RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAD35173.1 tmar0 AAD35173.1 GIB00025CH01 "iron(III) ABC
transporter, permease protein"
         (322 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01032 FecCD "FecCD transport family"                                179   4e-48

>PF01032 FecCD "FecCD transport family"
          Length = 313

 Score =  179 bits (456), Expect = 4e-48
 Identities = 123/300 (41%), Positives = 186/300 (62%), Gaps = 4/300 (1%)

Query: 22  VPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVGAGLSIVGNSFQNLLKNPLVDP 81
           V + P +VL  L G  ++     +  LR+PR+LA+ LVGA L++ G   Q L +NPL DP
Sbjct: 17  VSISPSDVLQALLGGGDSLAQLIVWELRLPRILAALLVGAALAVAGALMQGLTRNPLADP 76

Query: 82  YLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVTT 141
            +LG+SSGA+ G V++  L   L +     +PL +F  +++A+LL  L+AR+ G      
Sbjct: 77  GILGVSSGAALGAVLAILLFPGLSL---LGLPLAAFIGALLAALLVYLLARRRGGLSPLR 133

Query: 142 IVLSGVVVSTLFSSLTYMTIVLLK-RNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLY 200
           ++L+G+ VS LFS+LT + ++L     + ++  WL GS +G+TW DVL  L V++  L+ 
Sbjct: 134 LLLAGIAVSALFSALTSLLLLLADPEQLQSLLFWLMGSLAGATWSDVLILLPVLLIGLIL 193

Query: 201 SLIFSKHLNAMALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHI 260
           +L+ ++ LN ++LG++ A  LGV+VERL+++  L   L+TA  V+  G IGFVGL+VPHI
Sbjct: 194 ALLLARRLNVLSLGDDVARSLGVNVERLRLLLLLLAALLTAAAVAVVGPIGFVGLVVPHI 253

Query: 261 SRYLVGPNFXXXXXXXXXXXXXXXXXCDTAARTFFSPTELPVGVVTALIGAPFLAFLMKR 320
           +R LVGP+                   D  ART  +P ELPVG+VTALIGAPF  +L++R
Sbjct: 254 ARLLVGPDHRRLLPASALLGALLLLLADLLARTLLAPAELPVGIVTALIGAPFFLYLLRR 313


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.320    0.138    0.401 

Gapped
Lambda     K      H
   0.267   0.0525    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 19,032,217
Number of extensions: 1108474
Number of successful extensions: 142692
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3287
Number of HSP's successfully gapped: 250
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)