query: 128 IIPVHLFGRT---VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAI 184
           +   H    +     LE +  +  ++  +++ D   S+                  +   
Sbjct: 146 LFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVP--------FYMDKWEIDA 197

Query: 185 FSFFPTKNLGTYGDGGM-IVTNSDEIAEESRILRVHGARKKYFHEKV------------- 230
                       G   + I   + ++    R                             
Sbjct: 198 VYTGAQVLGAPPGITPISISPKALDVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRYHHT 257

Query: 231 GYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVY 278
             ++ +  +  A+ ++    LE   + R   A+   +   +  L +  
Sbjct: 258 VASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFV 305


>3e9kA [x.x.x] KYNURENINASE
          Length = 445

 Score = 63.9 bits (154), Expect = 7e-13
 Identities = 29/290 (10%), Positives = 73/290 (25%), Gaps = 39/290 (13%)

Query: 35  ENVRRLEEEIASFTGVKHG----VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATAS 90
                +   +    G        +   + +  LL+        K   ++     F +   
Sbjct: 105 TGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHY 164

Query: 91  APYRLGARV--------IFVDVDESTFNMDLNQLEHVLKK--EKVKAIIPVHLFGRT--- 137
           A                  +   E    + +  +  V++K  + +  I+   +   T   
Sbjct: 165 AIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQH 224

Query: 138 VDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYG 197
            ++ A++   +  G  +  D A ++G+        +       D A +  +   N G  G
Sbjct: 225 FNIPAITKAGQAKGCYVGFDLAHAVGNVE------LYLHDWGVDFACWCSYKYLNAGAGG 278

Query: 198 DGGMIVTN----------------SDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHA 241
             G  +                        +             F         +  +HA
Sbjct: 279 IAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHA 338

Query: 242 AILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
           ++   K   ++   ++   +    + L +     V          R    
Sbjct: 339 SLEIFKQATMKALRKKSVLLTGYLEYLIKHNYGVVNIITPSHVEERGCQL 388


>1bqaA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 395

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 25/232 (10%), Positives = 55/232 (23%), Gaps = 10/232 (4%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
            +    I             +G+  +     A        V  +  ++    S     G 
Sbjct: 84  GKGSALINDKRARTAQTPGGTGALRVAADFLA-KNTSVKRVWVSNPSWPNHKSVFNSAGL 142

Query: 98  RVIFVDVDES-TFNMDLNQLEHVLKKEKVKA---IIPVHLFGRTV-----DLEALSFLRE 148
            V      ++    +D + L + L + +                +       + L+ L  
Sbjct: 143 EVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSV 202

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
           + G + L D A    +       E  ++ +     +       N G Y +     T    
Sbjct: 203 EKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAA 262

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
            +E               +           +   +    LR +        R
Sbjct: 263 DSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR 314


>1eg5B [c.67.1] AMINOTRANSFERASE
          Length = 354

 Score = 63.1 bits (152), Expect = 1e-12
 Identities = 38/291 (13%), Positives = 80/291 (27%), Gaps = 28/291 (9%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVR---RLEEEIASFTGVKHG--VGVASGSDALLIA 66
           +R+  EI+   +K  +  +   G       +  E++A   GV        +  ++++   
Sbjct: 14  DRVLEEIVFYREKYGNPNSAHGGIEANLHEKAREKVAKVLGVSPSEIFFTSCATESINWI 73

Query: 67  LRAM----GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKK 122
           L+ +       K   + T         +     G +V +V VD     + L +LE ++ +
Sbjct: 74  LKTVAETFEKRKRTIITTPIEHKAVLETKYLSKGFKVKYVPVDSRGV-VKLEELEKLVDE 132

Query: 123 EKVKAIIPVH-LFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGD 181
           +     I  +   G    +E ++ + +K     L              S E        +
Sbjct: 133 DTFLVSIAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEKL------E 186

Query: 182 AAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHA 241
               SF   K  G  G G   +     I             +               +  
Sbjct: 187 VDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQ----------NVPG 236

Query: 242 AILRVKLRYLERWTEERTRVARTYQKLFEE-KKLPVVYPRVEEKGFRYHVF 291
            +   +         E  +  +   KL         +   +E         
Sbjct: 237 IVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEISLPNTLSV 287


>3caiA [x.x.x] POSSIBLE AMINOTRANSFERASE
          Length = 396

 Score = 63.0 bits (152), Expect = 1e-12
 Identities = 33/256 (12%), Positives = 68/256 (26%), Gaps = 36/256 (14%)

Query: 42  EEIASFTGVKHGVGVASGSDALLIALRAMG----VEKGDTVVTTPYTFFATASAPYRL-- 95
           E +A       G  V     A+L++L A         G  V+ +     A  +   R   
Sbjct: 66  EAVADLVNADPGGVVLGADRAVLLSLLAEASSSRAGLGYEVIVSRLDDEANIAPWLRAAH 125

Query: 96  --GARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV---DLEALSFLREKY 150
             GA+V + +VD  T  +   Q E ++  +  + +      G      DL A++ L    
Sbjct: 126 RYGAKVKWAEVDIETGELPTWQWESLIS-KSTRLVAVNSASGTLGGVTDLRAMTKLVHDV 184

Query: 151 GVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA 210
           G +++ D + +           +    +  D    +       G    G M+  +   + 
Sbjct: 185 GALVVVDHSAAAPYRL------LDIRETDADVVTVNA--HAWGGPPI-GAMVFRDPSVMN 235

Query: 211 EESRILRVHG---------------ARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWT 255
               +                                 +  +    +        ++   
Sbjct: 236 SFGSVSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAALDESARGSRRERLAVSMQSAD 295

Query: 256 EERTRVARTYQKLFEE 271
               RV          
Sbjct: 296 AYLNRVFDYLMVSLRS 311


>1djuA [c.67.1] AROMATIC AMINOTRANSFERASE
          Length = 375

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 40/267 (14%), Positives = 85/267 (31%), Gaps = 18/267 (6%)

Query: 33  LGENVRRLEEEIASFTGVK--HGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATAS 90
           L E +    ++            + +   + A L+ L A   +  + ++ TP       +
Sbjct: 54  LREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPA 113

Query: 91  APYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALS 144
                G  V     +E  F +++++L+  +  +K +A+I       T       DLE ++
Sbjct: 114 VILAGGKPVEVPTYEEDEFRLNVDELKKYVT-DKTRALIINSPCNPTGAVLTKKDLEEIA 172

Query: 145 FLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVT 204
               ++ ++++ D               I     + +  I     +K     G     V 
Sbjct: 173 DFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVA 232

Query: 205 NSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVART 264
               I E     +++ A       +      L +  +       + +E   +E  R  + 
Sbjct: 233 APSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSW------KAVEEMRKEYDRRRKL 286

Query: 265 YQKLFEEKKLPVVYPRVEEKGFRYHVF 291
             K   E  LP V P   +  F     
Sbjct: 287 VWKRLNEMGLPTVKP---KGAFYIFPR 310


>1ecxB [c.67.1] AMINOTRANSFERASE
          Length = 365

 Score = 62.7 bits (151), Expect = 2e-12
 Identities = 33/247 (13%), Positives = 67/247 (27%), Gaps = 22/247 (8%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGS-----DALLIALRAMGVEKGDTVVTTPYTFFATA 89
            ++ +  E++A   GV       +       + +L  +     ++  T++TTP    A  
Sbjct: 44  LHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVAETFEKRKRTIITTPIEHKAVL 103

Query: 90  SAPYRLGARVIFVDVDESTFN--MDLNQLEHVLKKEKVKAIIPVHL---FGRTVDLEALS 144
                L  +   V          + L +LE ++  E    +  +      G    +E ++
Sbjct: 104 ETMKYLSMKGFKVKYVPVDSRGVVKLEELEKLVD-EDTFLVSIMAANNEVGTIQPVEDVT 162

Query: 145 FLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVT 204
            + +K     L               G+I  S    +    SF   K  G  G G   + 
Sbjct: 163 RIVKKKNKETLVHVDAVQT------IGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIR 216

Query: 205 NSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVART 264
               I                       N       A  + + +  L    +   ++   
Sbjct: 217 KGVPIRPLIHGGGQE-----RGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSK 271

Query: 265 YQKLFEE 271
                  
Sbjct: 272 LVSGLMN 278


>2cfbA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 360

 Score = 62.3 bits (150), Expect = 2e-12
 Identities = 29/252 (11%), Positives = 57/252 (22%), Gaps = 33/252 (13%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                 E  IA+   V+    V SG++A +  LR M        V               
Sbjct: 59  LENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGC--------- 109

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV-------DLEALSFLR 147
                             +++L        +  +I   + G           LE L  L 
Sbjct: 110 -YHGHAATLTAPYNDLEAVSRLFEQYP-NDIAGVILEPVVGNAGFIPPDAGFLEGLRELT 167

Query: 148 EKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSD 207
           ++YG +++ D   +              +              K +G     G     ++
Sbjct: 168 KQYGALLVFDEVMTGFRIAYG------GAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAE 221

Query: 208 EIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
                     +               +    I    +  +    E       ++ +    
Sbjct: 222 ---------IMKMVAPAGPTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLD 272

Query: 268 LFEEKKLPVVYP 279
              E    V   
Sbjct: 273 AAREFGHEVCGG 284


>3bh1D [x.x.x] UPF0371 PROTEIN DIP2346
          Length = 487

 Score = 62.3 bits (149), Expect = 2e-12
 Identities = 13/116 (11%), Positives = 31/116 (26%), Gaps = 20/116 (17%)

Query: 96  GARVIFVDVDESTFNMDLNQLEHVLK---KEKVKAIIPVHLFGRTVDLEALSFLREKYGV 152
            A      +D++   +    +E +          +   +H     +   ++S   +    
Sbjct: 387 NALKHLAGIDDAIHLLSPESIEPIQTLKTVHLGSSNPRLHTDEV-LIALSVSAATDSNAQ 445

Query: 153 MILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
             L+      G +               D  IF              G++VT+  +
Sbjct: 446 KALDQLKNLRGCDVH-----TTTILGSVDEGIFRN-----------LGVLVTSDPK 485


>1ay5B [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
          Length = 388

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 37/273 (13%), Positives = 71/273 (26%), Gaps = 22/273 (8%)

Query: 39  RLEEEIASFTGVKHGV-------GVASGSDALLIALRAM-GVEKGDTVVTTPYTFFATAS 90
             ++ +                     G+ AL  AL           V  +  T+    S
Sbjct: 67  EFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVS 126

Query: 91  APYRLGARVIFVDVDES-TFNMDLNQLEHVLKKEKVKAII-----PVHLFGRTVDLEALS 144
               +G  V      ++ T  +D   ++  L   K   ++       +  G  + L+  +
Sbjct: 127 IMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWA 186

Query: 145 FLRE---KYGVMILEDCAQSMGS-EWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
            +     K G + L D A        +  +   R   S     + +   +KN G Y +  
Sbjct: 187 EIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERT 246

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
             +      A         GA      +   +         + +         W  E   
Sbjct: 247 GCLLALCADAA--TRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEA 304

Query: 261 VARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQ 293
           V     +L E  +L      +        V   
Sbjct: 305 VRSGMLRLRE--QLAGELRDLSGSDRFGFVAEH 335


>3d6kD [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 402

 Score = 61.2 bits (147), Expect = 5e-12
 Identities = 22/245 (8%), Positives = 47/245 (19%), Gaps = 32/245 (13%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHG------ 53
            P  +       +                   G    +  + E  A   G+         
Sbjct: 31  KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEALGLPADLVVAQD 90

Query: 54  --------VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD 105
                   +   S +     + R    E+    +     +    +     G  +     +
Sbjct: 91  GSSLNIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDE 150

Query: 106 ESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVD------LEALSFLREKYGVMILEDCA 159
                +     +      +VK          T           L+         I+ D A
Sbjct: 151 GPDGVVRELVKDP-----QVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNA 205

Query: 160 QS----MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRI 215
            +            +       +      +    +K     G G     +S E  E    
Sbjct: 206 YALHTLSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHA-GSGVSFFASSKENIEWYAS 264

Query: 216 LRVHG 220
                
Sbjct: 265 HANVR 269


>1c8fA [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
          Length = 548

 Score = 61.2 bits (146), Expect = 5e-12
 Identities = 5/74 (6%), Positives = 18/74 (24%), Gaps = 10/74 (13%)

Query: 53  GVGVASGSDALLIALRAM---------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVD 103
           GVG+++G+       + +            +   +       +            V    
Sbjct: 1   GVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVNNMDKTAVKGNM 60

Query: 104 VDESTFNMDLNQLE 117
                 ++++    
Sbjct: 61  AL-DDIHVEIVTPW 73


>2dr1B [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
          Length = 374

 Score = 60.8 bits (146), Expect = 6e-12
 Identities = 27/293 (9%), Positives = 74/293 (25%), Gaps = 21/293 (7%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
             +   +   +    S     +  +      E       +  +  +SG+  +  ++R   
Sbjct: 22  PEVLEIMKVQMFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNGV 81

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII-- 129
            + G  +VT    F            R   V   E    +    L+  L+K      +  
Sbjct: 82  SKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRKNPDVEAVTI 141

Query: 130 --PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSF 187
                  G    L  L+ + +++  ++  D   +MG                    +   
Sbjct: 142 TYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGG--------ADIKFDKWGLDVVFS 193

Query: 188 FPTKNLGTYGDGGMIVTNSDEIAEESRILRVHG-------ARKKYFHEKVGYNSRLDEIH 240
              K  G      +   +   +    ++             +     E       + ++ 
Sbjct: 194 SSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVF 253

Query: 241 AAILRVKLRYLERWTEERTRVARTYQKLFEE--KKLPVVYPRVEEKGFRYHVF 291
              + +++       E+   +     K+  E  +++ +               
Sbjct: 254 GINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITA 306


>1ejiA [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
          Length = 467

 Score = 60.5 bits (145), Expect = 8e-12
 Identities = 34/270 (12%), Positives = 66/270 (24%), Gaps = 24/270 (8%)

Query: 37  VRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTP---YTFFATASAPY 93
            R L+            V   SGS A      A+    G   +  P   +          
Sbjct: 90  KRALQAYHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIGLDLPDGGHLTHGFTDKKK 149

Query: 94  RLGARVIF---VDVDESTFNMDLNQLEHVLKKEKVKAII-PVHLFGRTVDLEALSFLREK 149
                + F     V   T  ++ +QLE        K II     + R +D   L  + + 
Sbjct: 150 ISATSIFFESPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADD 209

Query: 150 YGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTY--GDGGMIVTNSD 207
            G  + +              G +                T    T      G+      
Sbjct: 210 NGAYLADAHIS----------GLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGIFYRKGV 259

Query: 208 EIAEESRILRVHGARKKYFHEKV---GYNSRLDEIHAAILRVKLRYLERWTEERTRVART 264
              +       +   +   +  V         +   A +     +    +   + +V   
Sbjct: 260 RSVDPKTGKETYYELESLINSAVFPGLQGGPHNHAIAGVAVALKQATTEFKIYQLQVLAN 319

Query: 265 YQKLFEEKKLPVVYPRVEEKGFRYHVFHQY 294
            + L +   L  +  ++   G   H+    
Sbjct: 320 CRALSD--ALTELGYKIVTGGSDNHLILDL 347


>3ei7B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 409

 Score = 60.4 bits (145), Expect = 8e-12
 Identities = 27/259 (10%), Positives = 55/259 (21%), Gaps = 15/259 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                + +      G+       S      I+   +      T+     ++ A   +   
Sbjct: 84  PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVI 143

Query: 95  LGARVIFVDVDESTFNM-----DLNQLEHVLKKEKVKAIIPV--------HLFGRTVDLE 141
           +G    F    +   N+                   +  I                  L 
Sbjct: 144 MGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLT 203

Query: 142 ALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGM 201
            L    +K G +I+ D A         +   I +     + A+ +   +K  G  G    
Sbjct: 204 QLVEFAKKNGSIIVYDSAY-AMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLG 262

Query: 202 IVTNSDEIAEE-SRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
                 ++       +     R          N       A +    L  + +       
Sbjct: 263 WTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKE 322

Query: 261 VARTYQKLFEEKKLPVVYP 279
                   F      V   
Sbjct: 323 NTNIIIDTFTSLGYDVYGG 341


>1bkgA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 382

 Score = 60.4 bits (145), Expect = 8e-12
 Identities = 33/270 (12%), Positives = 71/270 (26%), Gaps = 30/270 (11%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN------VRRLEEEIASFTGVKHGVGVASGSDALLI 65
           E ++     A+ +  +      G          +   E       +  +    G  AL  
Sbjct: 47  EHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFN 106

Query: 66  ALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDES-TFNMDLNQLEHVLKKEK 124
             +A+ ++ GD V+     + +        G  V+ V+      F  D  ++   +   +
Sbjct: 107 LFQAI-LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAIT-PR 164

Query: 125 VKAIIPVHLFGRTV------DLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGS 178
            KA++       T        LEAL+ L  ++   ++ D    +     +          
Sbjct: 165 TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSD---EIYEHLLYEGEHFSPGRV 221

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDE 238
             +  +      K     G          E+ +    +                 +  D 
Sbjct: 222 APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQ------------STTSPDT 269

Query: 239 IHAAILRVKLRYLERWTEERTRVARTYQKL 268
           I        L   E            Y++ 
Sbjct: 270 IAQWATLEALTNQEASRAFVEMAREAYRRR 299


>3bc8A [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
          Length = 437

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 33/393 (8%), Positives = 91/393 (23%), Gaps = 34/393 (8%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNV-ILGENVRRLEEEIASFTGVKH---GVGVA 57
                 +    R     ++ I +   +    +L +    L   +    GV        V 
Sbjct: 53  REGRVASALVARRHYRFIHGIGRQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVP 112

Query: 58  SGSDALLIALRA---MGVEKGDTVVTTPYTFFATASAPYRLGARVIFV--DVDESTFNMD 112
             +   L            K   ++       +   +    G   + +   ++      D
Sbjct: 113 MATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTD 172

Query: 113 LNQLEHVLKKEKVKAII------PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEW 166
           L  +E  +++   + I+                LE L+ +   Y +  + + A  + S  
Sbjct: 173 LKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSK 232

Query: 167 KFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYF 226
                +      VG    F       +     G +I   ++   ++   +          
Sbjct: 233 CMHLIQQG--ARVGRIDAFVQSLDNFMV-PVGGAIIAGFNEPFIQDISKMYPGR------ 283

Query: 227 HEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE--KKLPVVYPRVEEK 284
                  S   ++   +L +      +  +ER  +        ++  +       +    
Sbjct: 284 ----ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHN 339

Query: 285 GFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPV 344
                +  +                                              G    
Sbjct: 340 PISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPL----GNVQTVSGHTFRGFMSH 395

Query: 345 AESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
           A++     L       ++  ++   +  +   L
Sbjct: 396 ADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL 428


>2aatA [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 28/241 (11%), Positives = 65/241 (26%), Gaps = 15/241 (6%)

Query: 41  EEEIASFTGVKHGVGVASGS---DALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
             + ++    K      +        + A           V  +  ++    S     G 
Sbjct: 83  FGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGL 142

Query: 98  RVIFVDVDEST-FNMDLNQLEHVLKK--EKVKAIIPVHLFGRTVD------LEALSFLRE 148
            V      ++    +D + L + L +       +        T         + L+ L  
Sbjct: 143 EVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSV 202

Query: 149 KYGVMILEDCAQSMGSEW-KFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSD 207
           + G + L D A    +   +  +  +R   ++    I +   + N G Y +     T   
Sbjct: 203 EKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSANFGLYNERVGACTLVA 262

Query: 208 EIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
             +E               +           +   +    L     W +E T + +  Q+
Sbjct: 263 ADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQR 320

Query: 268 L 268
           +
Sbjct: 321 M 321


>2bwnB [x.x.x] 5-AMINOLEVULINATE SYNTHASE
          Length = 394

 Score = 60.1 bits (144), Expect = 1e-11
 Identities = 32/263 (12%), Positives = 64/263 (24%), Gaps = 23/263 (8%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
              RRLE EIA     +  +  +S  +A    L  + V     ++ +     A+     +
Sbjct: 91  AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIK 150

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII---PVHLFGRTVDLEALSFLREKYG 151
                       +        +         K I       + G    ++ +  + E++G
Sbjct: 151 -RNAGPKRIFRHNDVAHLRELIAADDP-AAPKLIAFESVYSMDGDFGPIKEICDIAEEFG 208

Query: 152 VMILEDCAQS---MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
            +   D   +    G      +                      L  YG  G  +  S  
Sbjct: 209 ALTYIDEVHAVGMYGPRGAGVAERD-------GLMHRIDIFNGTLAAYGVFGGYIAASAR 261

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
           + +      V      +        +      A+I  +K        + R       + L
Sbjct: 262 MVD-----AVRSYAPGFIFSTSLPPAIAAGAQASIAFLK---TAEGQKLRDAQQMHAKVL 313

Query: 269 FEEKKLPVVYPRVEEKGFRYHVF 291
               K   +            V 
Sbjct: 314 KMRLKALGMPIIDHGSHIVPVVI 336


>2aevA [x.x.x] HYPOTHETICAL PROTEIN MJ0158
          Length = 365

 Score = 60.0 bits (144), Expect = 1e-11
 Identities = 18/207 (8%), Positives = 58/207 (28%), Gaps = 15/207 (7%)

Query: 17  EILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGD 76
            I      L+++         +  E  +    G ++   V     +  I    + ++   
Sbjct: 33  LIDEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKK 92

Query: 77  TVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGR 136
            +   P      +           + + D       + ++ + + K+ +  I    +  +
Sbjct: 93  VIHYLPELPGHPSIERSCKIVNAKYFESD------KVGEILNKIDKDTLVIITGSTMDLK 146

Query: 137 TVD---LEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNL 193
            ++    + +    +    ++  D A        F      +  ++   A      T  +
Sbjct: 147 VIELENFKKVINTAKNKEAIVFVDDASGARVRLLF-----NQPPALKLGADLVVTSTDLM 201

Query: 194 GTYGDGGMIVTNSDEIAEESRILRVHG 220
                GG++    + + +        G
Sbjct: 202 -EGPRGGLLAGKKELVDKIYIEGTKFG 227


>2eh6A [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
          Length = 375

 Score = 59.9 bits (144), Expect = 1e-11
 Identities = 32/280 (11%), Positives = 79/280 (28%), Gaps = 38/280 (13%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEI-ASFTGVKHGVGVASGSDALLIALRAM 70
            ++   +   ++KL+   N+        L  ++   F          SG++++  A++  
Sbjct: 47  PKLTEALKEQVEKLLHVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLA 106

Query: 71  ------GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNM-------DLNQLE 117
                   +     ++   +F            +  F    E            D++ + 
Sbjct: 107 RKYWRDKGKNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVY 166

Query: 118 HVLKKEKVKAIIPVH------LFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSG 171
            +L +E    II V              L  L  + ++  V+++ D  Q+          
Sbjct: 167 KLLDEETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGE--- 223

Query: 172 EIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVG 231
               +    +         K LG     G I+   +               + +     G
Sbjct: 224 --FYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEV-------------AQSFTPGSHG 268

Query: 232 YNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                + +      V +  +E+       V   +++  +E
Sbjct: 269 STFGGNPLACRAGTVVVDEVEKLLPHVREVGNYFKEKLKE 308


>2d61A [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 59.7 bits (143), Expect = 1e-11
 Identities = 34/249 (13%), Positives = 72/249 (28%), Gaps = 15/249 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGS--DALLIALR-AMGVEKGDTVVTTPYTFFATASA 91
                L  + ++    K      +     AL +A            V  +  ++    S 
Sbjct: 77  CTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSV 136

Query: 92  PYRLGARVIFVDVDESTFN-MDLNQLEHVLKK--EKVKAIIPVHLFGRTV------DLEA 142
               G  V      ++  + +D + L + L +       +        T         + 
Sbjct: 137 FNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQT 196

Query: 143 LSFLREKYGVMILEDCAQSMGS-EWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGM 201
           L+ L  + G + L D A    +   +  +  +R   ++    I +   +KN G Y +   
Sbjct: 197 LAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVG 256

Query: 202 IVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRV 261
             T     +E   + R     K                  A +         W +E T +
Sbjct: 257 ACTLVAADSE--TVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDM 314

Query: 262 ARTYQKLFE 270
            +  Q++ +
Sbjct: 315 RQRIQRMRQ 323


>3bcbA [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
          Length = 444

 Score = 59.7 bits (143), Expect = 1e-11
 Identities = 34/359 (9%), Positives = 85/359 (23%), Gaps = 33/359 (9%)

Query: 35  ENVRRLEEEIASFTGVK---HGVGVASGSDALLIALRAMGVEKGDT--VVTTPYTFFATA 89
           +    L   +    GV        V   +   L         K      +  P     + 
Sbjct: 94  KITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSC 153

Query: 90  SAPYRL-GARVIFVDVDE--STFNMDLNQLEHVLKKEKVKAIIPVHL------FGRTVDL 140
                  G   + ++          DL  +E  +++   + I+ +H             L
Sbjct: 154 FKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRL 213

Query: 141 EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
           E L+ +   Y +  + + A  + S        I++   VG    F       +   G G 
Sbjct: 214 EELAVICANYDIPHVVNNAYGLQSSK--CMHLIQQGARVGRIDAFVQSLDNFMVPVG-GA 270

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
           +I   ++   +               +      S   ++   +L +      +  +ER  
Sbjct: 271 IIAGFNEPFIQ----------DISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKE 320

Query: 261 VARTYQKLFEE--KKLPVVYPRVEEKGFRYHVFHQYXXXXXXXXXXXXXXXXXXXXGIQT 318
           +        ++  +       +         +  +                         
Sbjct: 321 MFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGA 380

Query: 319 AIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPELRDDEIKEVVDTIALFL 377
                  +             G    A++     L       ++  ++   +  +   L
Sbjct: 381 RAVPLGNVQTVS----GHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL 435


>3ei6B [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 411

 Score = 59.6 bits (143), Expect = 1e-11
 Identities = 29/261 (11%), Positives = 54/261 (20%), Gaps = 17/261 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                + +      G+       S      I+   +      T+     ++ A   +   
Sbjct: 84  PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVI 143

Query: 95  LGARVIFVDVDESTFNM-----DLNQLEHVLKK--EKVKAIIPVHLFGRTV------DLE 141
           +G    F    +   N+                   +   I        T        L 
Sbjct: 144 MGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLT 203

Query: 142 ALSFLREKYGVMILED-CAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
            L    +K G +I+ D       S+    S               SF  +K  G  G   
Sbjct: 204 QLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASF--SKYAGFTGVRL 261

Query: 201 MIVTNSDEIAEE-SRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERT 259
                  ++       +     R          N       A +    L  + +      
Sbjct: 262 GWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYK 321

Query: 260 RVARTYQKLFEEKKLPVVYPR 280
                    F      V   +
Sbjct: 322 ENTNIIIDTFTSLGYDVYGGK 342


>2c44C [x.x.x] TRYPTOPHANASE
          Length = 468

 Score = 59.4 bits (142), Expect = 2e-11
 Identities = 46/380 (12%), Positives = 90/380 (23%), Gaps = 49/380 (12%)

Query: 34  GENVRRLEEEIASFTGVKHGVGVASGSDALLIA--------LRAMGVEKGDTVVTTPYTF 85
             +   L E + +  G ++ +    G  A  I          +  G+++   V  + Y F
Sbjct: 74  SRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFF 133

Query: 86  FATASAPYRLGARVIFVDVD---------ESTFNMDLNQLEHVLKKEKVKAIIPV----- 131
             T       G  V  V +          +   N DL  LE  +++     +  +     
Sbjct: 134 DTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLEGLERGIEEVGPNNVPYIVATIT 193

Query: 132 -----HLFGRTVDLEALSFLREKYGVMILEDCAQSMG--------SEWKFSSGEIRKSGS 178
                       +L+A+  + +KY + ++ D A+                     + +  
Sbjct: 194 SNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIEQITRE 253

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDE 238
               A       K       GG++    D   +     R     ++ F    G      E
Sbjct: 254 TYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAME 313

Query: 239 IHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYXXXX 298
             A  L         W   R    +      EE  +           F            
Sbjct: 314 RLAVGL--YDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAG-GHAAFVDAGKLLPHIPA 370

Query: 299 XXXXXXXXXXXXXXXXGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMF 358
                           GI             +    L  ++             L L + 
Sbjct: 371 DQFPAQALACELYKVAGI----------RAVEIGSFLLGRDPKTGKQLPCPAELLRLTIP 420

Query: 359 PE-LRDDEIKEVVDTIALFL 377
                   +  +++      
Sbjct: 421 RATYTQTHMDFIIEAFKHVK 440


>1aiaA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 59.3 bits (142), Expect = 2e-11
 Identities = 32/248 (12%), Positives = 69/248 (27%), Gaps = 17/248 (6%)

Query: 37  VRRLEEEIASFTGVKHGVGV----ASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAP 92
              L  + ++    K          +G+  +     A         V+ P ++    S  
Sbjct: 79  QELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNP-SWPNHKSVF 137

Query: 93  YRLGARVIFVDV-DESTFNMDLNQLEHVLKKE--KVKAIIPVHLFGRTV------DLEAL 143
              G  V      D     +D + L + L +       +        T         + L
Sbjct: 138 NSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTL 197

Query: 144 SFLREKYGVMILEDCAQSMGSEW-KFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMI 202
           + L  + G + L D A    +   +  +  +R   ++    I +   + N G Y +    
Sbjct: 198 AQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSHNFGLYNERVGA 257

Query: 203 VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVA 262
            T     +E               +           +   +    L     W +E T + 
Sbjct: 258 CTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMR 315

Query: 263 RTYQKLFE 270
           +  Q++ +
Sbjct: 316 QRIQRMRQ 323


>1ariA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 58.6 bits (140), Expect = 3e-11
 Identities = 28/280 (10%), Positives = 71/280 (25%), Gaps = 24/280 (8%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDAL-------- 63
             ++      ++   +   + +   +             K    +               
Sbjct: 47  TSVKKAEQYLLENETTKNYLGIDG-IPEFGRCTQELLFGKGSALINDKRARTAQTPGGTG 105

Query: 64  ---LIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDE-STFNMDLNQLEHV 119
              + A           V  +  +     S     G  V      +     +D + L + 
Sbjct: 106 ALRVAADFLAKNTSVKRVWVSNPSHPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINS 165

Query: 120 LKKEKVKAII--------PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEW-KFSS 170
           L + +   ++        P  +       + L+ L  + G + L D A    +   +  +
Sbjct: 166 LNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDA 225

Query: 171 GEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKV 230
             +R   ++    I +   +KN G Y +     T     +E               +   
Sbjct: 226 EGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSN 285

Query: 231 GYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE 270
                   +   +    LR +        R  +  Q++ +
Sbjct: 286 PPAHGASVVATILSNDALRAIWEQELTDMR--QRIQRMRQ 323


>1c1dB [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
          Length = 348

 Score = 58.5 bits (141), Expect = 3e-11
 Identities = 8/80 (10%), Positives = 19/80 (23%), Gaps = 1/80 (1%)

Query: 87  ATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFL 146
                       V+    D          +   + +  +   +        +  EA S +
Sbjct: 215 VALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIADEAASDI 273

Query: 147 REKYGVMILEDCAQSMGSEW 166
               G++   D   + G   
Sbjct: 274 LHARGILYAPDFVANAGGAI 293


>3cogD [x.x.x] CYSTATHIONINE GAMMA-LYASE
          Length = 392

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 34/258 (13%), Positives = 74/258 (28%), Gaps = 22/258 (8%)

Query: 40  LEEEIASFTGVKHG--VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
               +        G    +A  S           ++ GD ++     +  T     ++ +
Sbjct: 58  TRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVAS 117

Query: 98  RVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILED 157
                        + L +     + + V    P +   + +D+E  + +  K+G +IL  
Sbjct: 118 EFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVV 177

Query: 158 CAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILR 217
               M   +       R      D +++S     N  +    G++  N + +    R L+
Sbjct: 178 DNTFMSPYF------QRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQ 231

Query: 218 VHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE--EKKLP 275
                           +    I   +    L+ L    E+  +      +  E       
Sbjct: 232 NS------------LGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEK 279

Query: 276 VVYPRVEEKGFRYHVFHQ 293
           V+YP +        V  Q
Sbjct: 280 VIYPGLPSHPQHELVKRQ 297


>1b5pA [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 382

 Score = 58.1 bits (139), Expect = 4e-11
 Identities = 33/272 (12%), Positives = 69/272 (25%), Gaps = 29/272 (10%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN------VRRLEEEIASFTGVKHGVGVASGSDALLI 65
           E ++     A+ +  +      G          +   E       +  +    GS AL  
Sbjct: 47  EHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFN 106

Query: 66  ALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKV 125
             +A+  + GD V+     + +        G  V+ V+       +   +        + 
Sbjct: 107 LFQAIL-DPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRT 165

Query: 126 KAIIPVHLFGRTV------DLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSV 179
           KA++       T        LEAL+ L  ++   ++ D          +           
Sbjct: 166 KALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLL---YEGEHFSPGRVA 222

Query: 180 GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEI 239
            +  +      K     G          E+ +                      +  D I
Sbjct: 223 PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIK------------AMASVSRQSTTSPDTI 270

Query: 240 HAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                   L   E  +     +AR   +   +
Sbjct: 271 AQWATLEALTNQE-ASRAFVEMAREAYRRRRD 301


>1b4xA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 57.8 bits (138), Expect = 5e-11
 Identities = 29/240 (12%), Positives = 63/240 (26%), Gaps = 15/240 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGV----ASGSDALLIALRAMGVEKGDTVVTTPYTFFATAS 90
                L  + ++    K          +G+  +     A        V  +  ++    S
Sbjct: 77  CTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAK-NTSVKRVWVSNPSWPNHKS 135

Query: 91  APYRLGARVIFVDVDESTFN-MDLNQLEHVLKK--EKVKAIIPVHLFGRTV------DLE 141
                G  V      ++  + +D + L + L +       +        T         +
Sbjct: 136 VFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDPTLEQWQ 195

Query: 142 ALSFLREKYGVMILEDCAQS-MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
            L+ L  + G + L D A        +  +  +R   ++    I +   +KN G Y +  
Sbjct: 196 TLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERV 255

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
              T     +E               +           +   +    LR +        R
Sbjct: 256 GACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR 315


>3eiaB [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
          Length = 409

 Score = 57.8 bits (138), Expect = 5e-11
 Identities = 21/260 (8%), Positives = 52/260 (20%), Gaps = 17/260 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                + +      G+       S      I+   +      T+     ++ A   +   
Sbjct: 84  PLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVI 143

Query: 95  LGARVIFVDVDESTFNM--------DLNQLEHVLKKEKVKAIIPVHLFGRTVDL------ 140
           +G    F    +   N+        +    +                             
Sbjct: 144 MGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLT 203

Query: 141 EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGG 200
           + + F ++   +++ +       S+    S               SF  ++  G  G   
Sbjct: 204 QLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASF--SQYAGFTGVRL 261

Query: 201 MIVTNSDEIAEE-SRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERT 259
                  ++       +     R          N       A +    L  + +      
Sbjct: 262 GWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYK 321

Query: 260 RVARTYQKLFEEKKLPVVYP 279
                    F      V   
Sbjct: 322 ENTNIIIDTFTSLGYDVYGG 341


>3e6gA [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
          Length = 368

 Score = 57.6 bits (139), Expect = 6e-11
 Identities = 39/193 (20%), Positives = 72/193 (37%), Gaps = 29/193 (15%)

Query: 36  NVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTF-----FATAS 90
                E  +A+  G       ASG  A    +  +  + G  VV     +          
Sbjct: 41  TRFAYERCVAALEGGTRAFAFASGMAATSTVMELL--DAGSHVVAMDDLYGGTFRLFERV 98

Query: 91  APYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII---PVHLFGRTVDLEALSFLR 147
                G    FVD+       D    +  ++    K +    P +   + VD+ A++ + 
Sbjct: 99  RRRTAGLDFSFVDLT------DPAAFKAAIR-ADTKMVWIETPTNPMLKLVDIAAIAVIA 151

Query: 148 EKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD--GGMIVTN 205
            K+G++ + D          F+S  +++  S+G A +     TK L  + D  GG+ V  
Sbjct: 152 RKHGLLTVVDNT--------FASPMLQRPLSLG-ADLVVHSATKYLNGHSDMVGGIAVVG 202

Query: 206 SD-EIAEESRILR 217
            + E+AE+   L+
Sbjct: 203 DNAELAEQMAFLQ 215


>1eg5A [c.67.1] AMINOTRANSFERASE
          Length = 353

 Score = 57.3 bits (137), Expect = 7e-11
 Identities = 35/265 (13%), Positives = 70/265 (26%), Gaps = 23/265 (8%)

Query: 35  ENVRRLEEEIASFTGVKHG--VGVASGSDALLIALR---AMGVEKGDTVVTTPYTFFATA 89
               +  E++A   GV        +  ++++   L+       ++  T++TTP    A  
Sbjct: 40  NLHEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVAETFEKRKRTIITTPIEHKAVL 99

Query: 90  SAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVH-LFGRTVDLEALSFLRE 148
              Y      +     +S   + L +LE ++ ++     I  +   G    +E ++ + +
Sbjct: 100 ETKYLSKGFKVKYVPVDSRGVVKLEELEKLVDEDTFLVSIAANNEVGTIQPVEDVTRIVK 159

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
           K     L                         D A FS    K  G  G G   +     
Sbjct: 160 KKNKETLVHVDAVQT----IGKIPFSLEKLEVDYASFSA--HKFHGPKGVGITYIRKGVP 213

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
           I                     G  S    +   +   +         E  +  +   KL
Sbjct: 214 IRPLIHGGGQER----------GLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKL 263

Query: 269 FEE-KKLPVVYPRVEEKGFRYHVFH 292
                    +   +E          
Sbjct: 264 VSGLNLGAHIITPLEISLPNTLSVS 288


>1c7nA [c.67.1] CYSTALYSIN
          Length = 394

 Score = 57.1 bits (136), Expect = 8e-11
 Identities = 28/252 (11%), Positives = 74/252 (29%), Gaps = 16/252 (6%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFAT-ASAPYRLG 96
           + +++           +  A    A+  A+R         ++ TP  +    A       
Sbjct: 77  KWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERK 136

Query: 97  ARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFG-------RTVDLEALSFLREK 149
                +   +  + +D  +LE +  K+K    +             +  +L+ +  +  K
Sbjct: 137 IIECELLEKDGYYTIDFQKLEKLS-KDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLK 195

Query: 150 YGVMILEDCAQS-MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
             +M+  D     +       +        + D  I    P+K     G G   +   + 
Sbjct: 196 SDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIKNP 255

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
                  +R    + +     + + +   +      +   ++L+   +   +  R  +  
Sbjct: 256 ------DIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDF 309

Query: 269 FEEKKLPVVYPR 280
           FE     +  P 
Sbjct: 310 FEVNHPEIKAPL 321


>5bj4A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 366

 Score = 56.5 bits (135), Expect = 1e-10
 Identities = 33/271 (12%), Positives = 68/271 (25%), Gaps = 28/271 (10%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN------VRRLEEEIASFTGVKHGVGVASGSDALLI 65
           E ++     A+ +  +      G          +   E       +  +    GS AL  
Sbjct: 31  EHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFN 90

Query: 66  ALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKV 125
             +A+ ++ GD V+     + +        G  V+ V+       +   +        + 
Sbjct: 91  LFQAI-LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRT 149

Query: 126 KAIIPVHLFGRTV------DLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSV 179
           KA++       T        LEAL+ L  ++   ++ D          +           
Sbjct: 150 KALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIY---EHLLYEGEHFSPGRVA 206

Query: 180 GDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEI 239
            +  +      K     G          E+           A            +  D I
Sbjct: 207 PEHTLTVNGAAKAFAMTGWRIGYACGPKEVI---------KAMASVSR---QSTTSPDTI 254

Query: 240 HAAILRVKLRYLERWTEERTRVARTYQKLFE 270
                   L   E            Y++  +
Sbjct: 255 AQWATLEALTNQEASRAFVEMAREAYRRRRD 285


>2bwoB [x.x.x] 5-AMINOLEVULINATE SYNTHASE
          Length = 399

 Score = 56.2 bits (134), Expect = 1e-10
 Identities = 30/249 (12%), Positives = 72/249 (28%), Gaps = 13/249 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
              RRLE EIA     +  +  +S  +A    L  + V     ++ +       +     
Sbjct: 91  AYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDS-LNHASMIEGI 149

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRT---VDLEALSFLREKYG 151
                       +        +         K I    ++        ++ +  + E++G
Sbjct: 150 KRNAGPKRIFRHNDVAHLRELIAADD-PAAPKLIAFESVYSMDGDFGPIKEICDIAEEFG 208

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
            +   D   ++G      +G   + G +    IF+    K  G +G          +   
Sbjct: 209 ALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVD--- 265

Query: 212 ESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEE 271
                 V      +        +      A+I  +K    ++  + +   A+  +   + 
Sbjct: 266 -----AVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKA 320

Query: 272 KKLPVVYPR 280
             +P++   
Sbjct: 321 LGMPIIDHG 329


>1c1dA [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
          Length = 349

 Score = 56.2 bits (135), Expect = 2e-10
 Identities = 18/120 (15%), Positives = 32/120 (26%), Gaps = 2/120 (1%)

Query: 44  IASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVD 103
           +   T +  G+G   GS A L A  A          T                  V+   
Sbjct: 173 LDGLTVLVQGLGAVGGSLASLAA-EAGAQLLVADTDTERVAHAVALGHTAVALEDVLSTP 231

Query: 104 VDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMG 163
            D          +   + +  +   +        +  EA S +    G++   D   + G
Sbjct: 232 CDVFAPCAMGGVITTEVAR-TLDCSVVAGAANNVIADEAASDILHARGILYAPDFVANAG 290


>7aatA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 401

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 32/234 (13%), Positives = 65/234 (27%), Gaps = 11/234 (4%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
               E   S   V       +GS  +         +    V     ++          G 
Sbjct: 86  GENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGL 145

Query: 98  RVIFVDVDES-TFNMDLNQLEHVLKKEKVKAIIPV--------HLFGRTVDLEALSFLRE 148
           ++      +  T ++D       + K   K+II +         +  R    + L+ + +
Sbjct: 146 QLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVK 205

Query: 149 KYGVMILEDCAQSMG--SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNS 206
           K  ++   D A       +    +  +R     G   + S    KN+G YG+     T  
Sbjct: 206 KRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVI 265

Query: 207 DEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
              AEE++ +                 +        +   +LR       +   
Sbjct: 266 CRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMA 319


>3e2yA [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
          Length = 410

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 31/202 (15%), Positives = 57/202 (28%), Gaps = 18/202 (8%)

Query: 27  SSGNVILGENVRRLEEEIASFTGVK-HGVGVASGSDALLIALRAMGVEKGDTVVTTPYTF 85
             G+  L + +  L  +I          + VA G+   L       V+ GD V+     +
Sbjct: 60  GFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFY 119

Query: 86  FATASAPYRLGARVI----------FVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFG 135
                     GA  +           +    S +  D  +LE      K KAII      
Sbjct: 120 DCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFS-SKTKAIILNTPHN 178

Query: 136 RTV------DLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFP 189
                    +L+ ++ L  K+  + + D           +  +I     + +  I     
Sbjct: 179 PLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSA 238

Query: 190 TKNLGTYGDGGMIVTNSDEIAE 211
            K     G           + +
Sbjct: 239 GKTFSVTGWKLGWSIGPAHLIK 260


>1djuB [c.67.1] AROMATIC AMINOTRANSFERASE
          Length = 373

 Score = 55.4 bits (132), Expect = 3e-10
 Identities = 43/294 (14%), Positives = 96/294 (32%), Gaps = 25/294 (8%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN-----VRRLEEEIASFTGV-KHGVGVASGSDALLI 65
           + I+     A+DK ++     +G       +    ++        K  + V  G++   +
Sbjct: 26  QHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFL 85

Query: 66  ALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD-ESTFNMDLNQLEHVLKKEK 124
              +  ++ G+ V+     F + A A    G + + V    E  F +++++L+  +  +K
Sbjct: 86  MGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVT-DK 144

Query: 125 VKAIIPVHL------FGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGS 178
            +A+I               DLE ++    ++ ++++ D               I     
Sbjct: 145 TRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDG 204

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDE 238
           + +  I     +K     G     V     I E          + + ++           
Sbjct: 205 MFERTITVNGFSKTFAMTGWRLGFVAAPSWIIE-------RMVKFQMYNATCPVTFIQYA 257

Query: 239 IHAAILRVK-LRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVF 291
              A+   +  + +E   +E  R  +   K   E  LP V P   +  F     
Sbjct: 258 AAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKP---KGAFYIFPR 308


>1bw0B [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
          Length = 412

 Score = 55.1 bits (131), Expect = 3e-10
 Identities = 28/247 (11%), Positives = 69/247 (27%), Gaps = 13/247 (5%)

Query: 54  VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD-ESTFNMD 112
           V + SG    ++       + GD  +     F    +     G  + F +   E+ +  D
Sbjct: 104 VVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEAD 163

Query: 113 LNQLEHVLKKEKVKAIIPVHLFGRTV-----DLEALSFLREKYGVMILEDCAQSMG--SE 165
           L+++  +   +    I+               +E +  L E+  + +  D   +      
Sbjct: 164 LDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKG 223

Query: 166 WKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKY 225
              ++     +             T NL   G     +   D          + G ++  
Sbjct: 224 KDPNATFTSVADFETTVPRVILGGTANLVVPGWRLGWLLYVDPHGN--GPSFLEGLKRVG 281

Query: 226 FHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKG 285
                        +  A+L     +L++      ++  +   L+      +       +G
Sbjct: 282 MLVCGPCTVVQAALGEALLNTPQEHLDQI---VAKIEESAMYLYNHIGECIGLAPTMPRG 338

Query: 286 FRYHVFH 292
             Y +  
Sbjct: 339 AMYLMSR 345


>2dr1A [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
          Length = 381

 Score = 55.1 bits (131), Expect = 3e-10
 Identities = 33/296 (11%), Positives = 76/296 (25%), Gaps = 26/296 (8%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMG 71
             +   +   +    S     +  +      E       +  +  +SG+  +  ++R   
Sbjct: 29  PEVLEIMKVQMFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNGV 88

Query: 72  VEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII-- 129
            + G  +VT    F            R   V   E    +    L+  L+K      +  
Sbjct: 89  SKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRKNPDVEAVTI 148

Query: 130 --PVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSF 187
                  G    L  L+ + +++  ++  D   +MG                    +   
Sbjct: 149 TYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGG--------ADIKFDKWGLDVVFS 200

Query: 188 FPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGY-----------NSRL 236
              K  G      +   +   +    ++           + K                  
Sbjct: 201 SSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVF 260

Query: 237 DEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFH 292
               A  +  K+   E+W E   + A+  ++   E  L ++    E       +  
Sbjct: 261 GINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDIL---AEPGHESPTITA 313


>1c1xA [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
          Length = 348

 Score = 55.0 bits (132), Expect = 4e-10
 Identities = 11/76 (14%), Positives = 23/76 (30%), Gaps = 7/76 (9%)

Query: 94  RLGARVIFVDVDESTFNMDLNQLEHVLK------KEKVKAIIPVHLFGRTVDLEALSFLR 147
            LG   + ++   ST   D+     +           +   +        +  EA S + 
Sbjct: 216 ALGHTAVALEDVLST-PCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDIL 274

Query: 148 EKYGVMILEDCAQSMG 163
              G++   D   + G
Sbjct: 275 HARGILYAPDFVANAG 290


>3cq4A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 357

 Score = 54.6 bits (130), Expect = 5e-10
 Identities = 28/245 (11%), Positives = 61/245 (24%), Gaps = 17/245 (6%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
             + ++        +       ++ L   L+A     G T +    ++            
Sbjct: 59  AYITKQTGVAVTRDNLWAANGSNEILQQLLQAF-GGPGRTALGFQPSYSMHPILAKGTHT 117

Query: 98  RVIFVDVDESTFNMDLNQLEHVLKKEKVKAII--PVHLFGRTVDLEALSFLREKYGVMIL 155
             I V             LE +  K+     +  P +  G    L+ +  +      +++
Sbjct: 118 EFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVI 177

Query: 156 EDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRI 215
            D A +       S              + S   +K     G        +    +   +
Sbjct: 178 VDEAYAEF---SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVML 234

Query: 216 LRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLP 275
           +R+             + S L +  A +            E+ +          EE    
Sbjct: 235 VRLP-----------YHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYA 283

Query: 276 VVYPR 280
           VV   
Sbjct: 284 VVPSE 288


>3b46A [x.x.x] AMINOTRANSFERASE BNA3
          Length = 423

 Score = 54.3 bits (129), Expect = 6e-10
 Identities = 36/260 (13%), Positives = 79/260 (30%), Gaps = 27/260 (10%)

Query: 39  RLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGAR 98
                  +    ++       ++ +L  L  + +  GD V+     F          G +
Sbjct: 84  LYSPIYNTELKAENVTVTTGANEGILSCLMGL-LNAGDEVIVFEPFFDQYIPNIELCGGK 142

Query: 99  VIFVDVDES-----------TFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLE 141
           V++V ++              + +D  Q E  +   K KA+I               +L 
Sbjct: 143 VVYVPINPPKELDQRNTRGEEWTIDFEQFEKAI-TSKTKAVIINTPHNPIGKVFTREELT 201

Query: 142 ALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDG-G 200
            L  +  K+ V+I+ D        +  S   I            +     +    G   G
Sbjct: 202 TLGNICVKHNVVIISDEVY-EHLYFTDSFTRIATLSPEIGQLTLTVGSAGSFAATGWRIG 260

Query: 201 MIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
            +++ + E+   +               +          ++    +K+ Y E+  +E   
Sbjct: 261 WVLSLNAELLSYAAKAHTRICFASPSPLQEAC------ANSINDALKIGYFEKMRQEYIN 314

Query: 261 VARTYQKLFEEKKLPVVYPR 280
             + +  +F+E  LP   P 
Sbjct: 315 KFKIFTSIFDELGLPYTAPE 334


>3a2bA [x.x.x] SERINE PALMITOYLTRANSFERASE
          Length = 392

 Score = 54.1 bits (130), Expect = 7e-10
 Identities = 37/209 (17%), Positives = 82/209 (39%), Gaps = 20/209 (9%)

Query: 12  ERIRGEILNAIDK----LISSGNVILGENV-RRLEEEIASFTGVKHGVGVASGSDALLIA 66
            RI     +A++K       S  +    ++   LEE+++++ G +  +  ++G  + L  
Sbjct: 60  TRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGP 119

Query: 67  LRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKK---E 123
           L  + + + D ++       +         ++VI         + ++  L   L +   +
Sbjct: 120 LSCL-MGRNDYILLDERDHASIIDGSRLSFSKVIKYG------HNNMEDLRAKLSRLPED 172

Query: 124 KVKAIIPVHLF---GRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVG 180
             K I    +F   G  V+L  L+ +  ++   ++ D A S+G      +G     G   
Sbjct: 173 SAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLND 232

Query: 181 DAAIFSFFPTKNLGTYGDGGMIVTNSDEI 209
           D  +     +K+L     GG +  ++D I
Sbjct: 233 DVDLIMGTFSKSLA--SLGGFVAGDADVI 259


>3bwnC [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 360

 Score = 53.9 bits (128), Expect = 8e-10
 Identities = 33/269 (12%), Positives = 64/269 (23%), Gaps = 39/269 (14%)

Query: 37  VRRLEEEIASFTGVKHGVG-------VASGSDALLIALRAM----GVEKGDTVVTTPYTF 85
              LE+ I    GV            V +GS  L  A           +  +VV     +
Sbjct: 53  EPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFY 112

Query: 86  FATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSF 145
                    + + +   + D   F+     +E V          P      TV  + +  
Sbjct: 113 STYVEETTYVRSGMYKWEGDAWGFDKKGPYIELV-----TSPNNPDGTIRETVVAKVIHD 167

Query: 146 LREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTN 205
               +         Q                    D  I  F  +         G  +  
Sbjct: 168 FAYYWPHYTPITRRQ--------------------DHDIMLFTFSITGHAGSRIGWALVK 207

Query: 206 SDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVK--LRYLERWTEERTRVAR 263
             E+A++     +  +       +V     L+ +            + +   E       
Sbjct: 208 DKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWE 267

Query: 264 TYQKLFEEKKLPVVYPRVEEKGFRYHVFH 292
             +++ +E       P+  E    Y    
Sbjct: 268 KLREVVKE-SDAFTLPKYPEAFCNYFGKS 295


>1arhA [c.67.1] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 53.6 bits (127), Expect = 9e-10
 Identities = 30/229 (13%), Positives = 64/229 (27%), Gaps = 14/229 (6%)

Query: 54  VGVASGSDALL--IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDES-TFN 110
                G    L   A           V  +  ++    S     G  V      ++    
Sbjct: 97  TAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHT 156

Query: 111 MDLNQLEHVLKK--EKVKAIIPVHLFGRT------VDLEALSFLREKYGVMILEDCAQSM 162
           +D + L + L +       +        T         + L+ L  + G + L D A+  
Sbjct: 157 LDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQG 216

Query: 163 GS-EWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGA 221
            +   +  +  +R   ++    I +   +KN G Y +     T     +E          
Sbjct: 217 FARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMK 276

Query: 222 RKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE 270
                +           +   +    L     W +E T + +  Q++ +
Sbjct: 277 AAIRANYSNPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQRMRQ 323


>2d5yA [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 29/244 (11%), Positives = 67/244 (27%), Gaps = 15/244 (6%)

Query: 40  LEEEIASFTGVKHGVGVASGSDALLIALR---AMGVEKGDTVVTTPYTFFATASAPYRLG 96
           L  + ++    K      +      + +             V  +  ++    S     G
Sbjct: 82  LFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAG 141

Query: 97  ARVIFVDVDES-TFNMDLNQLEHVLKK--EKVKAIIPVHLFGRTV------DLEALSFLR 147
             V      ++    +D + L + L +       +        T         + L+ L 
Sbjct: 142 LEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLS 201

Query: 148 EKYGVMILEDCAQSMG-SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNS 206
            + G + L D A        +  +  +R   ++    I +   +KN G Y +     T  
Sbjct: 202 VEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 207 DEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQ 266
              +E               +           +   +    L     W +E T + +  Q
Sbjct: 262 AADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAL--RAIWEQELTDMRQRIQ 319

Query: 267 KLFE 270
           ++ +
Sbjct: 320 RMRQ 323


>3d6kA [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 395

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 21/245 (8%), Positives = 51/245 (20%), Gaps = 31/245 (12%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILG--ENVRRLEEEIASFTGVKHG------ 53
            P  +       +                   G    +  + E  A   G+         
Sbjct: 24  KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEALGLPADLVVAQD 83

Query: 54  --------VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD 105
                   +   S +     + R    E+    +     +    +     G  +     +
Sbjct: 84  GSSLNIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDE 143

Query: 106 ESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVD------LEALSFLREKYGVMILEDCA 159
                +       ++K  +VK          T           L+         I+ D A
Sbjct: 144 GPDGVVR-----ELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNA 198

Query: 160 QSM----GSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRI 215
            ++           +       +      +    +K            ++ + I   +  
Sbjct: 199 YALHTLSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASH 258

Query: 216 LRVHG 220
             V G
Sbjct: 259 ANVRG 263


>1b8gA [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
          Length = 421

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 32/308 (10%), Positives = 73/308 (23%), Gaps = 36/308 (11%)

Query: 12  ERIRGEILNAIDKLISSGNVILGEN------VRRLEEEIASFTGVKHG--VGVASGSDAL 63
                +   +I   ++      G        V  + E   +         V  A  + A 
Sbjct: 56  AAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSAN 115

Query: 64  LIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNM-----DLNQLEH 118
              +  +  + G+ V+     +              I      S+         L +   
Sbjct: 116 ETFIFCL-ADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQ 174

Query: 119 VLKK--EKVKAIIPVHLFGRT------VDLEALSFLREKYGVMILEDCAQSMGSEWKFSS 170
             +K   +VK ++  +            +L  L    E  G+ ++ D   S      FSS
Sbjct: 175 EAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGT---AFSS 231

Query: 171 GEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEK- 229
                   V                +    ++ + S ++      +    +         
Sbjct: 232 PSFISVMEVLKDRNCDENS----EVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAA 287

Query: 230 -----VGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEK 284
                 G  S   +   + +    +  + +  E  +  +  QK      L          
Sbjct: 288 TKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVS-GLQKSGISCLNG 346

Query: 285 GFRYHVFH 292
                 + 
Sbjct: 347 NAGLFCWV 354


>1agxA [x.x.x] GLUTAMINASE-ASPARAGINASE
          Length = 331

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 24/163 (14%), Positives = 44/163 (26%), Gaps = 7/163 (4%)

Query: 52  HGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNM 111
           +    A  S    +     G           +T  +  +     G  +  V +   + NM
Sbjct: 168 NIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIVYGSDNM 227

Query: 112 DLNQLEHVLKKEKVKAIIPVHL---FGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKF 168
             +  +   K   VKAII             +  +  L ++ G+ I+     + G     
Sbjct: 228 MPDAYQAFAK-AGVKAIIHAGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQGF---V 283

Query: 169 SSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
                +     G  A     P K             ++ EI  
Sbjct: 284 LRNAEQPDDKYGWIAAHDLNPQKARLLMALALTKTNDAKEIQN 326


>3cogB [x.x.x] CYSTATHIONINE GAMMA-LYASE
          Length = 373

 Score = 52.3 bits (124), Expect = 2e-09
 Identities = 28/173 (16%), Positives = 57/173 (32%), Gaps = 12/173 (6%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYR 94
                LE+ +A+  G K    +A  S           ++ GD ++     +  T     +
Sbjct: 57  PTRNCLEKAVAALDGAK--YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQ 114

Query: 95  LGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAII--PVHLFGRTVDLEALSFLREKYGV 152
           + +               +  LE  +  E     I  P +   + +D+E  + +  K+G 
Sbjct: 115 VASEFGLKISFV--DCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGD 172

Query: 153 MILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTN 205
           +IL      M   +       R      D +++S     N  +    G++  N
Sbjct: 173 IILVVDNTFMSPYF------QRPLALGADISMYSATKYMNGHSDVVMGLVSVN 219


>2egyC [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
          Length = 396

 Score = 51.5 bits (122), Expect = 4e-09
 Identities = 31/241 (12%), Positives = 73/241 (30%), Gaps = 12/241 (4%)

Query: 41  EEEIASFTGVKHG--VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGAR 98
              +A + GV+    +       AL +  +    E    ++  P  +     A    G R
Sbjct: 79  RAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS-YMGAIQAFRLQGPR 137

Query: 99  VIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLREKYGV 152
            + V   E   ++D  +     ++      +       T         + L  +  + G+
Sbjct: 138 FLTVPAGEEGPDLDALEEVL-KRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGL 196

Query: 153 MILEDCAQSMG--SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA 210
           +++ED A       E +  S       +     I+    +K L         V + + + 
Sbjct: 197 VVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQ 256

Query: 211 EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFE 270
           +  +  +         ++ + +    +     + RV+  Y E+       + R   K   
Sbjct: 257 KLVQAKQGADLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVR 316

Query: 271 E 271
            
Sbjct: 317 Y 317


>2douA [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
          Length = 372

 Score = 51.4 bits (122), Expect = 4e-09
 Identities = 29/251 (11%), Positives = 64/251 (25%), Gaps = 24/251 (9%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
           R  E         +       GS   L  L     E  D ++     + +   A      
Sbjct: 71  RWYEGRYGVGLDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASL 130

Query: 98  RVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLREKYG 151
           R   + +       DL  +   +   + K ++  +    T         E    L  K+G
Sbjct: 131 RTFLIPLR-EDGLADLKAVPEGV-WREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHG 188

Query: 152 VMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
           + ++ D    +   ++  +          +  +  F  +K+    G        S+E   
Sbjct: 189 LWLIHDNPY-VDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEA-- 245

Query: 212 ESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEE-RTRVARTYQKLFE 270
                       +    K   +         +    L+  +                + E
Sbjct: 246 ----------LARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAE 295

Query: 271 --EKKLPVVYP 279
             +  L ++ P
Sbjct: 296 ALKGVLSLLPP 306


>3bwnB [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 369

 Score = 51.3 bits (121), Expect = 5e-09
 Identities = 29/267 (10%), Positives = 66/267 (24%), Gaps = 34/267 (12%)

Query: 40  LEEEIASFTGVKHGVGV--------ASGSDALLIALRAM---GVEKGDTVVTTPYTFFAT 88
           LE+ I    GV                 +     A+ A+      +  +VV     +   
Sbjct: 57  LEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTY 116

Query: 89  ASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRT-VDLEALSFLR 147
                 + + +   + D   F            K+     +            E +    
Sbjct: 117 VEETTYVRSGMYKWEGDAWGF-----------DKKGPYIELVTSPNNPDGTIRETVVNRP 165

Query: 148 EKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDG-GMIVTNS 206
           +     ++ D A                     D  +F+F  +K  G  G   G  +   
Sbjct: 166 DDDEAKVIHDFAYYWPHY------TPITRRQDHDIMLFTF--SKITGHAGSRIGWALVKD 217

Query: 207 DEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKL--RYLERWTEERTRVART 264
            E+A++     +  +       +V     L+ +            + +   E        
Sbjct: 218 KEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEK 277

Query: 265 YQKLFEEKKLPVVYPRVEEKGFRYHVF 291
            +++ +E     +    E     +   
Sbjct: 278 LREVVKESDAFTLPKYPEAFCNYFGKS 304


>3cq5A [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
          Length = 364

 Score = 51.2 bits (121), Expect = 5e-09
 Identities = 36/280 (12%), Positives = 79/280 (28%), Gaps = 29/280 (10%)

Query: 12  ERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVA-------SGSDALL 64
           E +  +++  +DK+ +  N     +   L +E+A++   + GV V        +GS+ +L
Sbjct: 41  EALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEIL 100

Query: 65  IALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEK 124
             L       G T +    ++              I V             LE +   ++
Sbjct: 101 QQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRA-KQ 159

Query: 125 VKAIIPVHLFGRTV---DLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGD 181
              +        T     L+ +  +      +++ D A +  S    S            
Sbjct: 160 PDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFS---PSPSATTLLEKYPT 216

Query: 182 AAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHA 241
             + S   +K     G        +    +                  V     L  +  
Sbjct: 217 KLVVSRTMSKAFDFAGGRLGYFVANPAFID--------------AVMLVRLPYHLSALSQ 262

Query: 242 AILRVKLRYLERWTEERTRVARTYQKLFEE-KKLPVVYPR 280
           A   V LR+         +++    ++    ++L      
Sbjct: 263 AAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVP 302


>1bw0A [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
          Length = 411

 Score = 50.8 bits (120), Expect = 6e-09
 Identities = 30/265 (11%), Positives = 70/265 (26%), Gaps = 16/265 (6%)

Query: 38  RRLEEEIASFTGVKHG-VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLG 96
                +    + +    V + SG    ++       + GD  +     F    +     G
Sbjct: 87  NSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYG 146

Query: 97  ARVIFVDVDES-TFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLREK 149
             + F +      +  DL+++  +   +K K +I  +             +E +  L E+
Sbjct: 147 IGMHFYNCRPENDWEADLDEIRRLKD-DKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEE 205

Query: 150 YGVMILEDCAQSMG--SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSD 207
             + +  D   +         ++     +             T NL   G     +   D
Sbjct: 206 LRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTANLVVPGWRLGWLLYVD 265

Query: 208 EIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
                     + G ++               +  A+L     +L++   +    A     
Sbjct: 266 PHGN--GPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYN 323

Query: 268 LFEEKKLPVVYPRVEEKGFRYHVFH 292
              E            +G  Y +  
Sbjct: 324 HIGECIGLAP---TMPRGAMYLMSR 345


>3c01F [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
          Length = 87

 Score = 50.6 bits (121), Expect = 7e-09
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 7/72 (9%)

Query: 115 QLEHVLKK-EKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEI 173
            +   +    ++  I  + ++       A+    EK GV ++ D   +            
Sbjct: 3   HITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLARSLFKT------ 56

Query: 174 RKSGSVGDAAIF 185
            +   +      
Sbjct: 57  HRRYDLVSLEEI 68


>3bwnE [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 362

 Score = 50.5 bits (119), Expect = 8e-09
 Identities = 27/265 (10%), Positives = 62/265 (23%), Gaps = 39/265 (14%)

Query: 40  LEEEIASFTGVKHGVGV--------ASGSDALLIALRAMG---VEKGDTVVTTPYTFFAT 88
           LE+ I    GV                 +     A+ A+      +  +VV     +   
Sbjct: 55  LEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTY 114

Query: 89  ASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE 148
                 + + +   + D                 +     +                   
Sbjct: 115 VEETTYVRSGMYKWEGDAWFDK------------KGPYIELVTSPNNPD----------- 151

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLG-TYGDGGMIVTNSD 207
             G +        +  ++ +            D  I  F  +K  G      G  +    
Sbjct: 152 --GTIRETVVEAKVIHDFAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDK 209

Query: 208 EIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQK 267
           E+A++     +  +       +V     L+ +              +   R  +   ++K
Sbjct: 210 EVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSES-ESENFFKYGREMMKNRWEK 268

Query: 268 LFEE-KKLPVVYPRVEEKGFRYHVF 291
           L E  K+          + F  +  
Sbjct: 269 LREVVKESDAFTLPKYPEAFCNYFG 293


>3c01E [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
          Length = 88

 Score = 49.1 bits (117), Expect = 2e-08
 Identities = 7/72 (9%), Positives = 20/72 (27%), Gaps = 7/72 (9%)

Query: 115 QLEHVLKK-EKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEI 173
            +   +    ++  I  + ++       A+    EK GV ++ D   +            
Sbjct: 3   HITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLARSLFKT------ 56

Query: 174 RKSGSVGDAAIF 185
            +   +      
Sbjct: 57  HRRYDLVSLEEI 68


>3caeA [x.x.x] ENDODEOXYRIBONUCLEASE 1
          Length = 132

 Score = 49.0 bits (116), Expect = 2e-08
 Identities = 10/107 (9%), Positives = 24/107 (22%), Gaps = 5/107 (4%)

Query: 56  VASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQ 115
            + G        +           +  YT           G  V    + ES        
Sbjct: 12  ESKGIKFEYEEWKVPYSNNQQNYSSHTYTPDFLLPN----GIFVETKGLWESDDRKKHLL 67

Query: 116 LEHVLKKEKVKAII-PVHLFGRTVDLEALSFLREKYGVMILEDCAQS 161
           +     +  ++ +              +     EK+G+   +    +
Sbjct: 68  IREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPA 114


>3d6kC [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 403

 Score = 48.9 bits (115), Expect = 2e-08
 Identities = 21/245 (8%), Positives = 48/245 (19%), Gaps = 31/245 (12%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHG------ 53
            P  +       +                   G    +  + E  A   G+         
Sbjct: 32  KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEALGLPADLVVAQD 91

Query: 54  --------VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD 105
                   +   S +     + R    E+    +     +    +     G  +      
Sbjct: 92  GSSLNIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEINVPT-- 149

Query: 106 ESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLREKYGVMILEDCA 159
                     +  ++K  +VK          T           L+         I+ D A
Sbjct: 150 ---DEGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNA 206

Query: 160 Q----SMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRI 215
                         +       +      +    +K            ++ + I   +  
Sbjct: 207 YALHTLSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASH 266

Query: 216 LRVHG 220
             V G
Sbjct: 267 ANVRG 271


>2bhxB [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
          Length = 356

 Score = 48.5 bits (114), Expect = 3e-08
 Identities = 20/282 (7%), Positives = 57/282 (20%), Gaps = 26/282 (9%)

Query: 12  ERIRGEILNAIDKLISSGNVI-----LGENVRRLEEEIASFTGVKHGVGV--------AS 58
           +         +     +   +       ++   + E+  +       +            
Sbjct: 15  KPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGG 74

Query: 59  GSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEH 118
            S    +    +  +          ++   A    +L          ++     +     
Sbjct: 75  ASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSE 134

Query: 119 VLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGS 178
                             T+         E     ++ D +  +            +   
Sbjct: 135 FQLN--ENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDIL----------SRPLK 182

Query: 179 VGDAAIFSFFPTKNLGTYGDGGMI-VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLD 237
           V    +      KNLG  G   +I   +       + +      +    +      S   
Sbjct: 183 VNQFGMIYAGAQKNLGPSGVTVVIVKKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYM 242

Query: 238 EIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYP 279
             +       L   E   ++    A+      +E     V  
Sbjct: 243 LRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGH 284


>3d6kB [x.x.x] PUTATIVE AMINOTRANSFERASE
          Length = 399

 Score = 47.7 bits (112), Expect = 5e-08
 Identities = 28/241 (11%), Positives = 59/241 (24%), Gaps = 24/241 (9%)

Query: 2   IPLFDLTRQYERIRGEILNAIDKLISSGNVILGEN--VRRLEEEIASFTGVKHG------ 53
            P  +       +                   G    +  + E  A   G+         
Sbjct: 28  KPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEALGLPADLVVAQD 87

Query: 54  --------VGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVD 105
                   +   S +     + R    E+    +     +    +     G  +     +
Sbjct: 88  GSSLNIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEINVPTDE 147

Query: 106 ESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE---KYGVMILEDCAQS- 161
               +  + +L    + +     +  +  G T   +    L E        I+ D A + 
Sbjct: 148 G--PDGVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYAL 205

Query: 162 --MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVH 219
             +  E+      I  + + G+   F F  T  +   G G     +S E  E        
Sbjct: 206 HTLSDEFPIVHNVIEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANV 265

Query: 220 G 220
            
Sbjct: 266 R 266


>5bj3A [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
          Length = 363

 Score = 46.9 bits (110), Expect = 1e-07
 Identities = 36/243 (14%), Positives = 70/243 (28%), Gaps = 29/243 (11%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGA 97
            +   E       +  +    GS AL    +A+ ++ GD V+     + +        G 
Sbjct: 60  EKFRRENGLSVTPEETIVTVGGSQALFNLFQAI-LDPGDEVIVLSPYWVSYPEMVRFAGG 118

Query: 98  RVIFVDVDES-TFNMDLNQLEHVLKKEKVKAIIPVHLFGRTV------DLEALSFLREKY 150
            V+ V+      F  D  ++       + KA++       T        LEAL+ L  ++
Sbjct: 119 VVVEVETLPEEGFVPDPERVRRA-ITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH 177

Query: 151 GVMILEDCAQSMG--SEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
              ++ D            FS G +    ++      +        T    G      + 
Sbjct: 178 DFYLVSDEIYEHLLYEGEHFSPGRVAPEHTL----TVNGAAKAFAMTGWRIGYACGPKEV 233

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
           I   + + R                +  D I        L   E  +     +AR   + 
Sbjct: 234 IKAMASVSR-------------QSTTSPDTIAQWATLEALTNQE-ASRAFVEMAREAYRR 279

Query: 269 FEE 271
             +
Sbjct: 280 RRD 282


>2d3jA [x.x.x] WNT INHIBITORY FACTOR-1
          Length = 157

 Score = 46.7 bits (110), Expect = 1e-07
 Identities = 7/83 (8%), Positives = 16/83 (19%), Gaps = 10/83 (12%)

Query: 40  LEEEIASFTGVKHGVGV--------ASGSDALLIALRAM--GVEKGDTVVTTPYTFFATA 89
              E  S   +  G+                    ++     + K D V           
Sbjct: 75  YFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMN 134

Query: 90  SAPYRLGARVIFVDVDESTFNMD 112
           S    +          ++    +
Sbjct: 135 SEGNTILQTPQNAIFFKTCLQAE 157


>2b34A [x.x.x] MAR1 RIBONUCLEASE
          Length = 192

 Score = 46.3 bits (109), Expect = 1e-07
 Identities = 10/134 (7%), Positives = 29/134 (21%), Gaps = 8/134 (5%)

Query: 35  ENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTPYTFFA---TASA 91
           + +      +         +   +     +        +  + ++           T   
Sbjct: 55  KGLGHTVPTLKEGLAENTPIFDKTKFSMCIPPTEDTLKKVQNVILVGIEAHVCVLQTTYD 114

Query: 92  PYRLGARVIFVDVDESTFNMDLNQLEHVLKKEK--VKAIIPVHLFGRTVDLEALSFLREK 149
               G  V  V VD    +          K+ +     +         +   +    + K
Sbjct: 115 LLERGLNVHVV-VDA-VSSRSHTDRHFAFKQMEQAGAILTTSEATILGLVGGSDH-PKFK 171

Query: 150 YGVMILEDCAQSMG 163
               ++   A   G
Sbjct: 172 EVQKLILTSAPDTG 185


>1bxgA [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
          Length = 349

 Score = 45.9 bits (108), Expect = 2e-07
 Identities = 11/76 (14%), Positives = 23/76 (30%), Gaps = 7/76 (9%)

Query: 94  RLGARVIFVDVDESTFNMDLNQLEHVLKKE------KVKAIIPVHLFGRTVDLEALSFLR 147
            LG   + ++   ST   D+     +           +   +        +  EA S + 
Sbjct: 216 ALGHTAVALEDVLST-PCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDIL 274

Query: 148 EKYGVMILEDCAQSMG 163
              G++   D   + G
Sbjct: 275 HARGILYAPDFVANAG 290


>1asbA [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 44.4 bits (103), Expect = 6e-07
 Identities = 27/236 (11%), Positives = 60/236 (25%), Gaps = 13/236 (5%)

Query: 38  RRLEEEIASFTGVKHGVGVASGSDALLIALRAMGV---EKGDTVVTTPYTFFATASAPYR 94
             L  + ++    K      +      + + A  +        V  +  ++    S    
Sbjct: 80  ELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNS 139

Query: 95  LGARVIFVDVDE-STFNMDLNQLEHVLKKE--KVKAIIPVHLFGRTV------DLEALSF 145
            G  V      +     +D + L + L +       +        T         + L+ 
Sbjct: 140 AGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQ 199

Query: 146 LREKYGVMILEDCAQS-MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVT 204
           L  + G + L   A        +  +  +R   ++    I +   +KN G Y +     T
Sbjct: 200 LSVEKGWLPLFAFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACT 259

Query: 205 NSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
                +E               +           +   +    LR +        R
Sbjct: 260 LVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMR 315


>1b93B [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
          Length = 151

 Score = 44.0 bits (103), Expect = 7e-07
 Identities = 14/121 (11%), Positives = 30/121 (24%), Gaps = 7/121 (5%)

Query: 45  ASFTGVKHGVGVASGSDALLIALRAMGVEKGDTVVTTP-YTFFATASAPYRLGARVIFVD 103
            + T            D     L +        +     Y    T +   R     +   
Sbjct: 4   TTRTLPARKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYATGTTGNLISRATGMNVNAM 63

Query: 104 VDESTFNMDLNQLEHVLKKEKVKAIIPVHLF----GRTVDLEALSFLREKYGVMILEDCA 159
           +       D       + + K+  +I             D++AL  L   + + +  + A
Sbjct: 64  LSG-PMGGDQQVGAL-ISEGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVA 121

Query: 160 Q 160
            
Sbjct: 122 T 122


>3d19C [x.x.x] CONSERVED METALLOPROTEIN
          Length = 258

 Score = 41.9 bits (98), Expect = 3e-06
 Identities = 11/164 (6%), Positives = 37/164 (22%), Gaps = 14/164 (8%)

Query: 61  DALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVL 120
           +           E    +      +           +     D +       + +    +
Sbjct: 19  EHSFFLRLGFRCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFNAEV 72

Query: 121 KKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVG 180
           + +    I       + + L     L  +    +L D        ++    ++ +     
Sbjct: 73  Q-QAATNIWGFKR--KILGLILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDA 129

Query: 181 DAAIFSFFPTKNLGTYGD-----GGMIVTNSDEIAEESRILRVH 219
                       L    D     G ++  +  ++ + +R     
Sbjct: 130 LPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSND 173


>1ei7A [a.24.5] COAT PROTEIN
          Length = 158

 Score = 41.6 bits (97), Expect = 4e-06
 Identities = 6/94 (6%), Positives = 19/94 (20%), Gaps = 9/94 (9%)

Query: 73  EKGDTVVTTPYTFF--ATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIP 130
           ++  TVV   ++     +     R       V    +  +  +  L            + 
Sbjct: 38  QQARTVVQRQFSEVWKPSPQVTVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVE 97

Query: 131 ------VHLFGRTVDLEAL-SFLREKYGVMILED 157
                               +         ++ +
Sbjct: 98  NQANPTTAETLDATRRVDDATVAIRSAINNLIVE 131


>2eaaA [x.x.x] 7S GLOBULIN-3
          Length = 375

 Score = 40.6 bits (93), Expect = 7e-06
 Identities = 14/143 (9%), Positives = 40/143 (27%), Gaps = 23/143 (16%)

Query: 9   RQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALR 68
            +  +++   +      +  G ++L     +    +    G      V    ++L +   
Sbjct: 229 EKNPQLKDLDVFISSVDMKEGALLLPHYNSKAIVIMVINEGEAKIELVGLSDESLEVQRY 288

Query: 69  AMGVEKGDTVVTTPYTFF-----------------ATASAPYRLGARVIFV-----DVDE 106
              + + D  V                              +  G +   +     +V E
Sbjct: 289 RAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGGKDNVMSEIPTEVLE 348

Query: 107 STFNMDLNQLEHVLKKEKVKAII 129
            +F     ++E  L K++ ++  
Sbjct: 349 VSFPASGKKVEK-LIKKQSESHF 370


>2e7uA [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
          Length = 424

 Score = 40.4 bits (93), Expect = 9e-06
 Identities = 22/148 (14%), Positives = 36/148 (24%), Gaps = 24/148 (16%)

Query: 40  LEEEIASFTGVKHGV-----GVASGSDALLIA----------LRAMGVEKGDTVVTTPYT 84
           L +++         V     G  +   AL +A                      +     
Sbjct: 97  LAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAG 156

Query: 85  FFATASAPYRLGARVIFVDVD-ESTFNMDLNQLEHVLK--KEKVKAIIPVHLFGRTV--- 138
             A                         D   L  VLK   E++ AII   + G      
Sbjct: 157 SGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLV 216

Query: 139 ---DLEALSFLREKYGVMILEDCAQSMG 163
              D        + YGV+++ D   +  
Sbjct: 217 PTEDFLKALHEAKAYGVLLIADEVMTGF 244


>3d19B [x.x.x] CONSERVED METALLOPROTEIN
          Length = 262

 Score = 39.2 bits (91), Expect = 2e-05
 Identities = 12/167 (7%), Positives = 39/167 (23%), Gaps = 15/167 (8%)

Query: 58  SGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLE 117
               +  + L     E    +      +           +     D +       + +  
Sbjct: 21  MKEHSFFLRL-GFRCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFN 73

Query: 118 HVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSG 177
             ++ +    I       + + L     L  +    +L D        ++    ++ +  
Sbjct: 74  AEVQ-QAATNIWGFKR--KILGLILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGK 130

Query: 178 SVGDAAIFSFFPTKNLGTYGD-----GGMIVTNSDEIAEESRILRVH 219
                          L    D     G ++  +  ++ + +R     
Sbjct: 131 LDALPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSND 177


>3d19D [x.x.x] CONSERVED METALLOPROTEIN
          Length = 260

 Score = 38.4 bits (89), Expect = 3e-05
 Identities = 12/167 (7%), Positives = 39/167 (23%), Gaps = 15/167 (8%)

Query: 58  SGSDALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLE 117
               +  + L     E    +      +           +     D +       + +  
Sbjct: 19  MKEHSFFLRL-GFRCEDTQLIEEANQFYRLFEHIEQIAHSYTNETDPE------QIKRFN 71

Query: 118 HVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSG 177
             ++ +    I       + + L     L  +    +L D        ++    ++ +  
Sbjct: 72  AEVQ-QAATNIWGFKR--KILGLILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGK 128

Query: 178 SVGDAAIFSFFPTKNLGTYGD-----GGMIVTNSDEIAEESRILRVH 219
                          L    D     G ++  +  ++ + +R     
Sbjct: 129 LDALPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSND 175


>2bylA [x.x.x] ORNITHINE AMINOTRANSFERASE
          Length = 404

 Score = 38.3 bits (88), Expect = 4e-05
 Identities = 36/218 (16%), Positives = 62/218 (28%), Gaps = 30/218 (13%)

Query: 18  ILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM------- 70
           + + +DKL  +        +   EE I         + + +G +A   A +         
Sbjct: 66  LKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTV 125

Query: 71  -GVEKGDTVV---------TTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVL 120
            G++K    +          T     ++       G        D      DL  LE  L
Sbjct: 126 KGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFD-IIPYNDLPALERAL 184

Query: 121 KKEKVKAIIPVHLFGRT----VDLEALSFLRE---KYGVMILEDCAQSMGSEWKFSSGEI 173
           +   V A +   + G       D   L  +RE   ++ V+ + D  Q  G         +
Sbjct: 185 QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQ-TGLARTGRWLAV 243

Query: 174 RKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIAE 211
                  D  +      K L         V   D+I  
Sbjct: 244 DYENVRPDIVLLG----KALSGGLYPVSAVLCDDDIML 277


>3bwoC [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 359

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 26/265 (9%), Positives = 60/265 (22%), Gaps = 38/265 (14%)

Query: 40  LEEEIASFTGVKHGVGV--------ASGSDALLIALRA---MGVEKGDTVVTTPYTFFAT 88
           LE+ I    GV                 +     A+ A   +   +  +VV     +   
Sbjct: 56  LEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTY 115

Query: 89  ASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE 148
                 + + +   + D                K+     +          +      + 
Sbjct: 116 VEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGTIRETVVAKV 164

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDE 208
                I +           +            D  I  F  +         G  +    E
Sbjct: 165 -----IHDFA---------YYWPHYTPITRRQDHDIMLFTFSITGHAGSRIGWALVKDKE 210

Query: 209 IAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKL 268
           +A++     +  +       +V     L+ +              +   R  +   ++KL
Sbjct: 211 VAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESE-SENFFKYGREMMKNRWEKL 269

Query: 269 FEE-KKLPVVYPRVEEKGFRYHVFH 292
            E  K+          + F  +   
Sbjct: 270 REVVKESDAFTLPKYPEAFCNYFGK 294


>3bwnD [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 359

 Score = 37.8 bits (86), Expect = 5e-05
 Identities = 22/193 (11%), Positives = 44/193 (22%), Gaps = 36/193 (18%)

Query: 37  VRRLEEEIASFTGVKHGVGV--------ASGSDALLIALRAM---GVEKGDTVVTTPYTF 85
              LE+ I    GV                 +     A+ A+      +  +VV     +
Sbjct: 52  EPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFY 111

Query: 86  FATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSF 145
                    + + +   + D                K+     +                
Sbjct: 112 STYVEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGT-----I 155

Query: 146 LREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDG-GMIVT 204
                   ++ D A                     D  +F+F  +K  G  G   G  + 
Sbjct: 156 RETVVNAKVIHDFAYYWPHYT------PITRRQDHDIMLFTF--SKITGHAGSRIGWALV 207

Query: 205 NSDEIAEESRILR 217
              E+A++     
Sbjct: 208 KDKEVAKKMVEYI 220


>1asfA [x.x.x] ASPARTATE AMINOTRANSFERASE
          Length = 396

 Score = 37.0 bits (84), Expect = 9e-05
 Identities = 33/238 (13%), Positives = 66/238 (27%), Gaps = 15/238 (6%)

Query: 37  VRRLEEEIASFTGVKHGVGV--ASGSDALLIALR-AMGVEKGDTVVTTPYTFFATASAPY 93
              L  + ++    K         G+ AL +A            V  +  ++    S   
Sbjct: 79  QELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFN 138

Query: 94  RLGARVIFVDV-DESTFNMDLNQLEHVLKK--EKVKAIIPVHLFGRT------VDLEALS 144
             G  V      D     +D + L + L +       +        T         + L+
Sbjct: 139 SAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLA 198

Query: 145 FLREKYGVMILEDCAQS-MGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD-GGMI 202
            L  + G + L D A        +  +  +R   ++    I +   +KN G Y +  G  
Sbjct: 199 QLSVEKGWLPLFDFAFQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGAC 258

Query: 203 VTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTR 260
              + +     R      A  +  +     +     +   +    LR +        R
Sbjct: 259 TLVAADSETVDRAFSQMKAAIRANYSNPPAHGAS-VVATILSNDALRAIWEQELTDMR 315


>3bwnA [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 362

 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 22/190 (11%), Positives = 45/190 (23%), Gaps = 35/190 (18%)

Query: 40  LEEEIASFTGVKHGVGV----------ASGSDALLI-ALRAMGVEKGDTVVTTPYTFFAT 88
           LE+ I    GV                ++      + AL ++   +  +VV     +   
Sbjct: 56  LEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTY 115

Query: 89  ASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE 148
                 + + +   + D                K+     +          +        
Sbjct: 116 VEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGTI----RETV 160

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGD-GGMIVTNSD 207
                ++ D A                     D  I  F  +K  G  G   G  +    
Sbjct: 161 VDEAKVIHDFAYYWPH--------YTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDK 212

Query: 208 EIAEESRILR 217
           E+A++     
Sbjct: 213 EVAKKMVEYI 222


>3bwnF [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
          Length = 360

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 21/189 (11%), Positives = 43/189 (22%), Gaps = 37/189 (19%)

Query: 40  LEEEIASFTGVKHGVGV--------ASGSDALLIALRAM---GVEKGDTVVTTPYTFFAT 88
           LE+ I    GV                 +     A+ A+      +  +VV     +   
Sbjct: 54  LEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTY 113

Query: 89  ASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDLEALSFLRE 148
                 + + +   + D                K+     +              +    
Sbjct: 114 VEETTYVRSGMYKWEGDAWG-----------FDKKGPYIELVTSPNNPD-----GTIRET 157

Query: 149 KYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDG-GMIVTNSD 207
               +I +           +            D  I  F  +K  G  G   G  +    
Sbjct: 158 VVAKVIHDFA---------YYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDK 208

Query: 208 EIAEESRIL 216
           E+A++    
Sbjct: 209 EVAKKMVEY 217


>3bk2A [x.x.x] METAL DEPENDENT HYDROLASE
          Length = 535

 Score = 33.8 bits (76), Expect = 8e-04
 Identities = 19/131 (14%), Positives = 39/131 (29%), Gaps = 19/131 (14%)

Query: 67  LRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNM---------DLNQLE 117
             A  ++ GDTV+ +         A  R+  R+  +                     +L+
Sbjct: 309 GHAKAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELK 368

Query: 118 HVLKKEKVKAIIPVHLFGRTVDLEALSFLREKYG---VMILEDCAQSMGSEWKFSSGEIR 174
            +L     +  +P H  G                    +I E+     G+ ++ +     
Sbjct: 369 LILNLTTPRFFLPWH--GEVRHQNFKWLAESSRPPEKTLIGEN-----GAVYRLTRETFE 421

Query: 175 KSGSVGDAAIF 185
           K G V    ++
Sbjct: 422 KVGEVPHGVLY 432


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.137    0.383 

Gapped
Lambda     K      H
   0.267   0.0600    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 20,398,098
Number of extensions: 1224249
Number of successful extensions: 15498
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6879
Number of HSP's successfully gapped: 410
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)